Citrus Sinensis ID: 029389

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190----
MGSLCCCFRVNDHEDSSLSNSNDNEGCRCPNCRLHTLLNKYTALFKKDETLAGPSDAHQGAALSTSNSSSSSPSSCNILPEIVTSQLRTMRFDPQLLHKQLRYGDSTNCPERAEEDGRLTKLERLDLLLKSPLRKLGPEDEDVCPTCLEEYTLENPKIVTQCRHHYHLSCIYEWMERSPTCPVCSKVMVFDETT
cccEEccccccccccccccccccccccccccHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccccccccccccHHHHHHHHHHHHccccccccccccccccccEEcccccccccEEEccccccccHHHHHHHHHHccccccccccccccccc
cccEEEEcccccHHHccccccccccccccHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHccccccccEEccccccccHHHHHHHHHccccccccccEEEccccc
mgslcccfrvndhedsslsnsndnegcrcpncrlhTLLNKYTALfkkdetlagpsdahqgaalstsnssssspsscnilpeIVTSqlrtmrfdpqllhkqlrygdstncperaeedgrLTKLERLDLLLksplrklgpededvcptcleeytlenpkivtQCRHHYHLSCIYewmersptcpvcskvmvfdett
MGSLCCCFRVNDhedsslsnsndnegCRCPNCRLHTLLNKYTALFKKDETLAGPSDAHQGAALStsnssssspsscNILPEIVTSQLRTMRFDPQLLHKqlrygdstncperaeedgrltklERLDLLLksplrklgpedeDVCPTCLEEYTLENPKIVTQCRHHYHLSCIYEwmersptcpvCSKVMVFDETT
MGSLCCCFRVndhedsslsnsndnEGCRCPNCRLHTLLNKYTALFKKDETLAGPSDAHQGAALstsnssssspssCNILPEIVTSQLRTMRFDPQLLHKQLRYGDSTNCPERAEEDGrltklerldlllksplrklGPEDEDVCPTCLEEYTLENPKIVTQCRHHYHLSCIYEWMERSPTCPVCSKVMVFDETT
***LCCCFRVN**************GCRCPNCRLHTLLNKYTALFK*******************************ILPEIVTSQLRTMRFDPQLLHKQLR*********************RLDLLLKSPLRKL**EDEDVCPTCLEEYTLENPKIVTQCRHHYHLSCIYEWMERSPTCPVCSKVMVF****
MGSLCCCFRVNDHEDSSLSNSNDNEGCRCPNCRLHTLLNKY****************************************************************************************************DVCPTCLEEYTLENPKIVTQCRHHYHLSCIYEWMERSPTCPVCSK*MV*****
MGSLCCCFRVNDH************GCRCPNCRLHTLLNKYTALFKKDETLAG***********************NILPEIVTSQLRTMRFDPQLLHKQLRYGDSTNCPERAEEDGRLTKLERLDLLLKSPLRKLGPEDEDVCPTCLEEYTLENPKIVTQCRHHYHLSCIYEWMERSPTCPVCSKVMVFDETT
*GSLCCCFRVNDHEDSSLSNSNDNEGCRCPNCRLHTLLNKYTALFKKD********************************EIVTSQLRTMRFD***********************************************EDVCPTCLEEYTLENPKIVTQCRHHYHLSCIYEWMERSPTCPVCSKVMVF****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGSLCCCFRVNDHEDSSLSNSNDNEGCRCPNCRLHTLLNKYTALFKKDETLAGPSDAHQGAALSTSNSSSSSPSSCNILPEIVTSQLRTMRFDPQLLHKQLRYGDSTNCPERAEEDGRLTKLERLDLLLKSPLRKLGPEDEDVCPTCLEEYTLENPKIVTQCRHHYHLSCIYEWMERSPTCPVCSKVMVFDETT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query194 2.2.26 [Sep-21-2011]
Q8LE94231 E3 ubiquitin-protein liga no no 0.994 0.835 0.352 6e-27
Q4TU14 371 E3 ubiquitin-protein liga no no 0.257 0.134 0.5 3e-11
Q9ZT42 375 E3 ubiquitin-protein liga no no 0.278 0.144 0.407 1e-07
Q9D0C1305 E3 ubiquitin-protein liga yes no 0.262 0.167 0.431 9e-06
Q9Y4L5304 E3 ubiquitin-protein liga yes no 0.262 0.167 0.431 1e-05
Q5XF85 432 E3 ubiquitin-protein liga no no 0.324 0.145 0.348 1e-05
O54965381 E3 ubiquitin-protein liga no no 0.329 0.167 0.409 2e-05
Q9NVW2624 E3 ubiquitin-protein liga no no 0.345 0.107 0.361 2e-05
Q66HG0380 E3 ubiquitin-protein liga yes no 0.329 0.168 0.409 2e-05
Q9M2S6273 E3 ubiquitin-protein liga no no 0.257 0.183 0.42 3e-05
>sp|Q8LE94|RING3_ARATH E3 ubiquitin-protein ligase At3g02290 OS=Arabidopsis thaliana GN=At3g02290 PE=2 SV=1 Back     alignment and function desciption
 Score =  120 bits (301), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 81/230 (35%), Positives = 110/230 (47%), Gaps = 37/230 (16%)

