Citrus Sinensis ID: 029333

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-----
MGSLQLNSYRLASYSLPYNFNCTTNSHKSLKFYKRVSFSRSRIRATATISENDSQANAAEEPPVVNFAFVHSVLLPDGTPDIHFRTACGGQKLRDIMLNSNIDLYGPYARPLSNCAGGGTCGTCMVEVIEGKELLGSRTDKEKEKLKRKPKNWRLACQTTVGTPDSTGLVVIQQLPEWKGHEWKYKKIPTSELPQ
cccccccccccccccccccccccccccccccccccccccccEEEEEEEcccccccccccccccEEEEEEEEEEEcccccccEEEEEEcccHHHHHHHHHcccccccccccccccccccccccccEEEEEccccccccccHHHHHHHcccccccEEEcEEEEccccccEEEEEEcccccccccEEEEEcccccccc
ccEEEEccHcccccccccccccccccccEccccccccEEccccEEEEEccccccccccccccccEEEEEEccccccccccccEEEEccccHHHHHHHHHccccEEcccccEEEcccccccccEEEEEEEccccccccccHHHHHHHcccccccEEEEEEEEcccccEEEEEEEEccccEEEEEcccccccccccc
mgslqlnsyrlasyslpynfncttnshkslkfykrvsfsrsRIRATATIsendsqanaaeeppvvNFAFVHsvllpdgtpdihfrtacggqkLRDIMLNsnidlygpyarplsncagggtcgtCMVEVIegkellgsrtdkekeklkrkpknwrlacqttvgtpdstgLVVIQqlpewkghewkykkiptselpq
mgslqlnsYRLASYSLPYNFNCTTNSHKSLKFYKRVSFSRSRIRATAtisendsqanaaeepPVVNFAFVHSVLLPDGTPDIHFRTACGGQKLRDIMLNSNIDLYGPYARPLSNCAGGGTCGTCMVEVIEgkellgsrtdkekeklkrkpknwrlacqttvgtpdstglvVIQQlpewkghewkykkiptselpq
MGSLQLNSYRLASYSLPYNFNCTTNSHKSLKFYKRVSFSRSRIRATATISENDSQANAAEEPPVVNFAFVHSVLLPDGTPDIHFRTACGGQKLRDIMLNSNIDLYGPYARPLSNCAGGGTCGTCMVEVIEGKELLGSRTDkekeklkrkpkNWRLACQTTVGTPDSTGLVVIQQLPEWKGHEWKYKKIPTSELPQ
*******SYRLASYSLPYNFNCTTNSHKSLKFYKRVSFSR***********************VVNFAFVHSVLLPDGTPDIHFRTACGGQKLRDIMLNSNIDLYGPYARPLSNCAGGGTCGTCMVEVIEGKELL****************NWRLACQTTVGTPDSTGLVVIQQLPEWKGHEWKYKK********
*******************************************************************AFVHSVLLPDGTPDIHFRTACGGQKLRDIMLNSNIDLYGPYARPLSNCAGGGTCGTCMVEVIEGKELLG*********LKRKPKNWRLACQTTVGTPDSTGLVVIQQLPEWKGHEWK***********
MGSLQLNSYRLASYSLPYNFNCTTNSHKSLKFYKRVSFSRSRIRATATIS********AEEPPVVNFAFVHSVLLPDGTPDIHFRTACGGQKLRDIMLNSNIDLYGPYARPLSNCAGGGTCGTCMVEVIEGKELLGSRT***********KNWRLACQTTVGTPDSTGLVVIQQLPEWKGHEWKYKKIPTSELPQ
*GSLQLNSYRLASYSLPYNFN*************RVSFSRSRIRATATIS**********EPPVVNFAFVHSVLLPDGTPDIHFRTACGGQKLRDIMLNSNIDLYGPYARPLSNCAGGGTCGTCMVEVIEGKELLGSRTDKEKEKLKRKPKNWRLACQTTVGTPDSTGLVVIQQLPEWKGHEWKYKKIPT*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGSLQLNSYRLASYSLPYNFNCTTNSHKSLKFYKRVSFSRSRIRATATISENDSQANAAEEPPVVNFAFVHSVLLPDGTPDIHFRTACGGQKLRDIMLNSNIDLYGPYARPLSNCAGGGTCGTCMVEVIEGKELLGSRTDKEKEKLKRKPKNWRLACQTTVGTPDSTGLVVIQQLPEWKGHEWKYKKIPTSELPQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query195
449448008197 PREDICTED: uncharacterized protein LOC10 0.984 0.974 0.645 6e-69
225442545191 PREDICTED: uncharacterized protein LOC10 0.964 0.984 0.726 7e-69
255549894204 electron carrier, putative [Ricinus comm 0.989 0.946 0.686 2e-68
388508898195 unknown [Lotus japonicus] 0.928 0.928 0.684 4e-68
224059120195 predicted protein [Populus trichocarpa] 0.948 0.948 0.688 1e-64
297834498204 hypothetical protein ARALYDRAFT_897928 [ 0.964 0.921 0.628 2e-63
15228165204 NDH-dependent cyclic electron flow 1 [Ar 0.979 0.936 0.618 2e-62
357454845191 Electron carrier/ electron transporter/ 0.835 0.853 0.702 2e-62
356556426194 PREDICTED: uncharacterized protein LOC10 0.907 0.912 0.679 8e-57
357122795187 PREDICTED: uncharacterized protein LOC10 0.933 0.973 0.560 3e-52
>gi|449448008|ref|XP_004141758.1| PREDICTED: uncharacterized protein LOC101218377 [Cucumis sativus] gi|449491773|ref|XP_004158999.1| PREDICTED: uncharacterized protein LOC101228255 [Cucumis sativus] Back     alignment and taxonomy information
 Score =  265 bits (677), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 124/192 (64%), Positives = 155/192 (80%)

Query: 1   MGSLQLNSYRLASYSLPYNFNCTTNSHKSLKFYKRVSFSRSRIRATATISENDSQANAAE 60
           M +L L SY L S S   +FN  TNS  +LK ++ ++F R+++RA  T+ ++ S+A   E
Sbjct: 1   MEALHLGSYHLLSSSSFRSFNYITNSSHTLKRFRPLTFRRTQVRAVGTVPQSQSEATDPE 60

Query: 61  EPPVVNFAFVHSVLLPDGTPDIHFRTACGGQKLRDIMLNSNIDLYGPYARPLSNCAGGGT 120
           EPP+V+ AFV+SVLLPDGTPD+H R ACGGQKLR+IML+SNIDLYGPY+R L NCAGGGT
Sbjct: 61  EPPIVDLAFVNSVLLPDGTPDVHLRRACGGQKLRNIMLDSNIDLYGPYSRFLLNCAGGGT 120

Query: 121 CGTCMVEVIEGKELLGSRTDKEKEKLKRKPKNWRLACQTTVGTPDSTGLVVIQQLPEWKG 180
           CGTCMVE++EGKELL  RTD EK+KLKRKPKNWRLACQTTVG PDS G++V+QQLPEWK 
Sbjct: 121 CGTCMVEIVEGKELLNPRTDIEKDKLKRKPKNWRLACQTTVGKPDSRGMLVVQQLPEWKA 180

Query: 181 HEWKYKKIPTSE 192
           HEW Y+++  S+
Sbjct: 181 HEWGYEEVELSD 192

Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225442545|ref|XP_002284206.1| PREDICTED: uncharacterized protein LOC100241139 [Vitis vinifera] gi|297743235|emb|CBI36102.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255549894|ref|XP_002515998.1| electron carrier, putative [Ricinus communis] gi|223544903|gb|EEF46418.1| electron carrier, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|388508898|gb|AFK42515.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|224059120|ref|XP_002299725.1| predicted protein [Populus trichocarpa] gi|118486517|gb|ABK95098.1| unknown [Populus trichocarpa] gi|222846983|gb|EEE84530.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297834498|ref|XP_002885131.1| hypothetical protein ARALYDRAFT_897928 [Arabidopsis lyrata subsp. lyrata] gi|297330971|gb|EFH61390.1| hypothetical protein ARALYDRAFT_897928 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15228165|ref|NP_188246.1| NDH-dependent cyclic electron flow 1 [Arabidopsis thaliana] gi|9279708|dbj|BAB01265.1| unnamed protein product [Arabidopsis thaliana] gi|14596159|gb|AAK68807.1| Unknown protein [Arabidopsis thaliana] gi|30023670|gb|AAP13368.1| At3g16240 [Arabidopsis thaliana] gi|332642269|gb|AEE75790.1| NDH-dependent cyclic electron flow 1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|357454845|ref|XP_003597703.1| Electron carrier/ electron transporter/ iron ion binding protein [Medicago truncatula] gi|355486751|gb|AES67954.1| Electron carrier/ electron transporter/ iron ion binding protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|356556426|ref|XP_003546527.1| PREDICTED: uncharacterized protein LOC100820264 [Glycine max] Back     alignment and taxonomy information
>gi|357122795|ref|XP_003563100.1| PREDICTED: uncharacterized protein LOC100845974 [Brachypodium distachyon] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query195
TAIR|locus:2094882204 PnsB3 "Photosynthetic NDH subc 0.979 0.936 0.582 3.4e-54
TAIR|locus:2125637180 AT4G32590 [Arabidopsis thalian 0.779 0.844 0.347 2.5e-19
TAIR|locus:2094882 PnsB3 "Photosynthetic NDH subcomplex B 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 560 (202.2 bits), Expect = 3.4e-54, P = 3.4e-54
 Identities = 116/199 (58%), Positives = 137/199 (68%)

Query:     1 MGSLQLNSYRLASYSLPYN--FNCTTNSHKSLKFYKRVSFSRSRIRATATISEND-SQAN 57
             MGS+QL+   L + SLP N  F+  T  +K   ++ R   + +R +    IS    SQ  
Sbjct:     1 MGSVQLSGSGLVA-SLPPNHSFSHKTKLNKPNSYFFRSKHNAARTKTVRAISTAPASQPP 59

Query:    58 AAEEP---PVVNFAFVHSVLLPDGTPDIHFRTACGGQKLRDIMLNSNIDLYGPYARPLSN 114
             AA+EP   P V+FAFVHSVLLPDGTPD+H+R A GGQKLRDIML+SNI+LYGPY++PLSN
Sbjct:    60 AADEPDEPPAVDFAFVHSVLLPDGTPDVHWRRANGGQKLRDIMLDSNIELYGPYSKPLSN 119

Query:   115 CAGGGTCGTCMVEVIEGKELLGSRTDXXXXXXXXXXXNWRLACQTTVGTPDSTGLVVIQQ 174
             CAG GTC TCMVE++ GKELL  RTD           NWRLACQT VG PDSTGLVVIQQ
Sbjct:   120 CAGVGTCATCMVEIVNGKELLNPRTDIEKEKLKRKPKNWRLACQTNVGNPDSTGLVVIQQ 179

Query:   175 LPEWKGHEWKY-KKIPTSE 192
             LPEWK HEW   K IP  +
Sbjct:   180 LPEWKAHEWNIPKNIPNDD 198
GO:0009055 "electron carrier activity" evidence=IEA;ISS
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0051536 "iron-sulfur cluster binding" evidence=IEA
GO:0009535 "chloroplast thylakoid membrane" evidence=IDA
GO:0009773 "photosynthetic electron transport in photosystem I" evidence=IMP
GO:0010598 "NAD(P)H dehydrogenase complex (plastoquinone)" evidence=IMP;IDA
GO:0006098 "pentose-phosphate shunt" evidence=RCA
GO:0019252 "starch biosynthetic process" evidence=RCA
GO:0019288 "isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway" evidence=RCA
GO:0019760 "glucosinolate metabolic process" evidence=RCA
GO:0019761 "glucosinolate biosynthetic process" evidence=RCA
GO:0030003 "cellular cation homeostasis" evidence=RCA
GO:0070838 "divalent metal ion transport" evidence=RCA
TAIR|locus:2125637 AT4G32590 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00034349001
SubName- Full=Chromosome chr9 scaffold_7, whole genome shotgun sequence; (191 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00037644001
SubName- Full=Chromosome chr9 scaffold_90, whole genome shotgun sequence; (395 aa)
   •  • 0.525
GSVIVG00025481001
SubName- Full=Chromosome chr8 scaffold_34, whole genome shotgun sequence; (355 aa)
   •  • 0.459
GSVIVG00036935001
SubName- Full=Chromosome chr1 scaffold_84, whole genome shotgun sequence; (188 aa)
   •  • 0.447
GSVIVG00016085001
SubName- Full=Chromosome chr17 scaffold_12, whole genome shotgun sequence; (471 aa)
   •  • 0.447
GSVIVG00017591001
SubName- Full=Chromosome chr17 scaffold_16, whole genome shotgun sequence; (399 aa)
   •  • 0.429
GSVIVG00022232001
SubName- Full=Chromosome chr6 scaffold_25, whole genome shotgun sequence; (747 aa)
   •  • 0.426

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query195
COG0633102 COG0633, Fdx, Ferredoxin [Energy production and co 1e-11
cd0020784 cd00207, fer2, 2Fe-2S iron-sulfur cluster binding 4e-09
pfam0011177 pfam00111, Fer2, 2Fe-2S iron-sulfur cluster bindin 1e-08
TIGR01941 405 TIGR01941, nqrF, NADH:ubiquinone oxidoreductase, N 4e-08
PRK05464 409 PRK05464, PRK05464, Na(+)-translocating NADH-quino 3e-07
COG3894 614 COG3894, COG3894, Uncharacterized metal-binding pr 2e-06
COG2871 410 COG2871, NqrF, Na+-transporting NADH:ubiquinone ox 4e-06
TIGR02007110 TIGR02007, fdx_isc, ferredoxin, 2Fe-2S type, ISC s 3e-04
>gnl|CDD|223706 COG0633, Fdx, Ferredoxin [Energy production and conversion] Back     alignment and domain information 
 Score = 58.6 bits (142), Expect = 1e-11
 Identities = 27/101 (26%), Positives = 40/101 (39%), Gaps = 11/101 (10%)

Query: 73  VLLPDGTPDIHFRTACGGQKLRDIMLNSNIDLYGPYARPLSNCAGGGTCGTCMVEVIEGK 132
             +              G+ L +    + I +   YA     C  GG CGTC V+V+EG 
Sbjct: 5   AFVTIDGEGDVTEAVNEGETLLEAAERNGIPI--EYA-----C-RGGACGTCRVKVLEGF 56

Query: 133 ELLGSRTDKEKEKLK--RKPKNWRLACQTTVGTPDSTGLVV 171
           + +    + E++ L       N RL+CQ  V   D    VV
Sbjct: 57  DEVSPPEESEEDLLDAAGLEGNSRLSCQCRV-KGDLDIEVV 96

Length = 102
>gnl|CDD|238126 cd00207, fer2, 2Fe-2S iron-sulfur cluster binding domain Back     alignment and domain information
>gnl|CDD|215725 pfam00111, Fer2, 2Fe-2S iron-sulfur cluster binding domain Back     alignment and domain information
>gnl|CDD|130996 TIGR01941, nqrF, NADH:ubiquinone oxidoreductase, Na(+)-translocating, F subunit Back     alignment and domain information
>gnl|CDD|235481 PRK05464, PRK05464, Na(+)-translocating NADH-quinone reductase subunit F; Provisional Back     alignment and domain information
>gnl|CDD|226410 COG3894, COG3894, Uncharacterized metal-binding protein [General function prediction only] Back     alignment and domain information
>gnl|CDD|225426 COG2871, NqrF, Na+-transporting NADH:ubiquinone oxidoreductase, subunit NqrF [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|131062 TIGR02007, fdx_isc, ferredoxin, 2Fe-2S type, ISC system Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 195
TIGR02007110 fdx_isc ferredoxin, 2Fe-2S type, ISC system. This 99.82
PLN02593117 adrenodoxin-like ferredoxin protein 99.82
PTZ00490143 Ferredoxin superfamily; Provisional 99.81
KOG3309159 consensus Ferredoxin [Energy production and conver 99.77
COG0633102 Fdx Ferredoxin [Energy production and conversion] 99.75
TIGR0200897 fdx_plant ferredoxin [2Fe-2S]. This model represen 99.66
PRK1071384 2Fe-2S ferredoxin YfaE; Provisional 99.65
CHL0013499 petF ferredoxin; Validated 99.64
PTZ00038191 ferredoxin; Provisional 99.58
PLN03136148 Ferredoxin; Provisional 99.58
TIGR01941 405 nqrF NADH:ubiquinone oxidoreductase, Na(+)-translo 99.56
PRK05464 409 Na(+)-translocating NADH-quinone reductase subunit 99.53
COG3894 614 Uncharacterized metal-binding protein [General fun 99.52
cd0020784 fer2 2Fe-2S iron-sulfur cluster binding domain. Ir 99.48
COG2871 410 NqrF Na+-transporting NADH:ubiquinone oxidoreducta 99.47
PF0011178 Fer2: 2Fe-2S iron-sulfur cluster binding domain; I 99.46
PRK05713 312 hypothetical protein; Provisional 99.46
PRK07609 339 CDP-6-deoxy-delta-3,4-glucoseen reductase; Validat 99.42
PRK11872 340 antC anthranilate dioxygenase reductase; Provision 99.42
TIGR02160352 PA_CoA_Oxy5 phenylacetate-CoA oxygenase/reductase, 99.31
PRK10684332 HCP oxidoreductase, NADH-dependent; Provisional 99.29
PRK07569 234 bidirectional hydrogenase complex protein HoxU; Va 98.54
PLN00129 276 succinate dehydrogenase [ubiquinone] iron-sulfur s 98.2
PF1351082 Fer2_4: 2Fe-2S iron-sulfur cluster binding domain; 98.18
PRK06259 486 succinate dehydrogenase/fumarate reductase iron-su 98.13
PRK08166 847 NADH dehydrogenase subunit G; Validated 98.06
PF13085110 Fer2_3: 2Fe-2S iron-sulfur cluster binding domain; 98.05
COG0479 234 FrdB Succinate dehydrogenase/fumarate reductase, F 97.82
PRK12577 329 succinate dehydrogenase iron-sulfur subunit; Provi 97.82
PRK12385 244 fumarate reductase iron-sulfur subunit; Provisiona 97.8
PRK13552 239 frdB fumarate reductase iron-sulfur subunit; Provi 97.8
PRK08640 249 sdhB succinate dehydrogenase iron-sulfur subunit; 97.79
PRK12386 251 fumarate reductase iron-sulfur subunit; Provisiona 97.71
PRK07570 250 succinate dehydrogenase/fumarate reductase iron-su 97.71
PRK12576 279 succinate dehydrogenase iron-sulfur subunit; Provi 97.59
PRK11433217 aldehyde oxidoreductase 2Fe-2S subunit; Provisiona 97.51
PRK12575 235 succinate dehydrogenase iron-sulfur subunit; Provi 97.51
TIGR00384 220 dhsB succinate dehydrogenase and fumarate reductas 97.5
PRK12814 652 putative NADPH-dependent glutamate synthase small 97.5
PRK08493 819 NADH dehydrogenase subunit G; Validated 97.26
PRK05950 232 sdhB succinate dehydrogenase iron-sulfur subunit; 97.21
PTZ00305 297 NADH:ubiquinone oxidoreductase; Provisional 97.19
PRK07860 797 NADH dehydrogenase subunit G; Validated 97.15
PRK09130 687 NADH dehydrogenase subunit G; Validated 97.01
PRK09129 776 NADH dehydrogenase subunit G; Validated 96.94
TIGR01973 603 NuoG NADH-quinone oxidoreductase, chain G. This mo 96.8
PRK09908159 xanthine dehydrogenase subunit XdhC; Provisional 96.6
TIGR03193148 4hydroxCoAred 4-hydroxybenzoyl-CoA reductase, gamm 96.52
COG1034 693 NuoG NADH dehydrogenase/NADH:ubiquinone oxidoreduc 96.2
TIGR03198151 pucE xanthine dehydrogenase E subunit. This gene h 95.11
COG2080156 CoxS Aerobic-type carbon monoxide dehydrogenase, s 94.6
COG3383 978 Uncharacterized anaerobic dehydrogenase [General f 94.32
PRK09800 956 putative hypoxanthine oxidase; Provisional 94.08
TIGR03313 951 Se_sel_red_Mo probable selenate reductase, molybde 91.87
TIGR02969 1330 mam_aldehyde_ox aldehyde oxidase. Members of this 91.64
TIGR02963 467 xanthine_xdhA xanthine dehydrogenase, small subuni 91.4
TIGR03311 848 Se_dep_Molyb_1 selenium-dependent molybdenum hydro 89.6
KOG3049 288 consensus Succinate dehydrogenase, Fe-S protein su 86.76
cd06218246 DHOD_e_trans FAD/NAD binding domain in the electro 86.41
PLN00192 1344 aldehyde oxidase 85.97
TIGR01372 985 soxA sarcosine oxidase, alpha subunit family, hete 84.82
PRK00054250 dihydroorotate dehydrogenase electron transfer sub 82.86
PRK06222281 ferredoxin-NADP(+) reductase subunit alpha; Review 81.42
cd06219248 DHOD_e_trans_like1 FAD/NAD binding domain in the e 80.59
cd06220233 DHOD_e_trans_like2 FAD/NAD binding domain in the e 80.31
>TIGR02007 fdx_isc ferredoxin, 2Fe-2S type, ISC system Back     alignment and domain information 
Probab=99.82  E-value=5.8e-20  Score=141.08  Aligned_cols=97  Identities=28%  Similarity=0.522  Sum_probs=80.0

Q ss_pred             CEEEEEeeeeeEcCCCCceEEeEecCCCchHHHHHHHCCCcccCCCCCCCCCCCCCceecCcEEEEecCcccCCCCCHHH
Q 029333           63 PVVNFAFVHSVLLPDGTPDIHFRTACGGQKLRDIMLNSNIDLYGPYARPLSNCAGGGTCGTCMVEVIEGKELLGSRTDKE  142 (195)
Q Consensus        63 p~V~~~~~~~~~~pdG~~~v~~~~a~~GetLLdal~~~GI~l~~p~s~~~~~CgG~G~CGTC~V~V~eG~~~l~~~t~~E  142 (195)
                      |+|.| +.+..+.|.|.. +   ++.+|+|||++|+++|+++       ++.|+|.|.||+|+|+|.+|...+.+.++.|
T Consensus         1 ~~~~~-~~~~~~~p~~~~-~---~~~~g~tLL~a~~~~gi~i-------~~~CgG~G~CgtC~v~V~~G~~~~~~~~~~e   68 (110)
T TIGR02007         1 PKIVF-LPHEDLCPEGAV-V---EAKPGETILDVALDNGIEI-------EHACEKSCACTTCHCIVREGFDSLEEASEQE   68 (110)
T ss_pred             CeEEE-EeCcccCCCCeE-E---EECCCChHHHHHHHcCCCc-------cccCCCCceeCCCEEEEeeccccCCCCCHHH
Confidence            35555 456666787775 3   7899999999999999999       5779999999999999999987888888889


Q ss_pred             HhhcCC---CCCCEEEeeeeEeeCCCCCccEEEecc
Q 029333          143 KEKLKR---KPKNWRLACQTTVGTPDSTGLVVIQQL  175 (195)
Q Consensus       143 ~~~L~~---~~~g~RLACQ~~v~s~d~~G~vvI~~l  175 (195)
                      .+.|+.   ..++||||||+.+.+    ++++|+..
T Consensus        69 ~~~L~~~~~~~~~~RLaCq~~~~~----~dl~v~~~  100 (110)
T TIGR02007        69 EDMLDKAWGLEPDSRLSCQAVVAD----EDLVVEIP  100 (110)
T ss_pred             HHHHhhccCCCCCcEEeeeEEEcC----CCEEEEEC
Confidence            888864   478999999999863    47788644

This family consists of proteobacterial ferredoxins associated with and essential to the ISC system of 2Fe-2S cluster assembly. This family is closely related to (but excludes) eukaryotic (mitochondrial) adrenodoxins, which are ferredoxins involved in electron transfer to P450 cytochromes.
>PLN02593 adrenodoxin-like ferredoxin protein Back     alignment and domain information
>PTZ00490 Ferredoxin superfamily; Provisional Back     alignment and domain information
>KOG3309 consensus Ferredoxin [Energy production and conversion] Back     alignment and domain information
>COG0633 Fdx Ferredoxin [Energy production and conversion] Back     alignment and domain information
>TIGR02008 fdx_plant ferredoxin [2Fe-2S] Back     alignment and domain information
>PRK10713 2Fe-2S ferredoxin YfaE; Provisional Back     alignment and domain information
>CHL00134 petF ferredoxin; Validated Back     alignment and domain information
>PTZ00038 ferredoxin; Provisional Back     alignment and domain information
>PLN03136 Ferredoxin; Provisional Back     alignment and domain information
>TIGR01941 nqrF NADH:ubiquinone oxidoreductase, Na(+)-translocating, F subunit Back     alignment and domain information
>PRK05464 Na(+)-translocating NADH-quinone reductase subunit F; Provisional Back     alignment and domain information
>COG3894 Uncharacterized metal-binding protein [General function prediction only] Back     alignment and domain information
>cd00207 fer2 2Fe-2S iron-sulfur cluster binding domain Back     alignment and domain information
>COG2871 NqrF Na+-transporting NADH:ubiquinone oxidoreductase, subunit NqrF [Energy production and conversion] Back     alignment and domain information
>PF00111 Fer2: 2Fe-2S iron-sulfur cluster binding domain; InterPro: IPR001041 The ferredoxin protein family are electron carrier proteins with an iron-sulphur cofactor that act in a wide variety of metabolic reactions Back     alignment and domain information
>PRK05713 hypothetical protein; Provisional Back     alignment and domain information
>PRK07609 CDP-6-deoxy-delta-3,4-glucoseen reductase; Validated Back     alignment and domain information
>PRK11872 antC anthranilate dioxygenase reductase; Provisional Back     alignment and domain information
>TIGR02160 PA_CoA_Oxy5 phenylacetate-CoA oxygenase/reductase, PaaK subunit Back     alignment and domain information
>PRK10684 HCP oxidoreductase, NADH-dependent; Provisional Back     alignment and domain information
>PRK07569 bidirectional hydrogenase complex protein HoxU; Validated Back     alignment and domain information
>PLN00129 succinate dehydrogenase [ubiquinone] iron-sulfur subunit Back     alignment and domain information
>PF13510 Fer2_4: 2Fe-2S iron-sulfur cluster binding domain; PDB: 1Y56_A 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A Back     alignment and domain information
>PRK06259 succinate dehydrogenase/fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK08166 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>PF13085 Fer2_3: 2Fe-2S iron-sulfur cluster binding domain; PDB: 3P4Q_N 1KFY_N 3CIR_N 3P4R_B 2B76_N 1KF6_B 3P4P_N 3P4S_B 1L0V_B 1ZOY_B Back     alignment and domain information
>COG0479 FrdB Succinate dehydrogenase/fumarate reductase, Fe-S protein subunit [Energy production and conversion] Back     alignment and domain information
>PRK12577 succinate dehydrogenase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK12385 fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK13552 frdB fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK08640 sdhB succinate dehydrogenase iron-sulfur subunit; Reviewed Back     alignment and domain information
>PRK12386 fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK07570 succinate dehydrogenase/fumarate reductase iron-sulfur subunit; Validated Back     alignment and domain information
>PRK12576 succinate dehydrogenase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK11433 aldehyde oxidoreductase 2Fe-2S subunit; Provisional Back     alignment and domain information
>PRK12575 succinate dehydrogenase iron-sulfur subunit; Provisional Back     alignment and domain information
>TIGR00384 dhsB succinate dehydrogenase and fumarate reductase iron-sulfur protein Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>PRK08493 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>PRK05950 sdhB succinate dehydrogenase iron-sulfur subunit; Reviewed Back     alignment and domain information
>PTZ00305 NADH:ubiquinone oxidoreductase; Provisional Back     alignment and domain information
>PRK07860 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>PRK09130 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>PRK09129 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>TIGR01973 NuoG NADH-quinone oxidoreductase, chain G Back     alignment and domain information
>PRK09908 xanthine dehydrogenase subunit XdhC; Provisional Back     alignment and domain information
>TIGR03193 4hydroxCoAred 4-hydroxybenzoyl-CoA reductase, gamma subunit Back     alignment and domain information
>COG1034 NuoG NADH dehydrogenase/NADH:ubiquinone oxidoreductase 75 kD subunit (chain G) [Energy production and conversion] Back     alignment and domain information
>TIGR03198 pucE xanthine dehydrogenase E subunit Back     alignment and domain information
>COG2080 CoxS Aerobic-type carbon monoxide dehydrogenase, small subunit CoxS/CutS homologs [Energy production and conversion] Back     alignment and domain information
>COG3383 Uncharacterized anaerobic dehydrogenase [General function prediction only] Back     alignment and domain information
>PRK09800 putative hypoxanthine oxidase; Provisional Back     alignment and domain information
>TIGR03313 Se_sel_red_Mo probable selenate reductase, molybdenum-binding subunit Back     alignment and domain information
>TIGR02969 mam_aldehyde_ox aldehyde oxidase Back     alignment and domain information
>TIGR02963 xanthine_xdhA xanthine dehydrogenase, small subunit Back     alignment and domain information
>TIGR03311 Se_dep_Molyb_1 selenium-dependent molybdenum hydroxylase 1 Back     alignment and domain information
>KOG3049 consensus Succinate dehydrogenase, Fe-S protein subunit [Energy production and conversion] Back     alignment and domain information
>cd06218 DHOD_e_trans FAD/NAD binding domain in the electron transfer subunit of dihydroorotate dehydrogenase Back     alignment and domain information
>PLN00192 aldehyde oxidase Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>PRK00054 dihydroorotate dehydrogenase electron transfer subunit; Reviewed Back     alignment and domain information
>PRK06222 ferredoxin-NADP(+) reductase subunit alpha; Reviewed Back     alignment and domain information
>cd06219 DHOD_e_trans_like1 FAD/NAD binding domain in the electron transfer subunit of dihydroorotate dehydrogenase-like proteins Back     alignment and domain information
>cd06220 DHOD_e_trans_like2 FAD/NAD binding domain in the electron transfer subunit of dihydroorotate dehydrogenase-like proteins Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query195
1l5p_A93 Ferredoxin; [2Fe-2S] cluster, electron transfer, i 2e-10
2y5c_A109 Adrenodoxin-like protein, mitochondrial; electron 5e-09
3ah7_A113 [2Fe-2S]ferredoxin; [2Fe-2S] cluster, iron-sulfur 9e-09
1i7h_A111 Ferredoxin; 2Fe-2S,electron transport; 1.70A {Esch 1e-08
3n9z_C123 Adrenodoxin; cytochrome P450, 22-hydroxycholestero 3e-08
2bt6_A108 Adrenodoxin 1; ruthenium(II) bipyridyl complex, in 3e-08
3zyy_X 631 Iron-sulfur cluster binding protein; iron-sulfur-b 9e-08
2wlb_A103 ETP1-FD, electron transfer protein 1, mitochondria 2e-07
1uwm_A106 Ferredoxin VI, FDVI; electron transport, metal-bin 3e-07
1xlq_A106 Putidaredoxin, PDX; [2Fe-2S], ferredoxin, oxidored 3e-06
3hui_A126 Ferredoxin; cytochrome P450, electron transfer, ir 5e-06
1b9r_A105 Protein (terpredoxin); structure from molmol, ferr 3e-05
3lxf_A104 Ferredoxin; iron, iron-sulfur, metal-binding, meta 3e-05
1krh_A 338 Benzoate 1,2-dioxygenase reductase; alpha-beta, FA 6e-05
1doi_A128 2Fe-2S ferredoxin; halophilic protein, redox prote 1e-04
>1l5p_A Ferredoxin; [2Fe-2S] cluster, electron transfer, iron-sulfur protein, metalloprotein, oxidoreductase; 2.20A {Trichomonas vaginalis} SCOP: d.15.4.1 Length = 93 Back     alignment and structure
 Score = 54.1 bits (131), Expect = 2e-10
 Identities = 21/57 (36%), Positives = 32/57 (56%), Gaps = 3/57 (5%)

Query: 115 CAGGGTCGTCMVEVIEGKELLGSRTDKEKEKLKRKPKNWRLACQTTVGTPDSTGLVV 171
           C G   CG C+ + + GK  + +  D EKE L+ +P N RLAC  T+ + ++ G V 
Sbjct: 38  CQGNKACGKCICKHVSGK--VAAAEDDEKEFLEDQPANARLACAITL-SGENDGAVF 91
>2y5c_A Adrenodoxin-like protein, mitochondrial; electron transport, iron-sulfur cluster biogenesis; 1.70A {Homo sapiens} Length = 109 Back     alignment and structure
>3ah7_A [2Fe-2S]ferredoxin; [2Fe-2S] cluster, iron-sulfur cluster biosynthes pseudomonas, metal binding protein; 1.90A {Pseudomonas putida} Length = 113 Back     alignment and structure
>1i7h_A Ferredoxin; 2Fe-2S,electron transport; 1.70A {Escherichia coli} SCOP: d.15.4.1 Length = 111 Back     alignment and structure
>3n9z_C Adrenodoxin; cytochrome P450, 22-hydroxycholesterol, cholesterol SIDE CHA cleavage, structural genomics; HET: HEM HC9; 2.17A {Homo sapiens} PDB: 3na1_C* 3p1m_A* 1l6u_A 1l6v_A 1e6e_B* 1cje_A Length = 123 Back     alignment and structure
>2bt6_A Adrenodoxin 1; ruthenium(II) bipyridyl complex, intramolecular electron TRA electron transport, metal-binding; HET: RUA; 1.50A {Bos taurus} SCOP: d.15.4.1 PDB: 1ayf_A 3n9y_C* 2jqr_B* 3na0_C* Length = 108 Back     alignment and structure
>3zyy_X Iron-sulfur cluster binding protein; iron-sulfur-binding protein, ashka family, ATPase; 2.20A {Carboxydothermus hydrogenoformans} Length = 631 Back     alignment and structure
>2wlb_A ETP1-FD, electron transfer protein 1, mitochondrial; iron-sulfur, iron, transport, ferredoxin, adrenodoxin-like, electron transport; 2.60A {Schizosaccharomyces pombe} Length = 103 Back     alignment and structure
>1uwm_A Ferredoxin VI, FDVI; electron transport, metal-binding, iron-sulfur, iron, 2Fe-2S; 2.0A {Rhodobacter capsulatus} SCOP: d.15.4.1 PDB: 1e9m_A Length = 106 Back     alignment and structure
>1xlq_A Putidaredoxin, PDX; [2Fe-2S], ferredoxin, oxidoreductase; 1.45A {Pseudomonas putida} SCOP: d.15.4.1 PDB: 1xlp_A 1oqr_A 1r7s_A 1pdx_A 1yji_A 1yjj_A 1oqq_A 1xln_A 1xlo_A 3lb8_C* 1put_A 1gpx_A Length = 106 Back     alignment and structure
>3hui_A Ferredoxin; cytochrome P450, electron transfer, iron, iron-sulfur, metal-binding, electron transport; 2.01A {Rhodopseudomonas palustris} Length = 126 Back     alignment and structure
>1b9r_A Protein (terpredoxin); structure from molmol, ferredoxin; NMR {Pseudomonas SP} SCOP: d.15.4.1 Length = 105 Back     alignment and structure
>3lxf_A Ferredoxin; iron, iron-sulfur, metal-binding, metal protein; 2.30A {Novosphingobium aromaticivorans} Length = 104 Back     alignment and structure
>1krh_A Benzoate 1,2-dioxygenase reductase; alpha-beta, FAD-binding, ferredoxin, NADH-binding, oxidoreductase; HET: FAD; 1.50A {Acinetobacter SP} SCOP: b.43.4.2 c.25.1.2 d.15.4.2 Length = 338 Back     alignment and structure
>1doi_A 2Fe-2S ferredoxin; halophilic protein, redox protein, iron-sulfur, electron transport; 1.90A {Haloarcula marismortui} SCOP: d.15.4.1 PDB: 1e0z_A* 1e10_A Length = 128 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query195
3hui_A126 Ferredoxin; cytochrome P450, electron transfer, ir 99.87
3lxf_A104 Ferredoxin; iron, iron-sulfur, metal-binding, meta 99.86
2bt6_A108 Adrenodoxin 1; ruthenium(II) bipyridyl complex, in 99.86
2y5c_A109 Adrenodoxin-like protein, mitochondrial; electron 99.86
3ah7_A113 [2Fe-2S]ferredoxin; [2Fe-2S] cluster, iron-sulfur 99.85
3n9z_C123 Adrenodoxin; cytochrome P450, 22-hydroxycholestero 99.83
1xlq_A106 Putidaredoxin, PDX; [2Fe-2S], ferredoxin, oxidored 99.83
1uwm_A106 Ferredoxin VI, FDVI; electron transport, metal-bin 99.82
1i7h_A111 Ferredoxin; 2Fe-2S,electron transport; 1.70A {Esch 99.81
1b9r_A105 Protein (terpredoxin); structure from molmol, ferr 99.8
2wlb_A103 ETP1-FD, electron transfer protein 1, mitochondria 99.8
1l5p_A93 Ferredoxin; [2Fe-2S] cluster, electron transfer, i 99.79
1frr_A95 Ferredoxin I; electron transfer(iron-sulfur protei 99.67
1a70_A97 Ferredoxin; iron-sulfur protein, photosynthesis, e 99.67
1awd_A94 Ferredoxin; electron transport, eukaryotic, green 99.66
1frd_A98 Heterocyst [2Fe-2S] ferredoxin; electron transport 99.65
1czp_A98 Ferredoxin I; [2Fe-2S] protein, crystal reduced wi 99.65
1wri_A93 Ferredoxin II, ferredoxin; electron transport; 1.2 99.65
1iue_A98 Ferredoxin; electron transport, iron-sulfur; 1.70A 99.64
1jq4_A98 Methane monooxygenase component C; [2Fe-2S] ferred 99.63
1krh_A 338 Benzoate 1,2-dioxygenase reductase; alpha-beta, FA 99.58
3zyy_X 631 Iron-sulfur cluster binding protein; iron-sulfur-b 99.54
1doi_A128 2Fe-2S ferredoxin; halophilic protein, redox prote 99.53
2pia_A321 Phthalate dioxygenase reductase; HET: FMN; 2.00A { 99.42
1t3q_A168 Quinoline 2-oxidoreductase small subunit; QOR, mol 98.22
2bs2_B 241 Quinol-fumarate reductase iron-sulfur subunit B; 2 98.17
1kf6_B 243 Fumarate reductase iron-sulfur protein; respiratio 98.09
2wdq_B 238 Succinate dehydrogenase iron-sulfur subunit; succi 97.98
3i9v_3 783 NADH-quinone oxidoreductase subunit 3; electron tr 97.94
3vr8_B 282 Iron-sulfur subunit of succinate dehydrogenase; me 97.9
1rm6_C161 4-hydroxybenzoyl-COA reductase gamma subunit; xant 97.75
1n62_A166 Carbon monoxide dehydrogenase small chain; CODH, m 97.72
2h88_B 252 Succinate dehydrogenase IP subunit; complex II, me 97.72
1ffv_A163 CUTS, iron-sulfur protein of carbon monoxide dehyd 97.69
3c8y_A 574 Iron hydrogenase 1; dithiomethylether, H-cluster, 97.66
3hrd_D160 Nicotinate dehydrogenase small FES subunit; seleni 97.11
1dgj_A 907 Aldehyde oxidoreductase; beta half-barrel, four-he 96.35
1vlb_A 907 Aldehyde oxidoreductase; iron-sulphur cluster; HET 96.33
3nvw_A164 Xanthine dehydrogenase/oxidase; hydroxylase, homod 94.89
2w3s_A 462 Xanthine dehydrogenase; XO, XDH, GOUT, iron, 2Fe-2 94.55
1y56_A 493 Hypothetical protein PH1363; dehydrogenase, protei 89.3
3unc_A 1332 Xanthine dehydrogenase/oxidase; oxidoreductase; HE 85.49
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 85.39
3zyv_A 1335 AOH1; oxidoreductase, molybdenum cofactor; HET: MT 82.38
>3hui_A Ferredoxin; cytochrome P450, electron transfer, iron, iron-sulfur, metal-binding, electron transport; 2.01A {Rhodopseudomonas palustris} Back     alignment and structure
Probab=99.87  E-value=2e-22  Score=157.45  Aligned_cols=103  Identities=25%  Similarity=0.422  Sum_probs=83.7

Q ss_pred             CCCCCCEEEEEeeeeeEcCCCCceEEeEecCCCchHHHHHHHCCCc-ccCCCCCCCCCCCCCceecCcEEEEecCc-ccC
Q 029333           58 AAEEPPVVNFAFVHSVLLPDGTPDIHFRTACGGQKLRDIMLNSNID-LYGPYARPLSNCAGGGTCGTCMVEVIEGK-ELL  135 (195)
Q Consensus        58 ~~~~~p~V~~~~~~~~~~pdG~~~v~~~~a~~GetLLdal~~~GI~-l~~p~s~~~~~CgG~G~CGTC~V~V~eG~-~~l  135 (195)
                      .+..||+|+|      +.++|.. .++ ++.+|+|||++|+++||+ +       ++.|+|.|.||+|+|+|.+|+ ..+
T Consensus        17 ~~~~M~~Vt~------~~~~G~~-~~v-~~~~G~tLL~aa~~~gi~gi-------~~~C~G~G~CgtC~v~v~~G~~~~l   81 (126)
T 3hui_A           17 RGSHMAKINF------VDHTGET-RTV-EVEEGATVMEAAIRNAIPGV-------EAECGGACACATCHVYVDEAWREKV   81 (126)
T ss_dssp             TTCSEEEEEE------ECTTSCE-EEE-EEETTSBHHHHHHTTTCTTC-------CCTTSSSSCCSTTEEEECGGGHHHH
T ss_pred             CCCCceEEEE------EeCCCCE-EEE-EECCCCcHHHHHHHcCCCCC-------ccCCCCCCCCCCCEEEECCCccccc
Confidence            3578999999      2367864 334 789999999999999999 9       578999999999999999997 447


Q ss_pred             CCCCHHHHhhcCC---CCCCEEEeeeeEeeCCCCCccEEEeccCCc
Q 029333          136 GSRTDKEKEKLKR---KPKNWRLACQTTVGTPDSTGLVVIQQLPEW  178 (195)
Q Consensus       136 ~~~t~~E~~~L~~---~~~g~RLACQ~~v~s~d~~G~vvI~~lP~~  178 (195)
                      +++++.|.++|+.   +.++||||||+++. .|++| ++| .+|+.
T Consensus        82 ~~~~~~E~~~L~~~~e~~~g~RLaCQ~~~~-~dldg-l~V-~lp~~  124 (126)
T 3hui_A           82 GGPSPMEEDMLDFGYDVRPNSRLSCQIKVS-NELDG-LIV-TTPER  124 (126)
T ss_dssp             CCCCHHHHHHHTTSSSCCTTEEEGGGCBCC-GGGTT-EEE-ECCSC
T ss_pred             CCCCHHHhhhcCchhhccCCeEEeeeCEEC-cCCCc-EEE-EecCc
Confidence            8889999999973   57899999999995 45554 555 46653
>3lxf_A Ferredoxin; iron, iron-sulfur, metal-binding, metal protein; 2.30A {Novosphingobium aromaticivorans} SCOP: d.15.4.0 Back     alignment and structure
>2bt6_A Adrenodoxin 1; ruthenium(II) bipyridyl complex, intramolecular electron TRA electron transport, metal-binding; HET: RUA; 1.50A {Bos taurus} SCOP: d.15.4.1 PDB: 1ayf_A 3n9y_C* 2jqr_B* 3na0_C* Back     alignment and structure
>2y5c_A Adrenodoxin-like protein, mitochondrial; electron transport, iron-sulfur cluster biogenesis; 1.70A {Homo sapiens} Back     alignment and structure
>3ah7_A [2Fe-2S]ferredoxin; [2Fe-2S] cluster, iron-sulfur cluster biosynthes pseudomonas, metal binding protein; 1.90A {Pseudomonas putida} Back     alignment and structure
>3n9z_C Adrenodoxin; cytochrome P450, 22-hydroxycholesterol, cholesterol SIDE CHA cleavage, structural genomics; HET: HEM HC9; 2.17A {Homo sapiens} SCOP: d.15.4.1 PDB: 3na1_C* 3p1m_A* 1l6u_A 1l6v_A 1e6e_B* 1cje_A Back     alignment and structure
>1xlq_A Putidaredoxin, PDX; [2Fe-2S], ferredoxin, oxidoreductase; 1.45A {Pseudomonas putida} SCOP: d.15.4.1 PDB: 1xlp_A 1oqr_A 1r7s_A 1pdx_A 1yji_A 1yjj_A 1oqq_A 1xln_A 1xlo_A 3lb8_C* 1put_A 1gpx_A Back     alignment and structure
>1uwm_A Ferredoxin VI, FDVI; electron transport, metal-binding, iron-sulfur, iron, 2Fe-2S; 2.0A {Rhodobacter capsulatus} SCOP: d.15.4.1 PDB: 1e9m_A Back     alignment and structure
>1i7h_A Ferredoxin; 2Fe-2S,electron transport; 1.70A {Escherichia coli} SCOP: d.15.4.1 Back     alignment and structure
>1b9r_A Protein (terpredoxin); structure from molmol, ferredoxin; NMR {Pseudomonas SP} SCOP: d.15.4.1 Back     alignment and structure
>2wlb_A ETP1-FD, electron transfer protein 1, mitochondrial; iron-sulfur, iron, transport, ferredoxin, adrenodoxin-like, electron transport; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>1l5p_A Ferredoxin; [2Fe-2S] cluster, electron transfer, iron-sulfur protein, metalloprotein, oxidoreductase; 2.20A {Trichomonas vaginalis} SCOP: d.15.4.1 Back     alignment and structure
>1frr_A Ferredoxin I; electron transfer(iron-sulfur protein); 1.80A {Equisetum arvense} SCOP: d.15.4.1 Back     alignment and structure
>1a70_A Ferredoxin; iron-sulfur protein, photosynthesis, electron transport; 1.70A {Spinacia oleracea} SCOP: d.15.4.1 PDB: 1pfd_A Back     alignment and structure
>1awd_A Ferredoxin; electron transport, eukaryotic, green ALGA, electron transfer, metalloprotein; 1.40A {'chlorella' fusca} SCOP: d.15.4.1 Back     alignment and structure
>1frd_A Heterocyst [2Fe-2S] ferredoxin; electron transport; 1.70A {Nostoc SP} SCOP: d.15.4.1 Back     alignment and structure
>1czp_A Ferredoxin I; [2Fe-2S] protein, crystal reduced with dithionite, electron; 1.17A {Nostoc SP} SCOP: d.15.4.1 PDB: 1ewy_C* 1fxa_A 1qt9_A 1qog_A 1j7c_A 1j7b_A 1qof_A 1qob_A 1j7a_A 1qoa_A 1rfk_A 3p63_A 4fxc_A 3ab5_A 1roe_A 2cjn_A 2cjo_A 1off_A 1dox_A 1doy_A ... Back     alignment and structure
>1wri_A Ferredoxin II, ferredoxin; electron transport; 1.20A {Equisetum arvense} SCOP: d.15.4.1 Back     alignment and structure
>1iue_A Ferredoxin; electron transport, iron-sulfur; 1.70A {Plasmodium falciparum} SCOP: d.15.4.1 Back     alignment and structure
>1jq4_A Methane monooxygenase component C; [2Fe-2S] ferredoxin, oxidoreductase; NMR {Methylococcus capsulatus str} SCOP: d.15.4.2 Back     alignment and structure
>1krh_A Benzoate 1,2-dioxygenase reductase; alpha-beta, FAD-binding, ferredoxin, NADH-binding, oxidoreductase; HET: FAD; 1.50A {Acinetobacter SP} SCOP: b.43.4.2 c.25.1.2 d.15.4.2 Back     alignment and structure
>3zyy_X Iron-sulfur cluster binding protein; iron-sulfur-binding protein, ashka family, ATPase; 2.20A {Carboxydothermus hydrogenoformans} Back     alignment and structure
>1doi_A 2Fe-2S ferredoxin; halophilic protein, redox protein, iron-sulfur, electron transport; 1.90A {Haloarcula marismortui} SCOP: d.15.4.1 PDB: 1e0z_A* 1e10_A Back     alignment and structure
>2pia_A Phthalate dioxygenase reductase; HET: FMN; 2.00A {Burkholderia cepacia} SCOP: b.43.4.2 c.25.1.2 d.15.4.2 Back     alignment and structure
>1t3q_A Quinoline 2-oxidoreductase small subunit; QOR, molybdenum, MCD; HET: FAD MCN; 1.80A {Pseudomonas putida} SCOP: a.56.1.1 d.15.4.2 Back     alignment and structure
>2bs2_B Quinol-fumarate reductase iron-sulfur subunit B; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.1.2.1 d.15.4.2 PDB: 2bs3_B* 1e7p_B* 1qlb_B* 2bs4_B* Back     alignment and structure
>1kf6_B Fumarate reductase iron-sulfur protein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.1.2.1 d.15.4.2 PDB: 1kfy_B* 1l0v_B* 2b76_B* 3cir_B* 3p4p_B* 3p4q_B* 3p4r_B* 3p4s_B* Back     alignment and structure
>2wdq_B Succinate dehydrogenase iron-sulfur subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_B* 2acz_B* 1nek_B* 2wdr_B* 2wdv_B* 2ws3_B* 2wu2_B* 2wu5_B* 2wp9_B* Back     alignment and structure
>3i9v_3 NADH-quinone oxidoreductase subunit 3; electron transport, respiratory chain, cell flavoprotein, FMN, iron, iron-sulfur, membrane; HET: FMN; 3.10A {Thermus thermophilus} PDB: 2ybb_3* 2fug_3* 3iam_3* 3ias_3* 3m9s_3* Back     alignment and structure
>3vr8_B Iron-sulfur subunit of succinate dehydrogenase; membrane protein, reductase, mitochondria MEMB oxidoreductase; HET: FAD HEM RQX EPH; 2.81A {Ascaris suum} PDB: 3vrb_B* Back     alignment and structure
>1rm6_C 4-hydroxybenzoyl-COA reductase gamma subunit; xanthine oxidase family, dimer heterotrimers, oxidoreductase; HET: PCD FAD SF4 EPE; 1.60A {Thauera aromatica} SCOP: a.56.1.1 d.15.4.2 PDB: 1sb3_C* Back     alignment and structure
>1n62_A Carbon monoxide dehydrogenase small chain; CODH, molybdenum, molybdopterin, oxidoreductase; HET: CUB MCN FAD; 1.09A {Oligotropha carboxidovorans} SCOP: a.56.1.1 d.15.4.2 PDB: 1n5w_A* 1n61_A* 1n60_A* 1n63_A* 1zxi_A* Back     alignment and structure
>2h88_B Succinate dehydrogenase IP subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_B* 1yq3_B* 2fbw_B* 2h89_B* 2wqy_B* 3aef_B* 3abv_B* 3ae1_B* 3ae3_B* 3ae2_B* 3ae5_B* 3ae6_B* 3ae7_B* 3ae8_B* 3ae9_B* 3aea_B* 3aeb_B* 3aec_B* 3aed_B* 3aee_B* ... Back     alignment and structure
>1ffv_A CUTS, iron-sulfur protein of carbon monoxide dehydrogenase; hydrolase; HET: ARO PCD FAD; 2.25A {Hydrogenophaga pseudoflava} SCOP: a.56.1.1 d.15.4.2 PDB: 1ffu_A* Back     alignment and structure
>3c8y_A Iron hydrogenase 1; dithiomethylether, H-cluster, iron-sulfur binding, oxidoreductase; HET: HCN; 1.39A {Clostridium pasteurianum} SCOP: c.96.1.1 d.15.4.2 d.58.1.5 PDB: 1c4c_A* 1c4a_A* 1feh_A* Back     alignment and structure
>3hrd_D Nicotinate dehydrogenase small FES subunit; selenium ligand, iron, iron-sulfur, metal-binding, oxidoreductase; HET: MCN FAD; 2.20A {Eubacterium barkeri} Back     alignment and structure
>1dgj_A Aldehyde oxidoreductase; beta half-barrel, four-helix bundle, beta barrel; HET: MCN; 2.80A {Desulfovibrio desulfuricans} SCOP: a.56.1.1 d.15.4.2 d.41.1.1 d.133.1.1 Back     alignment and structure
>1vlb_A Aldehyde oxidoreductase; iron-sulphur cluster; HET: PCD; 1.28A {Desulfovibrio gigas} SCOP: a.56.1.1 d.15.4.2 d.41.1.1 d.133.1.1 PDB: 1sij_A* 1zcs_A* 3fah_A* 3fc4_A* 3l4p_A* Back     alignment and structure
>3nvw_A Xanthine dehydrogenase/oxidase; hydroxylase, homodimer, xanthine oxidase, guanine, oxidoredu; HET: FAD MTE GUN; 1.60A {Bos taurus} PDB: 3etr_A* 3ns1_A* 3nvv_A* 3nrz_A* 3nvy_A* 3nvz_A* 3rca_A* 3sr6_A* 3eub_A* Back     alignment and structure
>2w3s_A Xanthine dehydrogenase; XO, XDH, GOUT, iron, 2Fe-2S, iron-sulfur, oxidoreductase, purine metabolism, molybdenum cofactor, hypoxanthine; HET: MPN FAD XAN; 2.60A {Rhodobacter capsulatus} PDB: 2w3r_A* 2w54_A* 2w55_A* 1jro_A* 1jrp_A* Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>3unc_A Xanthine dehydrogenase/oxidase; oxidoreductase; HET: MTE FAD SAL; 1.65A {Bos taurus} PDB: 3una_A* 3uni_A* 1v97_A* 1fo4_A* 1vdv_A* 3am9_A* 3amz_A* 3ax7_A* 3ax9_A* 3bdj_A* 1n5x_A* 2ckj_A* 2e1q_A* 3an1_A* 2e3t_A* 1wyg_A* 3b9j_B* 1fiq_B* 3b9j_A* 1fiq_A* Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>3zyv_A AOH1; oxidoreductase, molybdenum cofactor; HET: MTE FAD; 2.54A {Mus musculus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 195
d1b9ra_105 d.15.4.1 (A:) 2Fe-2S ferredoxin {Pseudomonas sp., 7e-14
d1l5pa_93 d.15.4.1 (A:) 2Fe-2S ferredoxin {Trichomonas vagin 9e-13
d1i7ha_109 d.15.4.1 (A:) Adrenodoxin-like ferredoxin {Escheri 6e-12
d2bt6a1104 d.15.4.1 (A:5-108) Adrenodoxin {Cow (Bos taurus) [ 4e-11
d1xlqa1106 d.15.4.1 (A:1-106) 2Fe-2S ferredoxin {Pseudomonas 6e-11
d2fug3395 d.15.4.2 (3:1-95) Nadh-quinone oxidoreductase chai 2e-10
d1e9ma_106 d.15.4.1 (A:) 2Fe-2S ferredoxin {Rhodobacter capsu 5e-10
d1a70a_97 d.15.4.1 (A:) 2Fe-2S ferredoxin {Spinach (Spinacia 5e-07
d1krha3104 d.15.4.2 (A:2-105) Benzoate dioxygenase reductase, 2e-06
d1jq4a_98 d.15.4.2 (A:) Methane monooxygenase reductase N-te 2e-06
d1doia_128 d.15.4.1 (A:) 2Fe-2S ferredoxin {Archaeon Haloarcu 3e-06
d2piaa398 d.15.4.2 (A:224-321) Phthalate dioxygenase reducta 3e-04
>d1b9ra_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Pseudomonas sp., terpredoxin [TaxId: 306]} Length = 105 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-Grasp (ubiquitin-like)
superfamily: 2Fe-2S ferredoxin-like
family: 2Fe-2S ferredoxin-related
domain: 2Fe-2S ferredoxin
species: Pseudomonas sp., terpredoxin [TaxId: 306]

 Score = 62.7 bits (152), Expect = 7e-14
 Identities = 26/119 (21%), Positives = 46/119 (38%), Gaps = 22/119 (18%)

Query: 63  PVVNFAFVHSVLLPDGTPDIHFRTACGGQKLRDIMLNSNIDLYGPYARPLSNCAGGGTCG 122
           P V F      +        +   A  GQ L ++   + +         ++ C G   C 
Sbjct: 1   PRVVF------IDEQSG--EYAVDAQDGQSLMEVATQNGVPG------IVAECGGSCVCA 46

Query: 123 TCMVEVIEG-KELLGSRTDKEKEKLKRKP----KNWRLACQTTVGTPDSTGLVVIQQLP 176
           TC +E+ +   E++G     E + L+          RL+CQ  +  P   GL+V  ++P
Sbjct: 47  TCRIEIEDAWVEIVGEANPDENDLLQSTGEPMTAGTRLSCQVFI-DPSMDGLIV--RVP 102
>d1l5pa_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Trichomonas vaginalis [TaxId: 5722]} Length = 93 Back     information, alignment and structure
>d1i7ha_ d.15.4.1 (A:) Adrenodoxin-like ferredoxin {Escherichia coli [TaxId: 562]} Length = 109 Back     information, alignment and structure
>d2bt6a1 d.15.4.1 (A:5-108) Adrenodoxin {Cow (Bos taurus) [TaxId: 9913]} Length = 104 Back     information, alignment and structure
>d1xlqa1 d.15.4.1 (A:1-106) 2Fe-2S ferredoxin {Pseudomonas putida, putidaredoxin [TaxId: 303]} Length = 106 Back     information, alignment and structure
>d2fug33 d.15.4.2 (3:1-95) Nadh-quinone oxidoreductase chain 3, Nqo3, N-terminal domain {Thermus thermophilus [TaxId: 274]} Length = 95 Back     information, alignment and structure
>d1e9ma_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Rhodobacter capsulatus, ferredoxin VI [TaxId: 1061]} Length = 106 Back     information, alignment and structure
>d1a70a_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Spinach (Spinacia oleracea) [TaxId: 3562]} Length = 97 Back     information, alignment and structure
>d1krha3 d.15.4.2 (A:2-105) Benzoate dioxygenase reductase, N-terminal domain {Acinetobacter sp. [TaxId: 472]} Length = 104 Back     information, alignment and structure
>d1jq4a_ d.15.4.2 (A:) Methane monooxygenase reductase N-terminal domain {Methylococcus capsulatus [TaxId: 414]} Length = 98 Back     information, alignment and structure
>d1doia_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Archaeon Haloarcula marismortui [TaxId: 2238]} Length = 128 Back     information, alignment and structure
>d2piaa3 d.15.4.2 (A:224-321) Phthalate dioxygenase reductase, C-terminal domain {Pseudomonas cepacia, db01 [TaxId: 292]} Length = 98 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query195
d1i7ha_109 Adrenodoxin-like ferredoxin {Escherichia coli [Tax 99.9
d1e9ma_106 2Fe-2S ferredoxin {Rhodobacter capsulatus, ferredo 99.88
d1xlqa1106 2Fe-2S ferredoxin {Pseudomonas putida, putidaredox 99.87
d1b9ra_105 2Fe-2S ferredoxin {Pseudomonas sp., terpredoxin [T 99.87
d2bt6a1104 Adrenodoxin {Cow (Bos taurus) [TaxId: 9913]} 99.84
d1l5pa_93 2Fe-2S ferredoxin {Trichomonas vaginalis [TaxId: 5 99.83
d1krha3104 Benzoate dioxygenase reductase, N-terminal domain 99.76
d1frra_95 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258] 99.74
d1a70a_97 2Fe-2S ferredoxin {Spinach (Spinacia oleracea) [Ta 99.73
d1awda_94 2Fe-2S ferredoxin {Chlorella fusca [TaxId: 3073]} 99.73
d1czpa_98 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), 99.73
d1jq4a_98 Methane monooxygenase reductase N-terminal domain 99.72
d1frda_98 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), 99.71
d2fug3395 Nadh-quinone oxidoreductase chain 3, Nqo3, N-termi 99.71
d1iuea_98 2Fe-2S ferredoxin {Malaria parasite (Plasmodium fa 99.7
d2piaa398 Phthalate dioxygenase reductase, C-terminal domain 99.64
d1wria_93 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258] 99.6
d1doia_128 2Fe-2S ferredoxin {Archaeon Haloarcula marismortui 99.53
d1kf6b2105 Fumarate reductase iron-sulfur protein, N-terminal 98.43
d2bs2b2106 Fumarate reductase iron-sulfur protein, N-terminal 98.19
d3c8ya2126 Fe-only hydrogenase, N-terminal domain {Clostridiu 98.11
d1nekb2106 Succinate dehydogenase iron-sulfur protein, N-term 97.62
d1t3qa281 Quinoline 2-oxidoreductase small subunit QorS, N-d 97.58
d1dgja280 Aldehyde oxidoreductase, N-terminal domain {Desulf 97.39
d1vlba280 Aldehyde oxidoreductase, N-terminal domain {Desulf 97.39
d1rm6c281 4-hydroxybenzoyl-CoA reductase gamma subunit HrcC, 96.98
d1ffva279 Carbone monoxide (CO) dehydrogenase iron-sulfur pr 96.91
d1jroa284 Xanthine dehydrogenase chain A, N-terminal domain 96.69
d1n62a279 Carbone monoxide (CO) dehydrogenase iron-sulfur pr 96.68
d1v97a290 Xanthine oxidase, N-terminal domain {Cow (Bos taur 96.43
d1ep3b2160 Dihydroorotate dehydrogenase B, PyrK subunit {Lact 90.3
>d1i7ha_ d.15.4.1 (A:) Adrenodoxin-like ferredoxin {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-Grasp (ubiquitin-like)
superfamily: 2Fe-2S ferredoxin-like
family: 2Fe-2S ferredoxin-related
domain: Adrenodoxin-like ferredoxin
species: Escherichia coli [TaxId: 562]

Probab=99.90  E-value=3.8e-24  Score=160.87  Aligned_cols=101  Identities=28%  Similarity=0.512  Sum_probs=87.4

Q ss_pred             CEEEEEeeeeeEcCCCCceEEeEecCCCchHHHHHHHCCCcccCCCCCCCCCCCCCceecCcEEEEecCcccCCCCCHHH
Q 029333           63 PVVNFAFVHSVLLPDGTPDIHFRTACGGQKLRDIMLNSNIDLYGPYARPLSNCAGGGTCGTCMVEVIEGKELLGSRTDKE  142 (195)
Q Consensus        63 p~V~~~~~~~~~~pdG~~~v~~~~a~~GetLLdal~~~GI~l~~p~s~~~~~CgG~G~CGTC~V~V~eG~~~l~~~t~~E  142 (195)
                      |||+| +.+..++|+|.. +   ++.+|+|||++|+++||++       ++.|+|.|.||+|+|+|.+|.+.+.++++.|
T Consensus         1 pki~~-~p~~~~~p~g~~-v---~~~~G~tLl~aa~~~gi~i-------~~~CgG~g~CgtC~v~v~~G~~~l~~~~~~E   68 (109)
T d1i7ha_           1 PKIVI-LPHQDLCPDGAV-L---EANSGETILDAALRNGIEI-------EHACEKSCACTTCHCIVREGFDSLPESSEQE   68 (109)
T ss_dssp             CEEEE-CCBTTTBTTCEE-E---ECCTTCBHHHHHHHTTCCC-------CCTTSSSSCCSTTEEEEEECGGGSCCCCHHH
T ss_pred             CeEEE-ecCcccCCCCcE-E---EeCCCCcHHHHHHHcCCCC-------CcCCCCcceeCCeEEEeecCccccCCCChHH
Confidence            78999 788888899975 3   7899999999999999999       5789999999999999999999999999999


Q ss_pred             HhhcCC---CCCCEEEeeeeEeeCCCCCccEEEeccCCccc
Q 029333          143 KEKLKR---KPKNWRLACQTTVGTPDSTGLVVIQQLPEWKG  180 (195)
Q Consensus       143 ~~~L~~---~~~g~RLACQ~~v~s~d~~G~vvI~~lP~~~~  180 (195)
                      .++|..   .+++||||||+++.+    .+++|+ +|++..
T Consensus        69 ~~~l~~~~~~~~~~RLaCQ~~v~~----~dl~V~-lP~~t~  104 (109)
T d1i7ha_          69 DDMLDKAWGLEPESRLSCQARVTD----EDLVVE-IPRYTI  104 (109)
T ss_dssp             HHHHTTCTTCCTTEEETTTCBCCS----SCEEEE-CCSCCC
T ss_pred             hhhhhccccCCCCeEEEEeeEECC----CCEEEE-eCccch
Confidence            998865   578999999999953    377874 677443
>d1e9ma_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Rhodobacter capsulatus, ferredoxin VI [TaxId: 1061]} Back     information, alignment and structure
>d1xlqa1 d.15.4.1 (A:1-106) 2Fe-2S ferredoxin {Pseudomonas putida, putidaredoxin [TaxId: 303]} Back     information, alignment and structure
>d1b9ra_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Pseudomonas sp., terpredoxin [TaxId: 306]} Back     information, alignment and structure
>d2bt6a1 d.15.4.1 (A:5-108) Adrenodoxin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1l5pa_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Trichomonas vaginalis [TaxId: 5722]} Back     information, alignment and structure
>d1krha3 d.15.4.2 (A:2-105) Benzoate dioxygenase reductase, N-terminal domain {Acinetobacter sp. [TaxId: 472]} Back     information, alignment and structure
>d1frra_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258]} Back     information, alignment and structure
>d1a70a_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1awda_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Chlorella fusca [TaxId: 3073]} Back     information, alignment and structure
>d1czpa_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), pcc 7119 and 7120 [TaxId: 1167]} Back     information, alignment and structure
>d1jq4a_ d.15.4.2 (A:) Methane monooxygenase reductase N-terminal domain {Methylococcus capsulatus [TaxId: 414]} Back     information, alignment and structure
>d1frda_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), pcc 7119 and 7120 [TaxId: 1167]} Back     information, alignment and structure
>d2fug33 d.15.4.2 (3:1-95) Nadh-quinone oxidoreductase chain 3, Nqo3, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1iuea_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d2piaa3 d.15.4.2 (A:224-321) Phthalate dioxygenase reductase, C-terminal domain {Pseudomonas cepacia, db01 [TaxId: 292]} Back     information, alignment and structure
>d1wria_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258]} Back     information, alignment and structure
>d1doia_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1kf6b2 d.15.4.2 (B:1-105) Fumarate reductase iron-sulfur protein, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bs2b2 d.15.4.2 (B:1-106) Fumarate reductase iron-sulfur protein, N-terminal domain {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d3c8ya2 d.15.4.2 (A:1-126) Fe-only hydrogenase, N-terminal domain {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1nekb2 d.15.4.2 (B:1-106) Succinate dehydogenase iron-sulfur protein, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t3qa2 d.15.4.2 (A:7-87) Quinoline 2-oxidoreductase small subunit QorS, N-domain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1dgja2 d.15.4.2 (A:1-80) Aldehyde oxidoreductase, N-terminal domain {Desulfovibrio desulfuricans [TaxId: 876]} Back     information, alignment and structure
>d1vlba2 d.15.4.2 (A:1-80) Aldehyde oxidoreductase, N-terminal domain {Desulfovibrio gigas [TaxId: 879]} Back     information, alignment and structure
>d1rm6c2 d.15.4.2 (C:1-81) 4-hydroxybenzoyl-CoA reductase gamma subunit HrcC, N-terminal domain {Thauera aromatica [TaxId: 59405]} Back     information, alignment and structure
>d1ffva2 d.15.4.2 (A:3-81) Carbone monoxide (CO) dehydrogenase iron-sulfur protein, N-domain {Hydrogenophaga pseudoflava [TaxId: 47421]} Back     information, alignment and structure
>d1jroa2 d.15.4.2 (A:1-84) Xanthine dehydrogenase chain A, N-terminal domain {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1n62a2 d.15.4.2 (A:3-81) Carbone monoxide (CO) dehydrogenase iron-sulfur protein, N-domain {Oligotropha carboxidovorans, formerly Pseudomonas carboxydovorans [TaxId: 40137]} Back     information, alignment and structure
>d1v97a2 d.15.4.2 (A:3-92) Xanthine oxidase, N-terminal domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ep3b2 c.25.1.3 (B:103-262) Dihydroorotate dehydrogenase B, PyrK subunit {Lactococcus lactis, isozyme B [TaxId: 1358]} Back     information, alignment and structure