Citrus Sinensis ID: 029343


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190----
MTGTFGALSLSQTYQKSRTQLPKILHLHQLYYYKFCIFFQFTSMALTQHVLKPTINPPLYSFHRSLLTSKAPLSVQTHINSLFSTPRGHYLQNRAPTFTRRLFIPSVSGIWDALTGGNNNSREAVVAIRRGMLLFRQGDVVGSVAEFDKAIELDPRQKISGKGAYRFTISIGTKFFTFYSRLKKGLKKVQSSFG
cccccccccHHHHHHHHHcccccHHHHHHHHHHEEEEEEEHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHccccccHHHHHHHHHHHHHHEEEccccccHHHHHHcccccccccccccccEEEEEEEEccEEEHHHHHHHHHHHHHHHccc
ccccHHHEHHcHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccEEEccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccccccEEEEEcHEEEccccccEccccEEEEEEEEcHHHHHHHHHHHHHHHHHHHccc
mtgtfgalsLSQTYQKSRTQLPKILHLHQLYYYKFCIFFQFTSMALTQhvlkptinpplysfhrslltskaplsvqthinslfstprghylqnraptftrrlfipsvsgiwdaltggnnnsREAVVAIRRGMLLFRQgdvvgsvaefdkaieldprqkisgkgayrFTISIGTKFFTFYSRLKKGLKKVQSSFG
mtgtfgalslsqTYQKSRTQLPKILHLHQLYYYKFCIFFQFTSMALTQHVLKPTINPPLYSFHRSLLTSKAPLSVQTHINslfstprghYLQNRAPTFTRRLFIPSVSGIWDaltggnnnsREAVVAIRRGMLLFRQGDVVGSVAEFdkaieldprqkisgkgayrFTISIGTKFFTFYSRLKKGLKKVQSSFG
MTGTFGALSLSQTYQKSRTQLPKILHLHQLYYYKFCIFFQFTSMALTQHVLKPTINPPLYSFHRSLLTSKAPLSVQTHINSLFSTPRGHYLQNRAPTFTRRLFIPSVSGIWDALTGGNNNSREAVVAIRRGMLLFRQGDVVGSVAEFDKAIELDPRQKISGKGAYRFTISIGTKFFTFYSRLKKGLKKVQSSFG
******************TQLPKILHLHQLYYYKFCIFFQFTSMALTQHVLKPTINPPLYSFHRSLLTSKAPLSVQTHINSLFSTPRGHYLQNRAPTFTRRLFIPSVSGIWDALTGGNNNSREAVVAIRRGMLLFRQGDVVGSVAEFDKAIELDPRQKISGKGAYRFTISIGTKFFTFYSRLKK**********
***TFGALSLSQT*****TQLPKILHLHQLYYYKFCIFFQFTSMALTQHVLKPTINP**************PLSVQTHINSLFSTPRGHYLQNRAPTFTRRLFIPSVSGIWDALTGGNNNSREAVVAIRRGMLLFRQGDVVGSVAEFDKAIELDPRQ*ISGKGAYRFTISIGTKFFTFYSRLKKGLK*V*****
MTGTFGALSLSQTYQKSRTQLPKILHLHQLYYYKFCIFFQFTSMALTQHVLKPTINPPLYSFHRSLLTSKAPLSVQTHINSLFSTPRGHYLQNRAPTFTRRLFIPSVSGIWDALTGGNNNSREAVVAIRRGMLLFRQGDVVGSVAEFDKAIELDPRQKISGKGAYRFTISIGTKFFTFYSRLKKG*********
****FGALSLS*TYQKSRTQLPKILHLHQLYYYKFCIFFQFTSMALTQHVLKPTINPPLYSFHRSLLTSKAPLSVQTHINSLFSTPRGHYLQNRAPTFTRRLFIPSVSGIWDALTGGNNNSREAVVAIRRGMLLFRQGDVVGSVAEFDKAIELDPRQKISGKGAYRFTISIGTKFFTFYSRLKKGLKKVQS***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTGTFGALSLSQTYQKSRTQLPKILHLHQLYYYKFCIFFQFTSMALTQHVLKPTINPPLYSFHRSLLTSKAPLSVQTHINSLFSTPRGHYLQNRAPTFTRRLFIPSVSGIWDALTGGNNNSREAVVAIRRGMLLFRQGDVVGSVAEFDKAIELDPRQKISGKGAYRFTISIGTKFFTFYSRLKKGLKKVQSSFG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query194
224125100271 predicted protein [Populus trichocarpa] 0.592 0.424 0.663 3e-31
255542812221 conserved hypothetical protein [Ricinus 0.396 0.348 0.734 6e-26
356533558255 PREDICTED: uncharacterized protein LOC10 0.489 0.372 0.565 1e-24
449454057267 PREDICTED: uncharacterized protein LOC10 0.314 0.228 0.838 6e-23
124359146263 TPR repeat [Medicago truncatula] 0.319 0.235 0.75 7e-21
357441797265 hypothetical protein MTR_1g083600 [Medic 0.319 0.233 0.75 9e-21
217073934265 unknown [Medicago truncatula] 0.319 0.233 0.734 4e-20
297829092257 binding protein [Arabidopsis lyrata subs 0.525 0.396 0.517 1e-19
225450751270 PREDICTED: uncharacterized protein LOC10 0.314 0.225 0.758 1e-19
30679555257 tetratricopeptide repeat-containing prot 0.319 0.241 0.730 3e-19
>gi|224125100|ref|XP_002319500.1| predicted protein [Populus trichocarpa] gi|222857876|gb|EEE95423.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  140 bits (352), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 79/119 (66%), Positives = 87/119 (73%), Gaps = 4/119 (3%)

Query: 44  MALTQHVLKPTINPPLYSFHRSLLTSKAPLSVQTHINS-LFST---PRGHYLQNRAPTFT 99
           MALT +       P   S H+  LT+  P S +TH NS  FST    R H LQN  PTFT
Sbjct: 1   MALTHNFNHIFPTPSSSSKHKHSLTTTLPFSPKTHTNSHFFSTNIPSRIHNLQNPLPTFT 60

Query: 100 RRLFIPSVSGIWDALTGGNNNSREAVVAIRRGMLLFRQGDVVGSVAEFDKAIELDPRQK 158
           RRLF+PSVSGIWDALTGGNNN REAV+AIRRGMLLFRQGDV+GS+ EFDKAIELD RQK
Sbjct: 61  RRLFLPSVSGIWDALTGGNNNPREAVMAIRRGMLLFRQGDVLGSLVEFDKAIELDTRQK 119




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255542812|ref|XP_002512469.1| conserved hypothetical protein [Ricinus communis] gi|223548430|gb|EEF49921.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|356533558|ref|XP_003535330.1| PREDICTED: uncharacterized protein LOC100809261 [Glycine max] Back     alignment and taxonomy information
>gi|449454057|ref|XP_004144772.1| PREDICTED: uncharacterized protein LOC101209381 [Cucumis sativus] Back     alignment and taxonomy information
>gi|124359146|gb|ABD28339.2| TPR repeat [Medicago truncatula] Back     alignment and taxonomy information
>gi|357441797|ref|XP_003591176.1| hypothetical protein MTR_1g083600 [Medicago truncatula] gi|355480224|gb|AES61427.1| hypothetical protein MTR_1g083600 [Medicago truncatula] gi|388510044|gb|AFK43088.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|217073934|gb|ACJ85327.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|297829092|ref|XP_002882428.1| binding protein [Arabidopsis lyrata subsp. lyrata] gi|297328268|gb|EFH58687.1| binding protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|225450751|ref|XP_002279298.1| PREDICTED: uncharacterized protein LOC100240883 [Vitis vinifera] gi|296089711|emb|CBI39530.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|30679555|ref|NP_683531.2| tetratricopeptide repeat-containing protein [Arabidopsis thaliana] gi|27311659|gb|AAO00795.1| Unknown protein [Arabidopsis thaliana] gi|30023732|gb|AAP13399.1| At3g05625 [Arabidopsis thaliana] gi|332640747|gb|AEE74268.1| tetratricopeptide repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query194
TAIR|locus:504955885 257 AT3G05625 "AT3G05625" [Arabido 0.402 0.303 0.620 2.1e-20
TAIR|locus:504955885 AT3G05625 "AT3G05625" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 241 (89.9 bits), Expect = 2.1e-20, P = 2.1e-20
 Identities = 49/79 (62%), Positives = 60/79 (75%)