Query: 1   MGSLCCCFRVNDHEDSSLSNSNDNEGCRCPNCRLHTLLNKYTALFKKDETLAGPSDAHQG 60
           MG +  CFRV D ++    NS+    C C  C  H  LN Y ++F++ ET + PS     
Sbjct: 1   MGCVSSCFRVEDIDEYMNPNSSVYRNCPCIRCLAHNFLNLYISVFRRGETRSLPSSVQAT 60

Query: 61  AA----------LSTSNSSSSSPSSCNILPEIVTS--------------QLRTMRFDPQL 96
           A+          LS +  S+  P   +  P    S              ++  +R D   
Sbjct: 61  ASITSSSSHDNFLSEAFRSTPRPLPYDADPRYFRSLVSRREKGSSHSHEEVEPLRSDSDA 120

Query: 97  LHKQLRYGD---STNCPERAEEDG----------RLTKLERLDLLLKSPLRKLGPEDEDV 143
             +    G    + N    +++D           R+ +     ++  S    +  EDEDV
Sbjct: 121 DSESFGVGGCKWANNKSTLSDKDSKEEYSSKSSLRILRSRSKSIMADSENMYILSEDEDV 180

Query: 144 CPTCLEEYTLENPKIVTQCRHHYHLSCIYEWMERSPTCPVCSKVMVFDET 193
           CPTCLEEYT ENPKIVT+C HH+HLSCIYEWMERS  CPVC KVM F+ET
Sbjct: 181 CPTCLEEYTSENPKIVTKCSHHFHLSCIYEWMERSENCPVCGKVMEFNET 230
Mediates E2-dependent protein ubiquitination.
Arabidopsis thaliana (taxid: 3702)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|Q4TU14|RHF1A_ARATH E3 ubiquitin-protein ligase RHF1A OS=Arabidopsis thaliana GN=RHF1A PE=1 SV=1 Back     alignment and function description
>sp|Q9ZT42|RHF2A_ARATH E3 ubiquitin-protein ligase RHF2A OS=Arabidopsis thaliana GN=RHF2A PE=2 SV=1 Back     alignment and function description
>sp|Q9D0C1|RN115_MOUSE E3 ubiquitin-protein ligase RNF115 OS=Mus musculus GN=Rnf115 PE=1 SV=1 Back     alignment and function description
>sp|Q9Y4L5|RN115_HUMAN E3 ubiquitin-protein ligase RNF115 OS=Homo sapiens GN=RNF115 PE=1 SV=2 Back     alignment and function description
>sp|Q5XF85|ATL42_ARATH E3 ubiquitin-protein ligase ATL42 OS=Arabidopsis thaliana GN=ATL42 PE=1 SV=2 Back     alignment and function description
>sp|O54965|RNF13_MOUSE E3 ubiquitin-protein ligase RNF13 OS=Mus musculus GN=Rnf13 PE=1 SV=2 Back     alignment and function description
>sp|Q9NVW2|RNF12_HUMAN E3 ubiquitin-protein ligase RLIM OS=Homo sapiens GN=RLIM PE=1 SV=3 Back     alignment and function description
>sp|Q66HG0|RNF13_RAT E3 ubiquitin-protein ligase RNF13 OS=Rattus norvegicus GN=Rnf13 PE=2 SV=1 Back     alignment and function description
>sp|Q9M2S6|SDIR1_ARATH E3 ubiquitin-protein ligase SDIR1 OS=Arabidopsis thaliana GN=SDIR1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query194
356526552227 PREDICTED: E3 ubiquitin-protein ligase A 0.969 0.828 0.400 3e-32
225451825225 PREDICTED: E3 ubiquitin-protein ligase A 0.989 0.853 0.418 8e-32
363807934226 uncharacterized protein LOC100790543 [Gl 0.969 0.831 0.385 1e-31
358248876229 uncharacterized protein LOC100777068 [Gl 0.989 0.838 0.384 1e-30
449447440227 PREDICTED: E3 ubiquitin-protein ligase A 0.963 0.823 0.397 2e-30
90657595229 hypothetical protein [Cleome spinosa] 0.963 0.816 0.363 4e-30
449481398227 PREDICTED: E3 ubiquitin-protein ligase A 0.963 0.823 0.393 5e-30
224120794225 predicted protein [Populus trichocarpa] 0.948 0.817 0.387 1e-29
388511135229 unknown [Lotus japonicus] 0.984 0.834 0.369 2e-29
358248273229 uncharacterized protein LOC100790104 [Gl 0.958 0.812 0.387 4e-29
>gi|356526552|ref|XP_003531881.1| PREDICTED: E3 ubiquitin-protein ligase At3g02290-like [Glycine max] Back     alignment and taxonomy information
 Score =  143 bits (361), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 93/232 (40%), Positives = 118/232 (50%), Gaps = 44/232 (18%)

Query: 1   MGSLCCCFRVNDHEDSSLSNSNDNEGCRCPNCRLHTLLNKYTALFKKDETLAGPSDAHQG 60
           MG++CCCF V+D ED    NS+    C C +C +   L  Y ++F++ E  A PS   QG
Sbjct: 1   MGAVCCCFNVDDFEDYMNPNSSVYRNCMCLSCFVQNFLTVYESIFRRGEVHAIPSSI-QG 59

Query: 61  AALSTSNSSSSSPSSCNILPEIVTSQLRTMRFD--PQLLHKQL------RYGDSTNCPER 112
           AA  TS +S       N L ++  S  R + +D  P+    Q       R   S++  E 
Sbjct: 60  AASMTSTASLD-----NSLSDMYRSPPRPLPYDADPRFFRSQREGLVSRREKGSSHLNEE 114

Query: 113 AE-----------------------EDGRLTKLERLDLLLKSPLRKLGP-------EDED 142
           +E                       EDG      +  + L S     G        E+ED
Sbjct: 115 SEPLRGDVDADSESLNSGGKWNDTSEDGSKEYRSKSSVRLSSAKLTTGAGVVYSSSEEED 174

Query: 143 VCPTCLEEYTLENPKIVTQCRHHYHLSCIYEWMERSPTCPVCSKVMVFDETT 194
           VCPTCLEEYT ENPKIVT+C HH+HL CIYEWMERS +CPVC KVMVFDETT
Sbjct: 175 VCPTCLEEYTEENPKIVTKCSHHFHLGCIYEWMERSDSCPVCGKVMVFDETT 226

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225451825|ref|XP_002281596.1| PREDICTED: E3 ubiquitin-protein ligase At3g02290 [Vitis vinifera] gi|298204451|emb|CBI16931.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|363807934|ref|NP_001241941.1| uncharacterized protein LOC100790543 [Glycine max] gi|255641258|gb|ACU20906.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|358248876|ref|NP_001240211.1| uncharacterized protein LOC100777068 [Glycine max] gi|255647555|gb|ACU24241.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|449447440|ref|XP_004141476.1| PREDICTED: E3 ubiquitin-protein ligase At3g02290-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|90657595|gb|ABD96894.1| hypothetical protein [Cleome spinosa] Back     alignment and taxonomy information
>gi|449481398|ref|XP_004156171.1| PREDICTED: E3 ubiquitin-protein ligase At3g02290-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224120794|ref|XP_002330953.1| predicted protein [Populus trichocarpa] gi|222873147|gb|EEF10278.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|388511135|gb|AFK43629.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|358248273|ref|NP_001240108.1| uncharacterized protein LOC100790104 [Glycine max] gi|255637513|gb|ACU19083.1| unknown [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query194
TAIR|locus:2076542231 AT3G02290 [Arabidopsis thalian 0.283 0.238 0.836 4.3e-32
TAIR|locus:2143251232 AT5G15790 [Arabidopsis thalian 0.283 0.237 0.8 2.6e-30
TAIR|locus:2177881212 AT5G41350 [Arabidopsis thalian 0.283 0.259 0.690 2.9e-22
TAIR|locus:505006415190 RHB1A "RING-H2 finger B1A" [Ar 0.278 0.284 0.555 6.7e-17
TAIR|locus:2129525 371 RHF1A "RING-H2 group F1A" [Ara 0.252 0.132 0.510 6.4e-12
TAIR|locus:2169145208 AT5G37270 "AT5G37270" [Arabido 0.262 0.245 0.388 1.6e-08
UNIPROTKB|Q9Y4L5304 RNF115 "E3 ubiquitin-protein l 0.262 0.167 0.431 1.7e-08
MGI|MGI:1915095305 Rnf115 "ring finger protein 11 0.262 0.167 0.431 1.7e-08
UNIPROTKB|E2QY59319 RNF115 "Uncharacterized protei 0.262 0.159 0.431 1.9e-08
UNIPROTKB|F1SDD6231 F1SDD6 "Uncharacterized protei 0.262 0.220 0.411 2e-08
TAIR|locus:2076542 AT3G02290 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 272 (100.8 bits), Expect = 4.3e-32, Sum P(2) = 4.3e-32
 Identities = 46/55 (83%), Positives = 49/55 (89%)

Query:   139 EDEDVCPTCLEEYTLENPKIVTQCRHHYHLSCIYEWMERSPTCPVCSKVMVFDET 193
             EDEDVCPTCLEEYT ENPKIVT+C HH+HLSCIYEWMERS  CPVC KVM F+ET
Sbjct:   176 EDEDVCPTCLEEYTSENPKIVTKCSHHFHLSCIYEWMERSENCPVCGKVMEFNET 230
GO:0005634 "nucleus" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA;ISS
TAIR|locus:2143251 AT5G15790 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2177881 AT5G41350 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:505006415 RHB1A "RING-H2 finger B1A" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2129525 RHF1A "RING-H2 group F1A" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2169145 AT5G37270 "AT5G37270" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q9Y4L5 RNF115 "E3 ubiquitin-protein ligase RNF115" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1915095 Rnf115 "ring finger protein 115" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E2QY59 RNF115 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1SDD6 F1SDD6 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query194
pfam1363946 pfam13639, zf-RING_2, Ring finger domain 2e-08
pfam1267873 pfam12678, zf-rbx1, RING-H2 zinc finger 2e-07
COG5243 491 COG5243, HRD1, HRD ubiquitin ligase complex, ER me 5e-07
pfam1392345 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI 1e-06
cd0016245 cd00162, RING, RING-finger (Really Interesting New 3e-06
COG5540374 COG5540, COG5540, RING-finger-containing ubiquitin 2e-04
smart0018440 smart00184, RING, Ring finger 2e-04
pfam1286185 pfam12861, zf-Apc11, Anaphase-promoting complex su 7e-04
COG52191525 COG5219, COG5219, Uncharacterized conserved protei 0.003
pfam0009740 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING 0.003
COG519488 COG5194, APC11, Component of SCF ubiquitin ligase 0.004
>gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain Back     alignment and domain information 
 Score = 48.2 bits (115), Expect = 2e-08
 Identities = 17/45 (37%), Positives = 25/45 (55%)

Query: 142 DVCPTCLEEYTLENPKIVTQCRHHYHLSCIYEWMERSPTCPVCSK 186
           D CP CL+E+      +V  C H +H  C+ +W+  S TCP+C  
Sbjct: 1   DECPICLDEFEPGEEVVVLPCGHVFHKECLDKWLRSSNTCPLCRA 45

Length = 46
>gnl|CDD|221705 pfam12678, zf-rbx1, RING-H2 zinc finger Back     alignment and domain information
>gnl|CDD|227568 COG5243, HRD1, HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>gnl|CDD|227827 COG5540, COG5540, RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|214546 smart00184, RING, Ring finger Back     alignment and domain information
>gnl|CDD|193335 pfam12861, zf-Apc11, Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>gnl|CDD|227544 COG5219, COG5219, Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>gnl|CDD|215715 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|227521 COG5194, APC11, Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 194
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 99.63
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 99.51
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 99.43
COG5243 491 HRD1 HRD ubiquitin ligase complex, ER membrane com 99.37
PHA02929238 N1R/p28-like protein; Provisional 99.29
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 99.28
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 99.23
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 99.15
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 99.15
cd0016245 RING RING-finger (Really Interesting New Gene) dom 99.14
PLN03208 193 E3 ubiquitin-protein ligase RMA2; Provisional 99.06
KOG0823 230 consensus Predicted E3 ubiquitin ligase [Posttrans 99.06
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 99.05
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 99.05
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 98.96
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 98.96
PF1463444 zf-RING_5: zinc-RING finger domain 98.96
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 98.95
KOG0802 543 consensus E3 ubiquitin ligase [Posttranslational m 98.9
PHA02926242 zinc finger-like protein; Provisional 98.86
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 98.85
smart0050463 Ubox Modified RING finger domain. Modified RING fi 98.84
KOG149384 consensus Anaphase-promoting complex (APC), subuni 98.69
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 98.65
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 98.55
KOG2930114 consensus SCF ubiquitin ligase, Rbx1 component [Po 98.49
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 98.47
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 98.46
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 98.44
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 98.33
KOG2164 513 consensus Predicted E3 ubiquitin ligase [Posttrans 98.28
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 98.23
KOG0804 493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 98.19
KOG1734328 consensus Predicted RING-containing E3 ubiquitin l 98.19
KOG2177 386 consensus Predicted E3 ubiquitin ligase [Posttrans 98.18
KOG0287 442 consensus Postreplication repair protein RAD18 [Re 97.98
COG52191525 Uncharacterized conserved protein, contains RING Z 97.88
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 97.81
KOG1039 344 consensus Predicted E3 ubiquitin ligase [Posttrans 97.77
KOG0825 1134 consensus PHD Zn-finger protein [General function 97.71
KOG0311 381 consensus Predicted E3 ubiquitin ligase [Posttrans 97.69
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 97.67
KOG4445 368 consensus Uncharacterized conserved protein, conta 97.6
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 97.48
KOG4265349 consensus Predicted E3 ubiquitin ligase [Posttrans 97.46
KOG1941518 consensus Acetylcholine receptor-associated protei 97.29
KOG0297 391 consensus TNF receptor-associated factor [Signal t 97.26
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 97.25
KOG1428 3738 consensus Inhibitor of type V adenylyl cyclases/Ne 97.15
KOG4159 398 consensus Predicted E3 ubiquitin ligase [Posttrans 97.07
PF1290647 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A. 96.94
COG5152259 Uncharacterized conserved protein, contains RING a 96.66
PF05883134 Baculo_RING: Baculovirus U-box/Ring-like domain; I 96.57
KOG2660 331 consensus Locus-specific chromosome binding protei 96.47
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 96.43
KOG1785 563 consensus Tyrosine kinase negative regulator CBL [ 96.39
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 96.38
KOG1952 950 consensus Transcription factor NF-X1, contains NFX 96.26
PHA02825162 LAP/PHD finger-like protein; Provisional 96.23
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 96.22
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 96.02
KOG3039303 consensus Uncharacterized conserved protein [Funct 96.02
PHA02862156 5L protein; Provisional 95.89
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 95.81
KOG1002 791 consensus Nucleotide excision repair protein RAD16 95.81
KOG3970 299 consensus Predicted E3 ubiquitin ligase [Posttrans 95.7
PHA03096284 p28-like protein; Provisional 95.65
KOG0801205 consensus Predicted E3 ubiquitin ligase [Posttrans 95.55
PF0874643 zf-RING-like: RING-like domain; InterPro: IPR01485 95.19
KOG1814 445 consensus Predicted E3 ubiquitin ligase [Posttrans 94.99
PF04641260 Rtf2: Rtf2 RING-finger 94.97
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 94.79
KOG1940276 consensus Zn-finger protein [General function pred 94.31
PF0385450 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc 94.16
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 94.07
KOG1571355 consensus Predicted E3 ubiquitin ligase [Posttrans 93.97
KOG3268234 consensus Predicted E3 ubiquitin ligase [Posttrans 93.96
COG5222427 Uncharacterized conserved protein, contains RING Z 93.88
KOG4692489 consensus Predicted E3 ubiquitin ligase [Posttrans 93.79
COG5236 493 Uncharacterized conserved protein, contains RING Z 93.75
KOG4275350 consensus Predicted E3 ubiquitin ligase [Posttrans 93.42
KOG0826357 consensus Predicted E3 ubiquitin ligase involved i 93.24
COG5175 480 MOT2 Transcriptional repressor [Transcription] 92.56
KOG0298 1394 consensus DEAD box-containing helicase-like transc 90.82
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 90.69
KOG3002 299 consensus Zn finger protein [General function pred 90.53
KOG2034911 consensus Vacuolar sorting protein PEP3/VPS18 [Int 90.26
KOG2817394 consensus Predicted E3 ubiquitin ligase [Posttrans 90.05
KOG1001 674 consensus Helicase-like transcription factor HLTF/ 89.39
KOG2932 389 consensus E3 ubiquitin ligase involved in ubiquiti 88.83
KOG1609 323 consensus Protein involved in mRNA turnover and st 88.52
KOG3053 293 consensus Uncharacterized conserved protein [Funct 87.9
COG5183 1175 SSM4 Protein involved in mRNA turnover and stabili 87.78
PF07800162 DUF1644: Protein of unknown function (DUF1644); In 86.48
PF1444654 Prok-RING_1: Prokaryotic RING finger family 1 85.49
KOG03091081 consensus Conserved WD40 repeat-containing protein 85.37
PF10272358 Tmpp129: Putative transmembrane protein precursor; 85.03
PF0289150 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR0041 84.11
KOG0802543 consensus E3 ubiquitin ligase [Posttranslational m 82.72
KOG1812 384 consensus Predicted E3 ubiquitin ligase [Posttrans 82.37
KOG1100207 consensus Predicted E3 ubiquitin ligase [Posttrans 80.01
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information 
Probab=99.63  E-value=1.4e-16  Score=99.79  Aligned_cols=44  Identities=45%  Similarity=1.086  Sum_probs=40.3

Q ss_pred             cccccccccccCCCCeEEecCCCeecHHHHHHHHHcCCCCCccc
Q 029389          142 DVCPTCLEEYTLENPKIVTQCRHHYHLSCIYEWMERSPTCPVCS  185 (194)
Q Consensus       142 ~~C~ICle~~~~~~~~~~l~C~H~FH~~CI~~Wl~~~~tCPvCR  185 (194)
                      ++|+||+++|..++.++.++|+|.||.+||.+|++++.+||+||
T Consensus         1 d~C~IC~~~~~~~~~~~~l~C~H~fh~~Ci~~~~~~~~~CP~CR   44 (44)
T PF13639_consen    1 DECPICLEEFEDGEKVVKLPCGHVFHRSCIKEWLKRNNSCPVCR   44 (44)
T ss_dssp             -CETTTTCBHHTTSCEEEETTSEEEEHHHHHHHHHHSSB-TTTH
T ss_pred             CCCcCCChhhcCCCeEEEccCCCeeCHHHHHHHHHhCCcCCccC
Confidence            47999999999888999999999999999999999999999997

...
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length Back     alignment and domain information
>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] Back     alignment and domain information
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>KOG1952 consensus Transcription factor NF-X1, contains NFX-type Zn2+-binding and R3H domains [Transcription] Back     alignment and domain information
>PHA02825 LAP/PHD finger-like protein; Provisional Back     alignment and domain information
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PHA02862 5L protein; Provisional Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>KOG3970 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA03096 p28-like protein; Provisional Back     alignment and domain information
>KOG0801 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO) Back     alignment and domain information
>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>KOG1940 consensus Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF03854 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3268 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3002 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>KOG2034 consensus Vacuolar sorting protein PEP3/VPS18 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1609 consensus Protein involved in mRNA turnover and stability [RNA processing and modification] Back     alignment and domain information
>KOG3053 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5183 SSM4 Protein involved in mRNA turnover and stability [RNA processing and modification] Back     alignment and domain information
>PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function Back     alignment and domain information
>PF14446 Prok-RING_1: Prokaryotic RING finger family 1 Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PF10272 Tmpp129: Putative transmembrane protein precursor; InterPro: IPR018801 This entry consists of proteins conserved from worms to humans Back     alignment and domain information
>PF02891 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1812 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1100 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query194
2ect_A78 Solution Structure Of The Zinc Finger, C3hc4 Type ( 2e-05
2l0b_A91 Solution Nmr Structure Of Zinc Finger Domain Of E3 6e-04
>pdb|2ECT|A Chain A, Solution Structure Of The Zinc Finger, C3hc4 Type (Ring Finger) Domain Of Ring Finger Protein 126 Length = 78 Back     alignment and structure 
Iteration: 1

 Score = 45.1 bits (105), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 26/51 (50%)
Query: 144 CPTCLEEYTLENPKIVTQCRHHYHLSCIYEWMERSPTCPVCSKVMVFDETT 194
           CP C E+Y L        C H +H SCI  W+E+  +CPVC K +    T 
Sbjct: 18  CPVCKEDYALGESVRQLPCNHLFHDSCIVPWLEQHDSCPVCRKSLTGQNTA 68
>pdb|2L0B|A Chain A, Solution Nmr Structure Of Zinc Finger Domain Of E3 Ubiquitin-Protein Ligase Praja-1 From Homo Sapiens, Northeast Structural Genomics Consortium (Nesg) Target Hr4710b Length = 91 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query194
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 5e-11
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 2e-10
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 2e-10
2ecm_A55 Ring finger and CHY zinc finger domain- containing 3e-10
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 1e-09
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 2e-09
2ect_A78 Ring finger protein 126; metal binding protein, st 4e-09
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 6e-09
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 7e-09
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 1e-08
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 1e-08
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 1e-08
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 4e-08
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 1e-07
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 2e-07
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 7e-07
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 1e-06
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 2e-06
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 7e-06
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 7e-06
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 9e-06
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 1e-05
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 2e-05
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 2e-05
4epo_C149 E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 3e-05
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 4e-05
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 4e-04
3nw0_A238 Non-structural maintenance of chromosomes element 4e-04
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 Back     alignment and structure
 Score = 55.1 bits (133), Expect = 5e-11
 Identities = 16/47 (34%), Positives = 24/47 (51%), Gaps = 2/47 (4%)

Query: 138 PEDEDVCPTCLEEYTLENPKIVTQCRHHYHLSCIYEWMERSPTCPVC 184
               + CP CLE+    N  +   C H +   CI  W+ ++PTCP+C
Sbjct: 2   ATVAERCPICLEDP--SNYSMALPCLHAFCYVCITRWIRQNPTCPLC 46
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Length = 55 Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 78 Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Length = 55 Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Length = 114 Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Length = 117 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Length = 106 Back     alignment and structure
>4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Length = 238 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query194
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 99.66
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 99.63
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 99.63
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 99.62
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 99.6
2ect_A78 Ring finger protein 126; metal binding protein, st 99.59
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 99.57
2ecm_A55 Ring finger and CHY zinc finger domain- containing 99.56
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 99.52
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 99.51
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 99.51
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 99.5
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 99.5
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 99.48
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 99.48
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 99.46
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 99.45
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 99.45
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 99.44
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 99.43
2ysl_A73 Tripartite motif-containing protein 31; ring-type 99.4
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 99.39
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 99.38
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 99.38
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 99.34
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 99.34
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 99.33
2ecw_A85 Tripartite motif-containing protein 30; metal bind 99.33
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 99.33
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 99.33
2ysj_A63 Tripartite motif-containing protein 31; ring-type 99.3
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 99.29
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 99.29
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 99.29
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 99.29
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 99.27
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 99.27
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 99.26
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 99.24
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 99.21
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 99.18
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 99.17
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 99.17
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 99.14
1z6u_A150 NP95-like ring finger protein isoform B; structura 99.13
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 99.12
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 99.1
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 99.09
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 99.08
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 99.07
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 99.06
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 99.05
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 99.02
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 98.99
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 98.98
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 98.95
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 98.92
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 98.91
3hcs_A 170 TNF receptor-associated factor 6; cross-brace, bet 98.91
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 98.84
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.79
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 98.76
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 98.73
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 98.7
2ea5_A68 Cell growth regulator with ring finger domain prot 98.65
2f42_A179 STIP1 homology and U-box containing protein 1; cha 98.64
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 98.62
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 98.6
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 98.52
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 98.37
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 98.11
3nw0_A238 Non-structural maintenance of chromosomes element 97.95
2ko5_A99 Ring finger protein Z; lassa fever virus-Z, negati 96.35
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 95.65
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 93.23
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 88.39
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 87.26
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 85.81
2k16_A75 Transcription initiation factor TFIID subunit 3; p 84.68
1fp0_A88 KAP-1 corepressor; PHD domain, C3HC4 type zinc bin 82.71
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 82.6
1we9_A64 PHD finger family protein; structural genomics, PH 82.15
1wil_A89 KIAA1045 protein; ring finger domain, structural g 82.06
2yql_A56 PHD finger protein 21A; PHD domain, structural gen 81.54
3m62_A968 Ubiquitin conjugation factor E4; armadillo-like re 81.45
2puy_A60 PHD finger protein 21A; PHD finger, histone CODE, 81.11
3i2d_A371 E3 SUMO-protein ligase SIZ1; signal transduction, 80.97
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
Probab=99.66  E-value=8e-17  Score=114.61  Aligned_cols=70  Identities=26%  Similarity=0.518  Sum_probs=56.2

Q ss_pred             hhhhhhhhccCCCcc-----CCCCCCcccccccccccCCCCeEEecCCCeecHHHHHHHHHcCCCCCcccccccC
Q 029389          121 KLERLDLLLKSPLRK-----LGPEDEDVCPTCLEEYTLENPKIVTQCRHHYHLSCIYEWMERSPTCPVCSKVMVF  190 (194)
Q Consensus       121 k~~~~~s~~~~~~~~-----~~~~~~~~C~ICle~~~~~~~~~~l~C~H~FH~~CI~~Wl~~~~tCPvCR~~v~~  190 (194)
                      ++++.+.+..++...     ...+++..|+||++.|..++..+.++|+|.||..||..|++.+.+||+||+.+..
T Consensus        15 ~~~s~~~i~~lp~~~~~~~~~~~~~~~~C~IC~~~~~~~~~~~~l~C~H~Fh~~Ci~~wl~~~~~CP~Cr~~~~~   89 (91)
T 2l0b_A           15 PPASKESIDALPEILVTEDHGAVGQEMCCPICCSEYVKGDVATELPCHHYFHKPCVSIWLQKSGTCPVCRCMFPP   89 (91)
T ss_dssp             CCCCHHHHHTSCEEECCTTCSSSSSCSEETTTTEECCTTCEEEEETTTEEEEHHHHHHHHTTTCBCTTTCCBSSC
T ss_pred             CCCCHHHHHhCCCeeecccccccCCCCCCcccChhhcCCCcEEecCCCChHHHHHHHHHHHcCCcCcCcCccCCC
Confidence            445555555555433     3345677899999999988888889999999999999999999999999998864
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Back     alignment and structure
>1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Back     alignment and structure
>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 Back     alignment and structure
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A Back     alignment and structure
>2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Back     alignment and structure
>3i2d_A E3 SUMO-protein ligase SIZ1; signal transduction, replication, ring E3, PIAS, ubiquitin, UBC9, metal-binding, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 194
d1iyma_55 g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati 2e-10
d1chca_68 g.44.1.1 (A:) Immediate early protein, IEEHV {Equi 4e-09
d3dplr188 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of S 9e-08
d1fbva479 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta 6e-06
d1vyxa_60 g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal do 6e-05
d1g25a_65 g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi 1e-04
d1v87a_114 g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mou 2e-04
d1rmda286 g.44.1.1 (A:1-86) V(D)J recombination activating p 0.001
d1wima_94 g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA016 0.002
d1jm7a_103 g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie 0.003
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: EL5 RING-H2 domain
species: Rice (Oryza sativa) [TaxId: 4530]

 Score = 52.2 bits (125), Expect = 2e-10
 Identities = 15/47 (31%), Positives = 23/47 (48%), Gaps = 1/47 (2%)

Query: 139 EDEDVCPTCLEEYTL-ENPKIVTQCRHHYHLSCIYEWMERSPTCPVC 184
           +D   C  CL E    E  + + +C H +H  C+  W+    TCP+C
Sbjct: 3   DDGVECAVCLAELEDGEEARFLPRCGHGFHAECVDMWLGSHSTCPLC 49
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Length = 60 Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query194
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 99.72
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 99.56
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 99.54
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 99.5
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 99.49
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 99.47
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 99.47
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 99.38
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 99.29
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 99.25
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 99.24
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 99.23
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 99.13
d2c2la280 STIP1 homology and U box-containing protein 1, STU 99.1
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 99.08
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 98.78
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 98.63
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 93.35
d1wila_89 Hypothetical protein KIAA1045 {Human (Homo sapiens 90.51
d1fp0a170 Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo 89.51
d1mm2a_61 Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 83.04
d1we9a_64 PHD finger protein At5g26210 {Thale cress (Arabido 80.71
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: EL5 RING-H2 domain
species: Rice (Oryza sativa) [TaxId: 4530]

Probab=99.72  E-value=1.3e-18  Score=111.84  Aligned_cols=52  Identities=29%  Similarity=0.735  Sum_probs=46.2

Q ss_pred             CCCcccccccccccCCCCeEEe-cCCCeecHHHHHHHHHcCCCCCcccccccC
Q 029389          139 EDEDVCPTCLEEYTLENPKIVT-QCRHHYHLSCIYEWMERSPTCPVCSKVMVF  190 (194)
Q Consensus       139 ~~~~~C~ICle~~~~~~~~~~l-~C~H~FH~~CI~~Wl~~~~tCPvCR~~v~~  190 (194)
                      +++.+|+|||++|..++.+..+ .|+|.||..||.+||+++.+||+||+.|.+
T Consensus         3 ed~~~C~ICl~~~~~~~~~~~l~~C~H~Fh~~Ci~~Wl~~~~~CP~CR~~i~v   55 (55)
T d1iyma_           3 DDGVECAVCLAELEDGEEARFLPRCGHGFHAECVDMWLGSHSTCPLCRLTVVV   55 (55)
T ss_dssp             CCSCCCTTTCCCCCTTSCCEECSSSCCEECTTHHHHTTTTCCSCSSSCCCSCC
T ss_pred             CCCCCCeEECccccCCCEEEEeCCCCCcccHHHHHHHHHhCCcCCCCCCEeEC
Confidence            5667899999999987777766 599999999999999999999999998863
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure