Citrus Sinensis ID: 029343
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 194 | ||||||
| 224125100 | 271 | predicted protein [Populus trichocarpa] | 0.592 | 0.424 | 0.663 | 3e-31 | |
| 255542812 | 221 | conserved hypothetical protein [Ricinus | 0.396 | 0.348 | 0.734 | 6e-26 | |
| 356533558 | 255 | PREDICTED: uncharacterized protein LOC10 | 0.489 | 0.372 | 0.565 | 1e-24 | |
| 449454057 | 267 | PREDICTED: uncharacterized protein LOC10 | 0.314 | 0.228 | 0.838 | 6e-23 | |
| 124359146 | 263 | TPR repeat [Medicago truncatula] | 0.319 | 0.235 | 0.75 | 7e-21 | |
| 357441797 | 265 | hypothetical protein MTR_1g083600 [Medic | 0.319 | 0.233 | 0.75 | 9e-21 | |
| 217073934 | 265 | unknown [Medicago truncatula] | 0.319 | 0.233 | 0.734 | 4e-20 | |
| 297829092 | 257 | binding protein [Arabidopsis lyrata subs | 0.525 | 0.396 | 0.517 | 1e-19 | |
| 225450751 | 270 | PREDICTED: uncharacterized protein LOC10 | 0.314 | 0.225 | 0.758 | 1e-19 | |
| 30679555 | 257 | tetratricopeptide repeat-containing prot | 0.319 | 0.241 | 0.730 | 3e-19 |
| >gi|224125100|ref|XP_002319500.1| predicted protein [Populus trichocarpa] gi|222857876|gb|EEE95423.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 140 bits (352), Expect = 3e-31, Method: Compositional matrix adjust.
Identities = 79/119 (66%), Positives = 87/119 (73%), Gaps = 4/119 (3%)
Query: 44 MALTQHVLKPTINPPLYSFHRSLLTSKAPLSVQTHINS-LFST---PRGHYLQNRAPTFT 99
MALT + P S H+ LT+ P S +TH NS FST R H LQN PTFT
Sbjct: 1 MALTHNFNHIFPTPSSSSKHKHSLTTTLPFSPKTHTNSHFFSTNIPSRIHNLQNPLPTFT 60
Query: 100 RRLFIPSVSGIWDALTGGNNNSREAVVAIRRGMLLFRQGDVVGSVAEFDKAIELDPRQK 158
RRLF+PSVSGIWDALTGGNNN REAV+AIRRGMLLFRQGDV+GS+ EFDKAIELD RQK
Sbjct: 61 RRLFLPSVSGIWDALTGGNNNPREAVMAIRRGMLLFRQGDVLGSLVEFDKAIELDTRQK 119
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255542812|ref|XP_002512469.1| conserved hypothetical protein [Ricinus communis] gi|223548430|gb|EEF49921.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|356533558|ref|XP_003535330.1| PREDICTED: uncharacterized protein LOC100809261 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449454057|ref|XP_004144772.1| PREDICTED: uncharacterized protein LOC101209381 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|124359146|gb|ABD28339.2| TPR repeat [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|357441797|ref|XP_003591176.1| hypothetical protein MTR_1g083600 [Medicago truncatula] gi|355480224|gb|AES61427.1| hypothetical protein MTR_1g083600 [Medicago truncatula] gi|388510044|gb|AFK43088.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|217073934|gb|ACJ85327.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|297829092|ref|XP_002882428.1| binding protein [Arabidopsis lyrata subsp. lyrata] gi|297328268|gb|EFH58687.1| binding protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|225450751|ref|XP_002279298.1| PREDICTED: uncharacterized protein LOC100240883 [Vitis vinifera] gi|296089711|emb|CBI39530.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|30679555|ref|NP_683531.2| tetratricopeptide repeat-containing protein [Arabidopsis thaliana] gi|27311659|gb|AAO00795.1| Unknown protein [Arabidopsis thaliana] gi|30023732|gb|AAP13399.1| At3g05625 [Arabidopsis thaliana] gi|332640747|gb|AEE74268.1| tetratricopeptide repeat-containing protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 194 | ||||||
| TAIR|locus:504955885 | 257 | AT3G05625 "AT3G05625" [Arabido | 0.402 | 0.303 | 0.620 | 2.1e-20 |
| TAIR|locus:504955885 AT3G05625 "AT3G05625" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 241 (89.9 bits), Expect = 2.1e-20, P = 2.1e-20
Identities = 49/79 (62%), Positives = 60/79 (75%)
Query: 81 SLFSTPRGHYLQNRAPTFTRRLFIPSVSGIWDALTGG-NNNSREAVVAIRRGMLLFRQGD 139
S F T + ++ +RRLF+PSVS IWDA+TGG ++N REA+ A+RRGM LFRQGD
Sbjct: 25 SPFKTLSPQFSRHPPHALSRRLFLPSVSSIWDAITGGGDSNPREAIAAVRRGMQLFRQGD 84
Query: 140 VVGSVAEFDKAIELDPRQK 158
V GSVAEFD+AI LDPRQK
Sbjct: 85 VAGSVAEFDRAIILDPRQK 103
Parameters:
V=100
filter=SEG
E=0.001
ctxfactor=1.00
Query ----- As Used ----- ----- Computed ----
Frame MatID Matrix name Lambda K H Lambda K H
+0 0 BLOSUM62 0.324 0.137 0.406 same same same
Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a
Query
Frame MatID Length Eff.Length E S W T X E2 S2
+0 0 194 194 0.00076 111 3 11 22 0.40 32
31 0.43 35
Statistics:
Database: /share/blast/go-seqdb.fasta
Title: go_20130330-seqdb.fasta
Posted: 5:47:42 AM PDT Apr 1, 2013
Created: 5:47:42 AM PDT Apr 1, 2013
Format: XDF-1
# of letters in database: 169,044,731
# of sequences in database: 368,745
# of database sequences satisfying E: 1
No. of states in DFA: 567 (60 KB)
Total size of DFA: 147 KB (2091 KB)
Time to generate neighborhood: 0.00u 0.00s 0.00t Elapsed: 00:00:00
No. of threads or processors used: 24
Search cpu time: 17.10u 0.16s 17.26t Elapsed: 00:00:01
Total cpu time: 17.10u 0.16s 17.26t Elapsed: 00:00:01
Start: Fri May 10 16:21:53 2013 End: Fri May 10 16:21:54 2013
|
|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| eugene3.00130116 | hypothetical protein (271 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 194 | |||
| pfam13414 | 69 | pfam13414, TPR_11, TPR repeat | 2e-04 | |
| pfam07719 | 34 | pfam07719, TPR_2, Tetratricopeptide repeat | 0.003 |
| >gnl|CDD|222112 pfam13414, TPR_11, TPR repeat | Back alignment and domain information |
|---|
Score = 38.1 bits (89), Expect = 2e-04
Identities = 12/34 (35%), Positives = 18/34 (52%)
Query: 122 REAVVAIRRGMLLFRQGDVVGSVAEFDKAIELDP 155
A G LF+ GD ++ ++KA+ELDP
Sbjct: 1 DNAEALKNLGNALFKLGDYDEAIEAYEKALELDP 34
|
Length = 69 |
| >gnl|CDD|191825 pfam07719, TPR_2, Tetratricopeptide repeat | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 194 | |||
| PF00515 | 34 | TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 | 97.77 | |
| PF13414 | 69 | TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A | 97.58 | |
| PF13414 | 69 | TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A | 97.21 | |
| PF07719 | 34 | TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 | 97.17 | |
| PF13432 | 65 | TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL | 97.16 | |
| PF13371 | 73 | TPR_9: Tetratricopeptide repeat | 97.05 | |
| PF13181 | 34 | TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ | 96.78 | |
| smart00028 | 34 | TPR Tetratricopeptide repeats. Repeats present in | 96.62 | |
| KOG0547 | 606 | consensus Translocase of outer mitochondrial membr | 96.08 | |
| PRK15359 | 144 | type III secretion system chaperone protein SscB; | 95.87 | |
| PRK11189 | 296 | lipoprotein NlpI; Provisional | 95.66 | |
| PRK15359 | 144 | type III secretion system chaperone protein SscB; | 95.04 | |
| PLN03098 | 453 | LPA1 LOW PSII ACCUMULATION1; Provisional | 94.82 | |
| PLN03088 | 356 | SGT1, suppressor of G2 allele of SKP1; Provisional | 93.89 | |
| PF13428 | 44 | TPR_14: Tetratricopeptide repeat | 93.72 | |
| PRK11189 | 296 | lipoprotein NlpI; Provisional | 93.64 | |
| PF13174 | 33 | TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ | 93.25 | |
| KOG0543 | 397 | consensus FKBP-type peptidyl-prolyl cis-trans isom | 93.21 | |
| PLN03088 | 356 | SGT1, suppressor of G2 allele of SKP1; Provisional | 93.1 | |
| PF13432 | 65 | TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL | 92.95 | |
| TIGR02521 | 234 | type_IV_pilW type IV pilus biogenesis/stability pr | 92.34 | |
| TIGR02552 | 135 | LcrH_SycD type III secretion low calcium response | 92.12 | |
| TIGR00990 | 615 | 3a0801s09 mitochondrial precursor proteins import | 91.8 | |
| PRK10370 | 198 | formate-dependent nitrite reductase complex subuni | 91.58 | |
| cd00189 | 100 | TPR Tetratricopeptide repeat domain; typically con | 91.46 | |
| KOG0547 | 606 | consensus Translocase of outer mitochondrial membr | 91.31 | |
| cd00189 | 100 | TPR Tetratricopeptide repeat domain; typically con | 91.27 | |
| TIGR02552 | 135 | LcrH_SycD type III secretion low calcium response | 90.95 | |
| PRK12370 | 553 | invasion protein regulator; Provisional | 90.86 | |
| TIGR02795 | 119 | tol_pal_ybgF tol-pal system protein YbgF. Members | 90.24 | |
| TIGR00990 | 615 | 3a0801s09 mitochondrial precursor proteins import | 89.8 | |
| TIGR02521 | 234 | type_IV_pilW type IV pilus biogenesis/stability pr | 89.78 | |
| PF14559 | 68 | TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN | 88.83 | |
| PRK02603 | 172 | photosystem I assembly protein Ycf3; Provisional | 88.09 | |
| PRK10370 | 198 | formate-dependent nitrite reductase complex subuni | 88.08 | |
| PRK12370 | 553 | invasion protein regulator; Provisional | 87.91 | |
| PRK11906 | 458 | transcriptional regulator; Provisional | 87.5 | |
| KOG0553 | 304 | consensus TPR repeat-containing protein [General f | 86.04 | |
| PRK09782 | 987 | bacteriophage N4 receptor, outer membrane subunit; | 85.77 | |
| TIGR02795 | 119 | tol_pal_ybgF tol-pal system protein YbgF. Members | 85.42 | |
| TIGR03302 | 235 | OM_YfiO outer membrane assembly lipoprotein YfiO. | 85.19 | |
| PF13429 | 280 | TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 | 85.07 | |
| PRK15363 | 157 | pathogenicity island 2 chaperone protein SscA; Pro | 84.58 | |
| CHL00033 | 168 | ycf3 photosystem I assembly protein Ycf3 | 83.93 | |
| COG3063 | 250 | PilF Tfp pilus assembly protein PilF [Cell motilit | 82.07 | |
| PRK11906 | 458 | transcriptional regulator; Provisional | 81.62 | |
| TIGR02917 | 899 | PEP_TPR_lipo putative PEP-CTERM system TPR-repeat | 80.73 | |
| TIGR03302 | 235 | OM_YfiO outer membrane assembly lipoprotein YfiO. | 80.22 |
| >PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
Probab=97.77 E-value=2.8e-05 Score=44.72 Aligned_cols=33 Identities=30% Similarity=0.477 Sum_probs=30.3
Q ss_pred hHHHHHHHHHhhhhccccccHHHHHHHhhcCcc
Q 029343 124 AVVAIRRGMLLFRQGDVVGSVAEFDKAIELDPR 156 (194)
Q Consensus 124 a~aaIRRGM~lFrqgDVeGSIaDFDkAIeLDPR 156 (194)
|.++.++|+.++.+|+.+.+++.|.+|+++||.
T Consensus 1 a~~~~~~g~~~~~~~~~~~A~~~~~~al~~~p~ 33 (34)
T PF00515_consen 1 AEAYYNLGNAYFQLGDYEEALEYYQRALELDPD 33 (34)
T ss_dssp HHHHHHHHHHHHHTT-HHHHHHHHHHHHHHSTT
T ss_pred CHHHHHHHHHHHHhCCchHHHHHHHHHHHHCcC
Confidence 578899999999999999999999999999996
|
It mediates protein-protein interactions and the assembly of multiprotein complexes []. The TPR motif consists of 3-16 tandem-repeats of 34 amino acids residues, although individual TPR motifs can be dispersed in the protein sequence. Sequence alignment of the TPR domains reveals a consensus sequence defined by a pattern of small and large amino acids. TPR motifs have been identified in various different organisms, ranging from bacteria to humans. Proteins containing TPRs are involved in a variety of biological processes, such as cell cycle regulation, transcriptional control, mitochondrial and peroxisomal protein transport, neurogenesis and protein folding. The X-ray structure of a domain containing three TPRs from protein phosphatase 5 revealed that TPR adopts a helix-turn-helix arrangement, with adjacent TPR motifs packing in a parallel fashion, resulting in a spiral of repeating anti-parallel alpha-helices []. The two helices are denoted helix A and helix B. The packing angle between helix A and helix B is ~24 degrees; within a single TPR and generates a right-handed superhelical shape. Helix A interacts with helix B and with helix A' of the next TPR. Two protein surfaces are generated: the inner concave surface is contributed to mainly by residue on helices A, and the other surface presents residues from both helices A and B. ; GO: 0005515 protein binding; PDB: 3SF4_C 2LNI_A 1ELW_A 2C0M_A 1FCH_B 3R9A_B 2J9Q_A 2C0L_A 1KT1_A 3FWV_A .... |
| >PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A | Back alignment and domain information |
|---|
| >PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A | Back alignment and domain information |
|---|
| >PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B | Back alignment and domain information |
|---|
| >PF13371 TPR_9: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A | Back alignment and domain information |
|---|
| >smart00028 TPR Tetratricopeptide repeats | Back alignment and domain information |
|---|
| >KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK15359 type III secretion system chaperone protein SscB; Provisional | Back alignment and domain information |
|---|
| >PRK11189 lipoprotein NlpI; Provisional | Back alignment and domain information |
|---|
| >PRK15359 type III secretion system chaperone protein SscB; Provisional | Back alignment and domain information |
|---|
| >PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional | Back alignment and domain information |
|---|
| >PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional | Back alignment and domain information |
|---|
| >PF13428 TPR_14: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PRK11189 lipoprotein NlpI; Provisional | Back alignment and domain information |
|---|
| >PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A | Back alignment and domain information |
|---|
| >KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional | Back alignment and domain information |
|---|
| >PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B | Back alignment and domain information |
|---|
| >TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW | Back alignment and domain information |
|---|
| >TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD | Back alignment and domain information |
|---|
| >TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) | Back alignment and domain information |
|---|
| >PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional | Back alignment and domain information |
|---|
| >cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C | Back alignment and domain information |
|---|
| >KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C | Back alignment and domain information |
|---|
| >TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD | Back alignment and domain information |
|---|
| >PRK12370 invasion protein regulator; Provisional | Back alignment and domain information |
|---|
| >TIGR02795 tol_pal_ybgF tol-pal system protein YbgF | Back alignment and domain information |
|---|
| >TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) | Back alignment and domain information |
|---|
| >TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW | Back alignment and domain information |
|---|
| >PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A | Back alignment and domain information |
|---|
| >PRK02603 photosystem I assembly protein Ycf3; Provisional | Back alignment and domain information |
|---|
| >PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional | Back alignment and domain information |
|---|
| >PRK12370 invasion protein regulator; Provisional | Back alignment and domain information |
|---|
| >PRK11906 transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >KOG0553 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR02795 tol_pal_ybgF tol-pal system protein YbgF | Back alignment and domain information |
|---|
| >TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO | Back alignment and domain information |
|---|
| >PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B | Back alignment and domain information |
|---|
| >PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional | Back alignment and domain information |
|---|
| >CHL00033 ycf3 photosystem I assembly protein Ycf3 | Back alignment and domain information |
|---|
| >COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK11906 transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 194 | |||
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 4e-04 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 5e-04 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 5e-04 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 7e-04 |
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 | Back alignment and structure |
|---|
Score = 39.2 bits (92), Expect = 4e-04
Identities = 10/38 (26%), Positives = 19/38 (50%)
Query: 118 NNNSREAVVAIRRGMLLFRQGDVVGSVAEFDKAIELDP 155
N R+ G+ ++GD+ +V F+ A++ DP
Sbjct: 58 ENPLRDHPQPFEEGLRRLQEGDLPNAVLLFEAAVQQDP 95
|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 194 | |||
| 4gco_A | 126 | Protein STI-1; structural genomics, PSI-biology, m | 97.43 | |
| 4gco_A | 126 | Protein STI-1; structural genomics, PSI-biology, m | 97.06 | |
| 3rkv_A | 162 | Putative peptidylprolyl isomerase; structural geno | 97.03 | |
| 3ma5_A | 100 | Tetratricopeptide repeat domain protein; NESG, str | 97.01 | |
| 2l6j_A | 111 | TPR repeat-containing protein associated with HSP; | 96.98 | |
| 3upv_A | 126 | Heat shock protein STI1; TPR-fold, adaptor protein | 96.92 | |
| 3vtx_A | 184 | MAMA; tetratricopeptide repeats (TPR) containing p | 96.92 | |
| 4gcn_A | 127 | Protein STI-1; structural genomics, PSI-biology, m | 96.87 | |
| 3vtx_A | 184 | MAMA; tetratricopeptide repeats (TPR) containing p | 96.8 | |
| 2kc7_A | 99 | BFR218_protein; tetratricopeptide repeat, all-alph | 96.76 | |
| 4gcn_A | 127 | Protein STI-1; structural genomics, PSI-biology, m | 96.73 | |
| 3gyz_A | 151 | Chaperone protein IPGC; asymmetric homodimer, tetr | 96.66 | |
| 3upv_A | 126 | Heat shock protein STI1; TPR-fold, adaptor protein | 96.62 | |
| 4ga2_A | 150 | E3 SUMO-protein ligase ranbp2; TPR motif, nuclear | 96.52 | |
| 2hr2_A | 159 | Hypothetical protein; alpha-alpha superhelix fold, | 96.51 | |
| 1hxi_A | 121 | PEX5, peroxisome targeting signal 1 receptor PEX5; | 96.44 | |
| 3gyz_A | 151 | Chaperone protein IPGC; asymmetric homodimer, tetr | 96.4 | |
| 1na3_A | 91 | Designed protein CTPR2; de novo protein; HET: IPT; | 96.39 | |
| 3sz7_A | 164 | HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G | 96.34 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 96.25 | |
| 2kat_A | 115 | Uncharacterized protein; NESG, structure, structur | 96.21 | |
| 1na3_A | 91 | Designed protein CTPR2; de novo protein; HET: IPT; | 96.17 | |
| 2l6j_A | 111 | TPR repeat-containing protein associated with HSP; | 96.15 | |
| 3k9i_A | 117 | BH0479 protein; putative protein binding protein, | 96.11 | |
| 2lni_A | 133 | Stress-induced-phosphoprotein 1; structural genomi | 96.11 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 96.09 | |
| 2vgx_A | 148 | Chaperone SYCD; alternative dimer assembly, tetrat | 96.09 | |
| 2kck_A | 112 | TPR repeat; tetratricopeptide repeat, structural g | 96.05 | |
| 3rkv_A | 162 | Putative peptidylprolyl isomerase; structural geno | 96.02 | |
| 3q49_B | 137 | STIP1 homology and U box-containing protein 1; E3 | 95.91 | |
| 3q49_B | 137 | STIP1 homology and U box-containing protein 1; E3 | 95.91 | |
| 4i17_A | 228 | Hypothetical protein; TPR repeats protein, structu | 95.88 | |
| 3sz7_A | 164 | HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G | 95.83 | |
| 2kck_A | 112 | TPR repeat; tetratricopeptide repeat, structural g | 95.81 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 95.81 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 95.64 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 95.59 | |
| 2vgx_A | 148 | Chaperone SYCD; alternative dimer assembly, tetrat | 95.59 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 95.53 | |
| 2fbn_A | 198 | 70 kDa peptidylprolyl isomerase, putative; sulfur | 95.52 | |
| 1elw_A | 118 | TPR1-domain of HOP; HOP, TPR-domain, peptide-compl | 95.51 | |
| 4ga2_A | 150 | E3 SUMO-protein ligase ranbp2; TPR motif, nuclear | 95.43 | |
| 2dba_A | 148 | Smooth muscle cell associated protein-1, isoform 2 | 95.35 | |
| 2h6f_A | 382 | Protein farnesyltransferase/geranylgeranyltransfer | 95.31 | |
| 2lni_A | 133 | Stress-induced-phosphoprotein 1; structural genomi | 95.31 | |
| 2fbn_A | 198 | 70 kDa peptidylprolyl isomerase, putative; sulfur | 95.3 | |
| 2vyi_A | 131 | SGTA protein; chaperone, TPR repeat, phosphoprotei | 95.27 | |
| 1hxi_A | 121 | PEX5, peroxisome targeting signal 1 receptor PEX5; | 95.26 | |
| 2dba_A | 148 | Smooth muscle cell associated protein-1, isoform 2 | 95.18 | |
| 3ma5_A | 100 | Tetratricopeptide repeat domain protein; NESG, str | 95.18 | |
| 1p5q_A | 336 | FKBP52, FK506-binding protein 4; isomerase; 2.80A | 95.18 | |
| 1a17_A | 166 | Serine/threonine protein phosphatase 5; hydrolase, | 95.15 | |
| 3k9i_A | 117 | BH0479 protein; putative protein binding protein, | 95.15 | |
| 2xev_A | 129 | YBGF; tetratricopeptide, alpha-helical, metal bind | 95.13 | |
| 2r5s_A | 176 | Uncharacterized protein VP0806; APC090868.1, vibri | 95.13 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 95.08 | |
| 2vyi_A | 131 | SGTA protein; chaperone, TPR repeat, phosphoprotei | 94.89 | |
| 2h6f_A | 382 | Protein farnesyltransferase/geranylgeranyltransfer | 94.86 | |
| 2xev_A | 129 | YBGF; tetratricopeptide, alpha-helical, metal bind | 94.83 | |
| 1elw_A | 118 | TPR1-domain of HOP; HOP, TPR-domain, peptide-compl | 94.82 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 94.78 | |
| 1zu2_A | 158 | Mitochondrial import receptor subunit TOM20-3; TPR | 94.73 | |
| 1kt0_A | 457 | FKBP51, 51 kDa FK506-binding protein; FKBP-like pp | 94.73 | |
| 4i17_A | 228 | Hypothetical protein; TPR repeats protein, structu | 94.65 | |
| 2kc7_A | 99 | BFR218_protein; tetratricopeptide repeat, all-alph | 94.64 | |
| 2e2e_A | 177 | Formate-dependent nitrite reductase complex NRFG; | 94.56 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 94.55 | |
| 1elr_A | 131 | TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp | 94.5 | |
| 2hr2_A | 159 | Hypothetical protein; alpha-alpha superhelix fold, | 94.4 | |
| 2yhc_A | 225 | BAMD, UPF0169 lipoprotein YFIO; essential BAM comp | 94.4 | |
| 1a17_A | 166 | Serine/threonine protein phosphatase 5; hydrolase, | 94.37 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 94.34 | |
| 1na0_A | 125 | Designed protein CTPR3; de novo protein; HET: IPT; | 94.29 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 94.27 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 94.26 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 94.25 | |
| 2e2e_A | 177 | Formate-dependent nitrite reductase complex NRFG; | 94.1 | |
| 2if4_A | 338 | ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, | 94.1 | |
| 1elr_A | 131 | TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp | 94.04 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 94.04 | |
| 1na0_A | 125 | Designed protein CTPR3; de novo protein; HET: IPT; | 94.0 | |
| 2kat_A | 115 | Uncharacterized protein; NESG, structure, structur | 93.86 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 93.81 | |
| 1ihg_A | 370 | Cyclophilin 40; ppiase immunophilin tetratricopept | 93.78 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 93.72 | |
| 3qky_A | 261 | Outer membrane assembly lipoprotein YFIO; membrane | 93.69 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 93.6 | |
| 3qky_A | 261 | Outer membrane assembly lipoprotein YFIO; membrane | 93.6 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 93.54 | |
| 2r5s_A | 176 | Uncharacterized protein VP0806; APC090868.1, vibri | 93.44 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 93.38 | |
| 1p5q_A | 336 | FKBP52, FK506-binding protein 4; isomerase; 2.80A | 93.38 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 93.33 | |
| 3bee_A | 93 | Putative YFRE protein; putaive YFRE protein, struc | 93.22 | |
| 3mkr_A | 291 | Coatomer subunit epsilon; tetratricopeptide repeat | 93.2 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 93.17 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 93.16 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 93.12 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 93.07 | |
| 1zu2_A | 158 | Mitochondrial import receptor subunit TOM20-3; TPR | 92.93 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 92.78 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 92.69 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 92.6 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 92.6 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 92.38 | |
| 4gyw_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 92.27 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 92.18 | |
| 1kt0_A | 457 | FKBP51, 51 kDa FK506-binding protein; FKBP-like pp | 92.02 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 92.01 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 92.0 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 91.93 | |
| 3bee_A | 93 | Putative YFRE protein; putaive YFRE protein, struc | 91.88 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 91.85 | |
| 4gyw_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 91.72 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 91.58 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 91.51 | |
| 2yhc_A | 225 | BAMD, UPF0169 lipoprotein YFIO; essential BAM comp | 91.45 | |
| 1wao_1 | 477 | Serine/threonine protein phosphatase 5; hydrolase, | 91.27 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 91.24 | |
| 3sf4_A | 406 | G-protein-signaling modulator 2; tetratricopeptide | 91.11 | |
| 3qou_A | 287 | Protein YBBN; thioredoxin-like fold, tetratricopep | 91.1 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 91.08 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 91.08 | |
| 3nf1_A | 311 | KLC 1, kinesin light chain 1; TPR, structural geno | 90.92 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 90.87 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 90.83 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 90.67 | |
| 4f3v_A | 282 | ESX-1 secretion system protein ECCA1; tetratricope | 90.64 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 90.55 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 90.54 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 90.53 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 90.44 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 90.4 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 89.86 | |
| 3ro2_A | 338 | PINS homolog, G-protein-signaling modulator 2; TPR | 89.72 | |
| 3ro3_A | 164 | PINS homolog, G-protein-signaling modulator 2; asy | 89.69 | |
| 1wao_1 | 477 | Serine/threonine protein phosphatase 5; hydrolase, | 89.68 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 89.68 | |
| 3nf1_A | 311 | KLC 1, kinesin light chain 1; TPR, structural geno | 89.65 | |
| 3qou_A | 287 | Protein YBBN; thioredoxin-like fold, tetratricopep | 89.44 | |
| 3edt_B | 283 | KLC 2, kinesin light chain 2; superhelical, struct | 89.42 | |
| 2v5f_A | 104 | Prolyl 4-hydroxylase subunit alpha-1; endoplasmic | 89.38 | |
| 1ihg_A | 370 | Cyclophilin 40; ppiase immunophilin tetratricopept | 89.06 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 88.88 | |
| 3edt_B | 283 | KLC 2, kinesin light chain 2; superhelical, struct | 88.68 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 87.8 | |
| 4a1s_A | 411 | PINS, partner of inscuteable; cell cycle, LGN, mit | 87.38 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 87.21 | |
| 1qqe_A | 292 | Vesicular transport protein SEC17; helix-turn-heli | 86.72 | |
| 2ond_A | 308 | Cleavage stimulation factor 77 kDa subunit; HAT do | 86.25 | |
| 2ond_A | 308 | Cleavage stimulation factor 77 kDa subunit; HAT do | 86.13 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 85.91 | |
| 2if4_A | 338 | ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, | 85.49 | |
| 1ouv_A | 273 | Conserved hypothetical secreted protein; TPR repea | 84.99 | |
| 1qqe_A | 292 | Vesicular transport protein SEC17; helix-turn-heli | 84.38 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 83.38 | |
| 3mkr_A | 291 | Coatomer subunit epsilon; tetratricopeptide repeat | 82.59 | |
| 3ly7_A | 372 | Transcriptional activator CADC; alpha/beta domain, | 82.13 | |
| 3ro3_A | 164 | PINS homolog, G-protein-signaling modulator 2; asy | 81.63 | |
| 3gw4_A | 203 | Uncharacterized protein; structural genomics, PSI- | 80.88 |
| >4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} | Back alignment and structure |
|---|
Probab=97.43 E-value=8.3e-05 Score=50.63 Aligned_cols=37 Identities=24% Similarity=0.451 Sum_probs=22.3
Q ss_pred CchhhHHHHHHHHHhhhhccccccHHHHHHHhhcCcc
Q 029343 120 NSREAVVAIRRGMLLFRQGDVVGSVAEFDKAIELDPR 156 (194)
Q Consensus 120 ~p~ea~aaIRRGM~lFrqgDVeGSIaDFDkAIeLDPR 156 (194)
+|..+.++..+|..+|++||.+++|+.|++|+++||.
T Consensus 9 nP~~a~~~~~~G~~~~~~g~~~~A~~~~~~al~~~p~ 45 (126)
T 4gco_A 9 NPELAQEEKNKGNEYFKKGDYPTAMRHYNEAVKRDPE 45 (126)
T ss_dssp CHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTT
T ss_pred CHHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCC
Confidence 3555555556666666666666666666666666654
|
| >4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A | Back alignment and structure |
|---|
| >2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A | Back alignment and structure |
|---|
| >4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A | Back alignment and structure |
|---|
| >2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} | Back alignment and structure |
|---|
| >4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A | Back alignment and structure |
|---|
| >3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* | Back alignment and structure |
|---|
| >2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 | Back alignment and structure |
|---|
| >1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A | Back alignment and structure |
|---|
| >1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A | Back alignment and structure |
|---|
| >3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A | Back alignment and structure |
|---|
| >2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} | Back alignment and structure |
|---|
| >1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A | Back alignment and structure |
|---|
| >2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} | Back alignment and structure |
|---|
| >2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* | Back alignment and structure |
|---|
| >2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* | Back alignment and structure |
|---|
| >3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* | Back alignment and structure |
|---|
| >4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} | Back alignment and structure |
|---|
| >2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A | Back alignment and structure |
|---|
| >2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* | Back alignment and structure |
|---|
| >2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... | Back alignment and structure |
|---|
| >2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A | Back alignment and structure |
|---|
| >1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A | Back alignment and structure |
|---|
| >1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A | Back alignment and structure |
|---|
| >3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} | Back alignment and structure |
|---|
| >2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... | Back alignment and structure |
|---|
| >2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A | Back alignment and structure |
|---|
| >4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* | Back alignment and structure |
|---|
| >1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A | Back alignment and structure |
|---|
| >2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 | Back alignment and structure |
|---|
| >2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A | Back alignment and structure |
|---|
| >1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} | Back alignment and structure |
|---|
| >2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A | Back alignment and structure |
|---|
| >2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A | Back alignment and structure |
|---|
| >1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A | Back alignment and structure |
|---|
| >1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A | Back alignment and structure |
|---|
| >3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A | Back alignment and structure |
|---|
| >3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A | Back alignment and structure |
|---|
| >4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} | Back alignment and structure |
|---|
| >1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A | Back alignment and structure |
|---|
| >3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* | Back alignment and structure |
|---|
| >3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A | Back alignment and structure |
|---|
| >2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A | Back alignment and structure |
|---|
| >1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* | Back alignment and structure |
|---|
| >3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* | Back alignment and structure |
|---|
| >4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} | Back alignment and structure |
|---|
| >3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A | Back alignment and structure |
|---|
| >3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} | Back alignment and structure |
|---|
| >3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 194 | ||||
| d1fcha_ | 323 | a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting | 6e-04 |
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: alpha-alpha superhelix superfamily: TPR-like family: Tetratricopeptide repeat (TPR) domain: Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) species: Human (Homo sapiens) [TaxId: 9606]
Score = 37.1 bits (84), Expect = 6e-04
Identities = 10/38 (26%), Positives = 19/38 (50%)
Query: 118 NNNSREAVVAIRRGMLLFRQGDVVGSVAEFDKAIELDP 155
N R+ G+ ++GD+ +V F+ A++ DP
Sbjct: 13 ENPLRDHPQPFEEGLRRLQEGDLPNAVLLFEAAVQQDP 50
|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 194 | |||
| d2c2la1 | 201 | STIP1 homology and U box-containing protein 1, STU | 97.07 | |
| d2fbna1 | 153 | Putative 70 kda peptidylprolyl isomerase PFL2275c | 97.01 | |
| d1p5qa1 | 170 | FKBP52 (FKBP4), C-terminal domain {Human (Homo sap | 96.99 | |
| d1kt1a1 | 168 | FKBP51, C-terminal domain {Monkey (Saimiri bolivie | 96.96 | |
| d1ihga1 | 169 | Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | 96.86 | |
| d1xnfa_ | 259 | Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | 96.86 | |
| d1elwa_ | 117 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 96.72 | |
| d1hxia_ | 112 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 96.67 | |
| d1hh8a_ | 192 | Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H | 96.62 | |
| d1elwa_ | 117 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 96.53 | |
| d2c2la1 | 201 | STIP1 homology and U box-containing protein 1, STU | 96.5 | |
| d1hh8a_ | 192 | Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H | 96.46 | |
| d1xnfa_ | 259 | Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | 96.46 | |
| d1elra_ | 128 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 96.45 | |
| d1a17a_ | 159 | Protein phosphatase 5 {Human (Homo sapiens) [TaxId | 96.3 | |
| d1w3ba_ | 388 | O-GlcNAc transferase p110 subunit, OGT {Human (Hom | 96.19 | |
| d1a17a_ | 159 | Protein phosphatase 5 {Human (Homo sapiens) [TaxId | 96.09 | |
| d1elra_ | 128 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 96.03 | |
| d1zu2a1 | 145 | Mitochondrial import receptor subunit tom20-3 {Tha | 95.95 | |
| d1fcha_ | 323 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 95.39 | |
| d1hxia_ | 112 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 95.38 | |
| d2hr2a1 | 156 | Hypothetical protein CT2138 {Chlorobium tepidum [T | 95.35 | |
| d1tjca_ | 95 | Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human | 95.16 | |
| d1w3ba_ | 388 | O-GlcNAc transferase p110 subunit, OGT {Human (Hom | 95.07 | |
| d2h6fa1 | 315 | Protein farnesyltransferase alpha-subunit {Human ( | 95.07 | |
| d2h6fa1 | 315 | Protein farnesyltransferase alpha-subunit {Human ( | 95.02 | |
| d1dcea1 | 334 | Rab geranylgeranyltransferase alpha-subunit, N-ter | 94.94 | |
| d1fcha_ | 323 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 94.93 | |
| d1ihga1 | 169 | Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | 94.86 | |
| d1zu2a1 | 145 | Mitochondrial import receptor subunit tom20-3 {Tha | 94.48 | |
| d1nzna_ | 122 | Mitochondria fission protein Fis1 {Human (Homo sap | 94.02 | |
| d2fbna1 | 153 | Putative 70 kda peptidylprolyl isomerase PFL2275c | 93.15 | |
| d1kt1a1 | 168 | FKBP51, C-terminal domain {Monkey (Saimiri bolivie | 93.09 | |
| d2hr2a1 | 156 | Hypothetical protein CT2138 {Chlorobium tepidum [T | 92.04 | |
| d1p5qa1 | 170 | FKBP52 (FKBP4), C-terminal domain {Human (Homo sap | 91.64 | |
| d1zbpa1 | 264 | Hypothetical protein VPA1032 {Vibrio parahaemolyti | 90.39 | |
| d1tjca_ | 95 | Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human | 87.37 | |
| d1hz4a_ | 366 | Transcription factor MalT domain III {Escherichia | 87.02 | |
| d1ouva_ | 265 | Cysteine rich protein C (HcpC) {Helicobacter pylor | 85.36 | |
| d1dcea1 | 334 | Rab geranylgeranyltransferase alpha-subunit, N-ter | 81.45 | |
| d2ff4a2 | 179 | Probable regulatory protein EmbR, middle domain {M | 80.23 |
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: alpha-alpha superhelix superfamily: TPR-like family: Tetratricopeptide repeat (TPR) domain: STIP1 homology and U box-containing protein 1, STUB1 species: Mouse (Mus musculus) [TaxId: 10090]
Probab=97.07 E-value=0.00018 Score=48.01 Aligned_cols=37 Identities=24% Similarity=0.314 Sum_probs=23.4
Q ss_pred CchhhHHHHHHHHHhhhhccccccHHHHHHHhhcCcc
Q 029343 120 NSREAVVAIRRGMLLFRQGDVVGSVAEFDKAIELDPR 156 (194)
Q Consensus 120 ~p~ea~aaIRRGM~lFrqgDVeGSIaDFDkAIeLDPR 156 (194)
+|.++.++..+|+.+++.|+.+.+|++|++|+++||.
T Consensus 34 ~p~~~~~~~~lg~~y~~~~~~~~Ai~~~~~al~l~p~ 70 (201)
T d2c2la1 34 NPLVAVYYTNRALCYLKMQQPEQALADCRRALELDGQ 70 (201)
T ss_dssp CSCCHHHHHHHHHHHHHTTCHHHHHHHHHHHTTSCTT
T ss_pred CCCCHHHHHhHHHHHhhhhhhhhhhHHHHHHHHhCCC
Confidence 4556666666666666666666666666666666664
|
| >d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} | Back information, alignment and structure |
|---|
| >d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} | Back information, alignment and structure |
|---|
| >d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} | Back information, alignment and structure |
|---|
| >d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|