Query:    81 SLFSTPRGHYLQNRAPTFTRRLFIPSVSGIWDALTGG-NNNSREAVVAIRRGMLLFRQGD 139
             S F T    + ++     +RRLF+PSVS IWDA+TGG ++N REA+ A+RRGM LFRQGD
Sbjct:    25 SPFKTLSPQFSRHPPHALSRRLFLPSVSSIWDAITGGGDSNPREAIAAVRRGMQLFRQGD 84

Query:   140 VVGSVAEFDKAIELDPRQK 158
             V GSVAEFD+AI LDPRQK
Sbjct:    85 VAGSVAEFDRAIILDPRQK 103


Parameters:
  V=100
  filter=SEG
  E=0.001

  ctxfactor=1.00

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   +0      0   BLOSUM62        0.324   0.137   0.406    same    same    same
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a

  Query
  Frame  MatID  Length  Eff.Length     E     S W   T  X   E2     S2
   +0      0      194       194   0.00076  111 3  11 22  0.40    32
                                                     31  0.43    35


Statistics:

  Database:  /share/blast/go-seqdb.fasta
   Title:  go_20130330-seqdb.fasta
   Posted:  5:47:42 AM PDT Apr 1, 2013
   Created:  5:47:42 AM PDT Apr 1, 2013
   Format:  XDF-1
   # of letters in database:  169,044,731
   # of sequences in database:  368,745
   # of database sequences satisfying E:  1
  No. of states in DFA:  567 (60 KB)
  Total size of DFA:  147 KB (2091 KB)
  Time to generate neighborhood:  0.00u 0.00s 0.00t   Elapsed:  00:00:00
  No. of threads or processors used:  24
  Search cpu time:  17.10u 0.16s 17.26t   Elapsed:  00:00:01
  Total cpu time:  17.10u 0.16s 17.26t   Elapsed:  00:00:01
  Start:  Fri May 10 16:21:53 2013   End:  Fri May 10 16:21:54 2013


GO:0008150 "biological_process" evidence=ND
GO:0009570 "chloroplast stroma" evidence=IDA
GO:0009507 "chloroplast" evidence=IDA

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
eugene3.00130116
hypothetical protein (271 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query194
pfam1341469 pfam13414, TPR_11, TPR repeat 2e-04
pfam0771934 pfam07719, TPR_2, Tetratricopeptide repeat 0.003
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
 Score = 38.1 bits (89), Expect = 2e-04
 Identities = 12/34 (35%), Positives = 18/34 (52%)

Query: 122 REAVVAIRRGMLLFRQGDVVGSVAEFDKAIELDP 155
             A      G  LF+ GD   ++  ++KA+ELDP
Sbjct: 1   DNAEALKNLGNALFKLGDYDEAIEAYEKALELDP 34


Length = 69

>gnl|CDD|191825 pfam07719, TPR_2, Tetratricopeptide repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 194
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 97.77
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.58
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.21
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 97.17
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.16
PF1337173 TPR_9: Tetratricopeptide repeat 97.05
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 96.78
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 96.62
KOG0547 606 consensus Translocase of outer mitochondrial membr 96.08
PRK15359144 type III secretion system chaperone protein SscB; 95.87
PRK11189 296 lipoprotein NlpI; Provisional 95.66
PRK15359144 type III secretion system chaperone protein SscB; 95.04
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 94.82
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 93.89
PF1342844 TPR_14: Tetratricopeptide repeat 93.72
PRK11189296 lipoprotein NlpI; Provisional 93.64
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 93.25
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 93.21
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 93.1
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 92.95
TIGR02521 234 type_IV_pilW type IV pilus biogenesis/stability pr 92.34
TIGR02552135 LcrH_SycD type III secretion low calcium response 92.12
TIGR00990 615 3a0801s09 mitochondrial precursor proteins import 91.8
PRK10370198 formate-dependent nitrite reductase complex subuni 91.58
cd00189100 TPR Tetratricopeptide repeat domain; typically con 91.46
KOG0547 606 consensus Translocase of outer mitochondrial membr 91.31
cd00189100 TPR Tetratricopeptide repeat domain; typically con 91.27
TIGR02552135 LcrH_SycD type III secretion low calcium response 90.95
PRK12370 553 invasion protein regulator; Provisional 90.86
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 90.24
TIGR00990 615 3a0801s09 mitochondrial precursor proteins import 89.8
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 89.78
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 88.83
PRK02603172 photosystem I assembly protein Ycf3; Provisional 88.09
PRK10370198 formate-dependent nitrite reductase complex subuni 88.08
PRK12370 553 invasion protein regulator; Provisional 87.91
PRK11906458 transcriptional regulator; Provisional 87.5
KOG0553304 consensus TPR repeat-containing protein [General f 86.04
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 85.77
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 85.42
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 85.19
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 85.07
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 84.58
CHL00033168 ycf3 photosystem I assembly protein Ycf3 83.93
COG3063 250 PilF Tfp pilus assembly protein PilF [Cell motilit 82.07
PRK11906458 transcriptional regulator; Provisional 81.62
TIGR02917 899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 80.73
TIGR03302 235 OM_YfiO outer membrane assembly lipoprotein YfiO. 80.22
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
Probab=97.77  E-value=2.8e-05  Score=44.72  Aligned_cols=33  Identities=30%  Similarity=0.477  Sum_probs=30.3

Q ss_pred             hHHHHHHHHHhhhhccccccHHHHHHHhhcCcc
Q 029343          124 AVVAIRRGMLLFRQGDVVGSVAEFDKAIELDPR  156 (194)
Q Consensus       124 a~aaIRRGM~lFrqgDVeGSIaDFDkAIeLDPR  156 (194)
                      |.++.++|+.++.+|+.+.+++.|.+|+++||.
T Consensus         1 a~~~~~~g~~~~~~~~~~~A~~~~~~al~~~p~   33 (34)
T PF00515_consen    1 AEAYYNLGNAYFQLGDYEEALEYYQRALELDPD   33 (34)
T ss_dssp             HHHHHHHHHHHHHTT-HHHHHHHHHHHHHHSTT
T ss_pred             CHHHHHHHHHHHHhCCchHHHHHHHHHHHHCcC
Confidence            578899999999999999999999999999996



It mediates protein-protein interactions and the assembly of multiprotein complexes []. The TPR motif consists of 3-16 tandem-repeats of 34 amino acids residues, although individual TPR motifs can be dispersed in the protein sequence. Sequence alignment of the TPR domains reveals a consensus sequence defined by a pattern of small and large amino acids. TPR motifs have been identified in various different organisms, ranging from bacteria to humans. Proteins containing TPRs are involved in a variety of biological processes, such as cell cycle regulation, transcriptional control, mitochondrial and peroxisomal protein transport, neurogenesis and protein folding. The X-ray structure of a domain containing three TPRs from protein phosphatase 5 revealed that TPR adopts a helix-turn-helix arrangement, with adjacent TPR motifs packing in a parallel fashion, resulting in a spiral of repeating anti-parallel alpha-helices []. The two helices are denoted helix A and helix B. The packing angle between helix A and helix B is ~24 degrees; within a single TPR and generates a right-handed superhelical shape. Helix A interacts with helix B and with helix A' of the next TPR. Two protein surfaces are generated: the inner concave surface is contributed to mainly by residue on helices A, and the other surface presents residues from both helices A and B. ; GO: 0005515 protein binding; PDB: 3SF4_C 2LNI_A 1ELW_A 2C0M_A 1FCH_B 3R9A_B 2J9Q_A 2C0L_A 1KT1_A 3FWV_A ....

>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query194
1fch_A 368 Peroxisomal targeting signal 1 receptor; protein-p 4e-04
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 5e-04
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 5e-04
4eqf_A 365 PEX5-related protein; accessory protein, tetratric 7e-04
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
 Score = 39.2 bits (92), Expect = 4e-04
 Identities = 10/38 (26%), Positives = 19/38 (50%)

Query: 118 NNNSREAVVAIRRGMLLFRQGDVVGSVAEFDKAIELDP 155
            N  R+       G+   ++GD+  +V  F+ A++ DP
Sbjct: 58  ENPLRDHPQPFEEGLRRLQEGDLPNAVLLFEAAVQQDP 95


>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query194
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 97.43
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 97.06
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 97.03
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.01
2l6j_A111 TPR repeat-containing protein associated with HSP; 96.98
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 96.92
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 96.92
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 96.87
3vtx_A 184 MAMA; tetratricopeptide repeats (TPR) containing p 96.8
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 96.76
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 96.73
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 96.66
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 96.62
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 96.52
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 96.51
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 96.44
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 96.4
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 96.39
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 96.34
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 96.25
2kat_A115 Uncharacterized protein; NESG, structure, structur 96.21
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 96.17
2l6j_A111 TPR repeat-containing protein associated with HSP; 96.15
3k9i_A117 BH0479 protein; putative protein binding protein, 96.11
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 96.11
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 96.09
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 96.09
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 96.05
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 96.02
3q49_B137 STIP1 homology and U box-containing protein 1; E3 95.91
3q49_B137 STIP1 homology and U box-containing protein 1; E3 95.91
4i17_A 228 Hypothetical protein; TPR repeats protein, structu 95.88
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 95.83
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 95.81
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 95.81
2pl2_A 217 Hypothetical conserved protein TTC0263; TPR, prote 95.64
2pl2_A 217 Hypothetical conserved protein TTC0263; TPR, prote 95.59
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 95.59
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 95.53
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 95.52
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 95.51
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 95.43
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 95.35
2h6f_A 382 Protein farnesyltransferase/geranylgeranyltransfer 95.31
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 95.31
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 95.3
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 95.27
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 95.26
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 95.18
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 95.18
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 95.18
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 95.15
3k9i_A117 BH0479 protein; putative protein binding protein, 95.15
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 95.13
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 95.13
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 95.08
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 94.89
2h6f_A 382 Protein farnesyltransferase/geranylgeranyltransfer 94.86
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 94.83
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 94.82
2vq2_A 225 PILW, putative fimbrial biogenesis and twitching m 94.78
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 94.73
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 94.73
4i17_A228 Hypothetical protein; TPR repeats protein, structu 94.65
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 94.64
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 94.56
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 94.55
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 94.5
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 94.4
2yhc_A 225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 94.4
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 94.37
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 94.34
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 94.29
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 94.27
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 94.26
4g1t_A472 Interferon-induced protein with tetratricopeptide 94.25
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 94.1
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 94.1
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 94.04
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 94.04
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 94.0
2kat_A115 Uncharacterized protein; NESG, structure, structur 93.86
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 93.81
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 93.78
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 93.72
3qky_A 261 Outer membrane assembly lipoprotein YFIO; membrane 93.69
1xnf_A 275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 93.6
3qky_A 261 Outer membrane assembly lipoprotein YFIO; membrane 93.6
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 93.54
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 93.44
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 93.38
1p5q_A 336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 93.38
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 93.33
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 93.22
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 93.2
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 93.17
3u4t_A 272 TPR repeat-containing protein; structural genomics 93.16
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 93.12
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 93.07
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 92.93
2q7f_A 243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 92.78
4eqf_A 365 PEX5-related protein; accessory protein, tetratric 92.69
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 92.6
3u4t_A272 TPR repeat-containing protein; structural genomics 92.6
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 92.38
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 92.27
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 92.18
1kt0_A 457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 92.02
2ho1_A 252 Type 4 fimbrial biogenesis protein PILF; type IV p 92.01
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 92.0
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 91.93
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 91.88
2vq2_A 225 PILW, putative fimbrial biogenesis and twitching m 91.85
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 91.72
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 91.58
3hym_B 330 Cell division cycle protein 16 homolog; APC, anaph 91.51
2yhc_A 225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 91.45
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 91.27
1fch_A 368 Peroxisomal targeting signal 1 receptor; protein-p 91.24
3sf4_A 406 G-protein-signaling modulator 2; tetratricopeptide 91.11
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 91.1
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 91.08
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 91.08
3nf1_A 311 KLC 1, kinesin light chain 1; TPR, structural geno 90.92
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 90.87
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 90.83
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 90.67
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 90.64
2gw1_A 514 Mitochondrial precursor proteins import receptor; 90.55
4eqf_A365 PEX5-related protein; accessory protein, tetratric 90.54
3cv0_A 327 Peroxisome targeting signal 1 receptor PEX5; TPR m 90.53
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 90.44
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 90.4
2gw1_A 514 Mitochondrial precursor proteins import receptor; 89.86
3ro2_A 338 PINS homolog, G-protein-signaling modulator 2; TPR 89.72
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 89.69
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 89.68
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 89.68
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 89.65
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 89.44
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 89.42
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 89.38
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 89.06
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 88.88
3edt_B 283 KLC 2, kinesin light chain 2; superhelical, struct 88.68
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 87.8
4a1s_A 411 PINS, partner of inscuteable; cell cycle, LGN, mit 87.38
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 87.21
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 86.72
2ond_A 308 Cleavage stimulation factor 77 kDa subunit; HAT do 86.25
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 86.13
4g1t_A 472 Interferon-induced protein with tetratricopeptide 85.91
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 85.49
1ouv_A 273 Conserved hypothetical secreted protein; TPR repea 84.99
1qqe_A 292 Vesicular transport protein SEC17; helix-turn-heli 84.38
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 83.38
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 82.59
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 82.13
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 81.63
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 80.88
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
Probab=97.43  E-value=8.3e-05  Score=50.63  Aligned_cols=37  Identities=24%  Similarity=0.451  Sum_probs=22.3

Q ss_pred             CchhhHHHHHHHHHhhhhccccccHHHHHHHhhcCcc
Q 029343          120 NSREAVVAIRRGMLLFRQGDVVGSVAEFDKAIELDPR  156 (194)
Q Consensus       120 ~p~ea~aaIRRGM~lFrqgDVeGSIaDFDkAIeLDPR  156 (194)
                      +|..+.++..+|..+|++||.+++|+.|++|+++||.
T Consensus         9 nP~~a~~~~~~G~~~~~~g~~~~A~~~~~~al~~~p~   45 (126)
T 4gco_A            9 NPELAQEEKNKGNEYFKKGDYPTAMRHYNEAVKRDPE   45 (126)
T ss_dssp             CHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTT
T ss_pred             CHHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCC
Confidence            3555555556666666666666666666666666654



>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 194
d1fcha_ 323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 6e-04
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor)
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 37.1 bits (84), Expect = 6e-04
 Identities = 10/38 (26%), Positives = 19/38 (50%)

Query: 118 NNNSREAVVAIRRGMLLFRQGDVVGSVAEFDKAIELDP 155
            N  R+       G+   ++GD+  +V  F+ A++ DP
Sbjct: 13  ENPLRDHPQPFEEGLRRLQEGDLPNAVLLFEAAVQQDP 50


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query194
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 97.07
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 97.01
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 96.99
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 96.96
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 96.86
d1xnfa_ 259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 96.86
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 96.72
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 96.67
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 96.62
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 96.53
d2c2la1 201 STIP1 homology and U box-containing protein 1, STU 96.5
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 96.46
d1xnfa_ 259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 96.46
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 96.45
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 96.3
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 96.19
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 96.09
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 96.03
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 95.95
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 95.39
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 95.38
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 95.35
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 95.16
d1w3ba_ 388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 95.07
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 95.07
d2h6fa1 315 Protein farnesyltransferase alpha-subunit {Human ( 95.02
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 94.94
d1fcha_ 323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 94.93
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 94.86
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 94.48
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 94.02
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 93.15
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 93.09
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 92.04
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 91.64
d1zbpa1 264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 90.39
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 87.37
d1hz4a_366 Transcription factor MalT domain III {Escherichia 87.02
d1ouva_ 265 Cysteine rich protein C (HcpC) {Helicobacter pylor 85.36
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 81.45
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 80.23
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: STIP1 homology and U box-containing protein 1, STUB1
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=97.07  E-value=0.00018  Score=48.01  Aligned_cols=37  Identities=24%  Similarity=0.314  Sum_probs=23.4

Q ss_pred             CchhhHHHHHHHHHhhhhccccccHHHHHHHhhcCcc
Q 029343          120 NSREAVVAIRRGMLLFRQGDVVGSVAEFDKAIELDPR  156 (194)
Q Consensus       120 ~p~ea~aaIRRGM~lFrqgDVeGSIaDFDkAIeLDPR  156 (194)
                      +|.++.++..+|+.+++.|+.+.+|++|++|+++||.
T Consensus        34 ~p~~~~~~~~lg~~y~~~~~~~~Ai~~~~~al~l~p~   70 (201)
T d2c2la1          34 NPLVAVYYTNRALCYLKMQQPEQALADCRRALELDGQ   70 (201)
T ss_dssp             CSCCHHHHHHHHHHHHHTTCHHHHHHHHHHHTTSCTT
T ss_pred             CCCCHHHHHhHHHHHhhhhhhhhhhHHHHHHHHhCCC
Confidence            4556666666666666666666666666666666664



>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure