Citrus Sinensis ID: 029430
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 193 | ||||||
| 224117478 | 278 | predicted protein [Populus trichocarpa] | 0.927 | 0.643 | 0.668 | 1e-64 | |
| 255564003 | 245 | sgp1 monomeric G-protein, putative [Rici | 0.886 | 0.697 | 0.692 | 4e-63 | |
| 224126377 | 279 | predicted protein [Populus trichocarpa] | 0.922 | 0.637 | 0.666 | 5e-61 | |
| 147838102 | 277 | hypothetical protein VITISV_008356 [Viti | 0.917 | 0.638 | 0.666 | 3e-58 | |
| 225461736 | 282 | PREDICTED: septum-promoting GTP-binding | 0.917 | 0.627 | 0.666 | 3e-58 | |
| 356553345 | 282 | PREDICTED: septum-promoting GTP-binding | 0.937 | 0.641 | 0.614 | 1e-57 | |
| 356501505 | 282 | PREDICTED: septum-promoting GTP-binding | 0.932 | 0.638 | 0.622 | 2e-57 | |
| 357494385 | 289 | Ras-related protein Rab-37 [Medicago tru | 0.963 | 0.643 | 0.577 | 3e-55 | |
| 297796357 | 288 | GTP-binding family protein [Arabidopsis | 0.963 | 0.645 | 0.564 | 2e-51 | |
| 356567378 | 284 | PREDICTED: septum-promoting GTP-binding | 0.937 | 0.637 | 0.561 | 2e-46 |
| >gi|224117478|ref|XP_002317584.1| predicted protein [Populus trichocarpa] gi|222860649|gb|EEE98196.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 251 bits (641), Expect = 1e-64, Method: Compositional matrix adjust.
Identities = 127/190 (66%), Positives = 152/190 (80%), Gaps = 11/190 (5%)
Query: 1 MAKIIHEATENMTQLCRRVVHV-NIRRSLFDRVSIFRRFFRFIWERILVCSIGKQPAVRY 59
MA+++HE MTQLCR VVHV NI+ ++ +RV++F++FF+FIW+RIL CSIGK VRY
Sbjct: 1 MAEVVHE---KMTQLCREVVHVKNIKWNILERVTVFKQFFQFIWDRILACSIGK--PVRY 55
Query: 60 QKLTRRSSSESSPAPDTMEAGLVELSRTFSSGYDTDSDLVSLKISLLGDCQIGKTSF-VK 118
++L R S P P+ MEAG+ L SG++ DSDLV LKISLLGDCQIGKTSF +K
Sbjct: 56 RRLASRPYS---PPPEAMEAGVESLEAASCSGFNPDSDLVRLKISLLGDCQIGKTSFMIK 112
Query: 119 YVGNEQERS-LQMAGLNLINKTLMVQGARIAFSIWDVGGDSRSFDHVPIACKDAVAILFM 177
YVG+EQE+ L M GLNL++KTL VQGARI+FSIWDV GDSRS DHVPIACKDAVAILFM
Sbjct: 113 YVGDEQEKKCLGMTGLNLMDKTLFVQGARISFSIWDVAGDSRSIDHVPIACKDAVAILFM 172
Query: 178 FDLTSRCTLN 187
FDLTSRCTLN
Sbjct: 173 FDLTSRCTLN 182
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255564003|ref|XP_002523001.1| sgp1 monomeric G-protein, putative [Ricinus communis] gi|223537813|gb|EEF39431.1| sgp1 monomeric G-protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|224126377|ref|XP_002319823.1| predicted protein [Populus trichocarpa] gi|222858199|gb|EEE95746.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|147838102|emb|CAN60928.1| hypothetical protein VITISV_008356 [Vitis vinifera] gi|302142871|emb|CBI20166.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|225461736|ref|XP_002285529.1| PREDICTED: septum-promoting GTP-binding protein 1 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356553345|ref|XP_003545017.1| PREDICTED: septum-promoting GTP-binding protein 1-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356501505|ref|XP_003519565.1| PREDICTED: septum-promoting GTP-binding protein 1-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357494385|ref|XP_003617481.1| Ras-related protein Rab-37 [Medicago truncatula] gi|355518816|gb|AET00440.1| Ras-related protein Rab-37 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|297796357|ref|XP_002866063.1| GTP-binding family protein [Arabidopsis lyrata subsp. lyrata] gi|297311898|gb|EFH42322.1| GTP-binding family protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|356567378|ref|XP_003551897.1| PREDICTED: septum-promoting GTP-binding protein 1-like [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 193 | ||||||
| TAIR|locus:2160125 | 288 | SGP1 [Arabidopsis thaliana (ta | 0.958 | 0.642 | 0.489 | 6.1e-39 | |
| TAIR|locus:2093019 | 292 | SGP2 [Arabidopsis thaliana (ta | 0.481 | 0.318 | 0.663 | 2.3e-31 | |
| ASPGD|ASPL0000066888 | 314 | spgA [Emericella nidulans (tax | 0.626 | 0.385 | 0.430 | 3.9e-21 | |
| DICTYBASE|DDB_G0291269 | 203 | spg1 "small GTPase" [Dictyoste | 0.518 | 0.492 | 0.480 | 1e-20 | |
| POMBASE|SPAC1565.06c | 198 | spg1 "GTPase Spg1" [Schizosacc | 0.492 | 0.479 | 0.463 | 8.3e-19 | |
| SGD|S000004529 | 245 | TEM1 "GTP-binding protein of t | 0.461 | 0.363 | 0.384 | 8.2e-12 | |
| FB|FBgn0086913 | 388 | Rab26 "Rab26" [Drosophila mela | 0.455 | 0.226 | 0.419 | 1.1e-09 | |
| UNIPROTKB|E1C6J7 | 213 | RAB17 "Uncharacterized protein | 0.450 | 0.408 | 0.340 | 2.9e-09 | |
| UNIPROTKB|D4A0G7 | 223 | LOC100364984 "RCG35079, isofor | 0.512 | 0.443 | 0.339 | 1.3e-08 | |
| MGI|MGI:1929945 | 223 | Rab37 "RAB37, member of RAS on | 0.512 | 0.443 | 0.339 | 2.3e-08 |
| TAIR|locus:2160125 SGP1 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 416 (151.5 bits), Expect = 6.1e-39, P = 6.1e-39
Identities = 94/192 (48%), Positives = 120/192 (62%)
Query: 1 MAKIIHEATENMTQLCRRVVHVNIRRSLXXXXXXXXXXXXXXXXXXLVCSIGKQPAVRYQ 60
MA+ +HE +T CR++VHVN + + + CS + + Y+
Sbjct: 1 MAEKVHEIAGKITPFCRKIVHVNRKWRIIERVSIFGDFFRFLWRKIVSCSSIIEKPILYR 60
Query: 61 KLTRRSSSESSPAPDTMEAGLVELS---RTFSSGYDTDSDLVSLKISLLGDCQIGKTSFV 117
++ + SS + D + E + R F S +DSDLVSLKISLLGDCQ GKT+FV
Sbjct: 61 RIVHKISSTAGDIFDGDDDTTTEPTVSGRRFGSS--SDSDLVSLKISLLGDCQTGKTTFV 118
Query: 118 -KYVGNEQERSLQMAGLNLINKTLMVQGARIAFSIWDVGGDS-RSFDHVPIACKDAVAIL 175
KYVG+E + L+M GLNL++KT VQG I+FSIWDVGGD RS DH+PIACKDAVAIL
Sbjct: 119 VKYVGDENQSFLEMTGLNLMDKTFYVQGVTISFSIWDVGGDEKRSKDHIPIACKDAVAIL 178
Query: 176 FMFDLTSRCTLN 187
FMFDLTSR TLN
Sbjct: 179 FMFDLTSRSTLN 190
|
|
| TAIR|locus:2093019 SGP2 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| ASPGD|ASPL0000066888 spgA [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0291269 spg1 "small GTPase" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| POMBASE|SPAC1565.06c spg1 "GTPase Spg1" [Schizosaccharomyces pombe (taxid:4896)] | Back alignment and assigned GO terms |
|---|
| SGD|S000004529 TEM1 "GTP-binding protein of the Ras family involved in M-phase termination" [Saccharomyces cerevisiae (taxid:4932)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0086913 Rab26 "Rab26" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1C6J7 RAB17 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|D4A0G7 LOC100364984 "RCG35079, isoform CRA_b" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1929945 Rab37 "RAB37, member of RAS oncogene family" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 193 | |||
| cd04128 | 182 | cd04128, Spg1, Septum-promoting GTPase (Spg1) | 2e-43 | |
| pfam08477 | 116 | pfam08477, Miro, Miro-like protein | 7e-18 | |
| cd00154 | 159 | cd00154, Rab, Ras-related in brain (Rab) family of | 3e-10 | |
| cd04123 | 162 | cd04123, Rab21, Rab GTPase family 21 (Rab21) | 8e-10 | |
| PLN03118 | 211 | PLN03118, PLN03118, Rab family protein; Provisiona | 6e-08 | |
| cd04112 | 191 | cd04112, Rab26, Rab GTPase family 26 (Rab26) | 2e-07 | |
| cd01864 | 165 | cd01864, Rab19, Rab GTPase family 19 (Rab19) | 6e-07 | |
| cd04116 | 170 | cd04116, Rab9, Rab GTPase family 9 (Rab9) | 1e-06 | |
| cd01860 | 163 | cd01860, Rab5_related, Rab-related GTPase family i | 3e-06 | |
| cd01861 | 161 | cd01861, Rab6, Rab GTPase family 6 (Rab6) | 5e-06 | |
| COG1100 | 219 | COG1100, COG1100, GTPase SAR1 and related small G | 7e-06 | |
| smart00175 | 164 | smart00175, RAB, Rab subfamily of small GTPases | 2e-05 | |
| cd04126 | 220 | cd04126, Rab20, Rab GTPase family 20 (Rab20) | 4e-05 | |
| pfam00071 | 162 | pfam00071, Ras, Ras family | 4e-05 | |
| PLN03110 | 216 | PLN03110, PLN03110, Rab GTPase; Provisional | 5e-05 | |
| PTZ00132 | 215 | PTZ00132, PTZ00132, GTP-binding nuclear protein Ra | 6e-05 | |
| cd04131 | 176 | cd04131, Rnd, Rho family GTPase subfamily Rnd incl | 2e-04 | |
| cd01863 | 161 | cd01863, Rab18, Rab GTPase family 18 (Rab18) | 2e-04 | |
| cd01865 | 165 | cd01865, Rab3, Rab GTPase family 3 contains Rab3A, | 4e-04 | |
| cd00877 | 166 | cd00877, Ran, Ras-related nuclear proteins (Ran)/T | 7e-04 | |
| cd04127 | 180 | cd04127, Rab27A, Rab GTPase family 27a (Rab27a) | 8e-04 | |
| cd04111 | 211 | cd04111, Rab39, Rab GTPase family 39 (Rab39) | 0.001 | |
| cd04124 | 161 | cd04124, RabL2, Rab GTPase-like family 2 (Rab-like | 0.001 | |
| cd04117 | 164 | cd04117, Rab15, Rab GTPase family 15 (Rab15) | 0.001 | |
| cd04115 | 170 | cd04115, Rab33B_Rab33A, Rab GTPase family 33 inclu | 0.002 | |
| PLN03071 | 219 | PLN03071, PLN03071, GTP-binding nuclear protein Ra | 0.002 | |
| PTZ00099 | 176 | PTZ00099, PTZ00099, rab6; Provisional | 0.002 | |
| cd04172 | 182 | cd04172, Rnd3_RhoE_Rho8, Rnd3/RhoE/Rho8 GTPases | 0.002 | |
| cd04121 | 189 | cd04121, Rab40, Rab GTPase family 40 (Rab40) conta | 0.003 | |
| cd04114 | 169 | cd04114, Rab30, Rab GTPase family 30 (Rab30) | 0.004 |
| >gnl|CDD|206701 cd04128, Spg1, Septum-promoting GTPase (Spg1) | Back alignment and domain information |
|---|
Score = 142 bits (361), Expect = 2e-43
Identities = 51/89 (57%), Positives = 62/89 (69%), Gaps = 2/89 (2%)
Query: 101 LKISLLGDCQIGKTSF-VKYVGNE-QERSLQMAGLNLINKTLMVQGARIAFSIWDVGGDS 158
LKI LLGD QIGKTS VKYV E E +Q G+N + KT+ ++G I FSIWD+GG
Sbjct: 1 LKIGLLGDAQIGKTSLMVKYVEGEFDEEYIQTLGVNFMEKTISIRGTEITFSIWDLGGQR 60
Query: 159 RSFDHVPIACKDAVAILFMFDLTSRCTLN 187
+ +P+ CKDAVAILFMFDLT + TLN
Sbjct: 61 EFINMLPLVCKDAVAILFMFDLTRKSTLN 89
|
Spg1p. Spg1p (septum-promoting GTPase) was first identified in the fission yeast S. pombe, where it regulates septum formation in the septation initiation network (SIN) through the cdc7 protein kinase. Spg1p is an essential gene that localizes to the spindle pole bodies. When GTP-bound, it binds cdc7 and causes it to translocate to spindle poles. Sid4p (septation initiation defective) is required for localization of Spg1p to the spindle pole body, and the ability of Spg1p to promote septum formation from any point in the cell cycle depends on Sid4p. Spg1p is negatively regulated by Byr4 and cdc16, which form a two-component GTPase activating protein (GAP) for Spg1p. The existence of a SIN-related pathway in plants has been proposed. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Length = 182 |
| >gnl|CDD|219856 pfam08477, Miro, Miro-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|206640 cd00154, Rab, Ras-related in brain (Rab) family of small guanosine triphosphatases (GTPases) | Back alignment and domain information |
|---|
| >gnl|CDD|133323 cd04123, Rab21, Rab GTPase family 21 (Rab21) | Back alignment and domain information |
|---|
| >gnl|CDD|215587 PLN03118, PLN03118, Rab family protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|206695 cd04112, Rab26, Rab GTPase family 26 (Rab26) | Back alignment and domain information |
|---|
| >gnl|CDD|133267 cd01864, Rab19, Rab GTPase family 19 (Rab19) | Back alignment and domain information |
|---|
| >gnl|CDD|206697 cd04116, Rab9, Rab GTPase family 9 (Rab9) | Back alignment and domain information |
|---|
| >gnl|CDD|206653 cd01860, Rab5_related, Rab-related GTPase family includes Rab5 and Rab22; regulates early endosome fusion | Back alignment and domain information |
|---|
| >gnl|CDD|206654 cd01861, Rab6, Rab GTPase family 6 (Rab6) | Back alignment and domain information |
|---|
| >gnl|CDD|224025 COG1100, COG1100, GTPase SAR1 and related small G proteins [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|197555 smart00175, RAB, Rab subfamily of small GTPases | Back alignment and domain information |
|---|
| >gnl|CDD|133326 cd04126, Rab20, Rab GTPase family 20 (Rab20) | Back alignment and domain information |
|---|
| >gnl|CDD|215692 pfam00071, Ras, Ras family | Back alignment and domain information |
|---|
| >gnl|CDD|178657 PLN03110, PLN03110, Rab GTPase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240284 PTZ00132, PTZ00132, GTP-binding nuclear protein Ran; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|206703 cd04131, Rnd, Rho family GTPase subfamily Rnd includes Rnd1/Rho6, Rnd2/Rho7, and Rnd3/RhoE/Rho8 | Back alignment and domain information |
|---|
| >gnl|CDD|206656 cd01863, Rab18, Rab GTPase family 18 (Rab18) | Back alignment and domain information |
|---|
| >gnl|CDD|206657 cd01865, Rab3, Rab GTPase family 3 contains Rab3A, Rab3B, Rab3C and Rab3D | Back alignment and domain information |
|---|
| >gnl|CDD|206643 cd00877, Ran, Ras-related nuclear proteins (Ran)/TC4 family of small GTPases | Back alignment and domain information |
|---|
| >gnl|CDD|206700 cd04127, Rab27A, Rab GTPase family 27a (Rab27a) | Back alignment and domain information |
|---|
| >gnl|CDD|133311 cd04111, Rab39, Rab GTPase family 39 (Rab39) | Back alignment and domain information |
|---|
| >gnl|CDD|133324 cd04124, RabL2, Rab GTPase-like family 2 (Rab-like2) | Back alignment and domain information |
|---|
| >gnl|CDD|206698 cd04117, Rab15, Rab GTPase family 15 (Rab15) | Back alignment and domain information |
|---|
| >gnl|CDD|133315 cd04115, Rab33B_Rab33A, Rab GTPase family 33 includes Rab33A and Rab33B | Back alignment and domain information |
|---|
| >gnl|CDD|178620 PLN03071, PLN03071, GTP-binding nuclear protein Ran; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185444 PTZ00099, PTZ00099, rab6; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|206735 cd04172, Rnd3_RhoE_Rho8, Rnd3/RhoE/Rho8 GTPases | Back alignment and domain information |
|---|
| >gnl|CDD|133321 cd04121, Rab40, Rab GTPase family 40 (Rab40) contains Rab40a, Rab40b and Rab40c | Back alignment and domain information |
|---|
| >gnl|CDD|133314 cd04114, Rab30, Rab GTPase family 30 (Rab30) | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 193 | |||
| KOG0084 | 205 | consensus GTPase Rab1/YPT1, small G protein superf | 99.97 | |
| KOG0094 | 221 | consensus GTPase Rab6/YPT6/Ryh1, small G protein s | 99.96 | |
| KOG0092 | 200 | consensus GTPase Rab5/YPT51 and related small G pr | 99.96 | |
| KOG0080 | 209 | consensus GTPase Rab18, small G protein superfamil | 99.95 | |
| KOG0078 | 207 | consensus GTP-binding protein SEC4, small G protei | 99.95 | |
| KOG0095 | 213 | consensus GTPase Rab30, small G protein superfamil | 99.94 | |
| KOG0394 | 210 | consensus Ras-related GTPase [General function pre | 99.93 | |
| KOG0079 | 198 | consensus GTP-binding protein H-ray, small G prote | 99.93 | |
| KOG0098 | 216 | consensus GTPase Rab2, small G protein superfamily | 99.93 | |
| KOG0087 | 222 | consensus GTPase Rab11/YPT3, small G protein super | 99.93 | |
| KOG0088 | 218 | consensus GTPase Rab21, small G protein superfamil | 99.93 | |
| KOG0086 | 214 | consensus GTPase Rab4, small G protein superfamily | 99.92 | |
| cd04120 | 202 | Rab12 Rab12 subfamily. Rab12 was first identified | 99.92 | |
| KOG0093 | 193 | consensus GTPase Rab3, small G protein superfamily | 99.92 | |
| cd04172 | 182 | Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily. Rnd3/RhoE | 99.91 | |
| cd04133 | 176 | Rop_like Rop subfamily. The Rop (Rho-related prote | 99.91 | |
| cd04128 | 182 | Spg1 Spg1p. Spg1p (septum-promoting GTPase) was fi | 99.91 | |
| cd04121 | 189 | Rab40 Rab40 subfamily. This subfamily contains Rab | 99.91 | |
| KOG0091 | 213 | consensus GTPase Rab39, small G protein superfamil | 99.91 | |
| cd04131 | 178 | Rnd Rnd subfamily. The Rnd subfamily contains Rnd1 | 99.91 | |
| cd01875 | 191 | RhoG RhoG subfamily. RhoG is a GTPase with high se | 99.91 | |
| cd04102 | 202 | RabL3 RabL3 (Rab-like3) subfamily. RabL3s are nove | 99.91 | |
| KOG0083 | 192 | consensus GTPase Rab26/Rab37, small G protein supe | 99.9 | |
| cd04174 | 232 | Rnd1_Rho6 Rnd1/Rho6 subfamily. Rnd1/Rho6 is a memb | 99.9 | |
| cd01874 | 175 | Cdc42 Cdc42 subfamily. Cdc42 is an essential GTPas | 99.89 | |
| PLN03071 | 219 | GTP-binding nuclear protein Ran; Provisional | 99.89 | |
| cd04173 | 222 | Rnd2_Rho7 Rnd2/Rho7 subfamily. Rnd2/Rho7 is a memb | 99.89 | |
| cd04107 | 201 | Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38 | 99.89 | |
| cd04122 | 166 | Rab14 Rab14 subfamily. Rab14 GTPases are localized | 99.89 | |
| PLN00023 | 334 | GTP-binding protein; Provisional | 99.89 | |
| cd04108 | 170 | Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found pr | 99.89 | |
| cd04117 | 161 | Rab15 Rab15 subfamily. Rab15 colocalizes with the | 99.88 | |
| PF00071 | 162 | Ras: Ras family; InterPro: IPR001806 Small GTPases | 99.88 | |
| cd04136 | 163 | Rap_like Rap-like subfamily. The Rap subfamily con | 99.88 | |
| cd04176 | 163 | Rap2 Rap2 subgroup. The Rap2 subgroup is part of t | 99.88 | |
| cd04141 | 172 | Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like p | 99.88 | |
| cd04119 | 168 | RJL RJL (RabJ-Like) subfamily. RJLs are found in m | 99.88 | |
| cd01871 | 174 | Rac1_like Rac1-like subfamily. The Rac1-like subfa | 99.88 | |
| cd01865 | 165 | Rab3 Rab3 subfamily. The Rab3 subfamily contains R | 99.87 | |
| cd01869 | 166 | Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev | 99.87 | |
| cd01867 | 167 | Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp | 99.87 | |
| cd04109 | 215 | Rab28 Rab28 subfamily. First identified in maize, | 99.87 | |
| cd04110 | 199 | Rab35 Rab35 subfamily. Rab35 is one of several Rab | 99.87 | |
| cd04124 | 161 | RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily | 99.87 | |
| cd04127 | 180 | Rab27A Rab27a subfamily. The Rab27a subfamily cons | 99.87 | |
| PTZ00369 | 189 | Ras-like protein; Provisional | 99.87 | |
| cd04116 | 170 | Rab9 Rab9 subfamily. Rab9 is found in late endosom | 99.87 | |
| KOG0081 | 219 | consensus GTPase Rab27, small G protein superfamil | 99.87 | |
| cd04111 | 211 | Rab39 Rab39 subfamily. Found in eukaryotes, Rab39 | 99.87 | |
| cd04175 | 164 | Rap1 Rap1 subgroup. The Rap1 subgroup is part of t | 99.86 | |
| cd04125 | 188 | RabA_like RabA-like subfamily. RabA was first iden | 99.86 | |
| cd00877 | 166 | Ran Ran (Ras-related nuclear proteins) /TC4 subfam | 99.86 | |
| KOG0393 | 198 | consensus Ras-related small GTPase, Rho type [Gene | 99.86 | |
| cd04118 | 193 | Rab24 Rab24 subfamily. Rab24 is distinct from othe | 99.86 | |
| cd04143 | 247 | Rhes_like Rhes_like subfamily. This subfamily incl | 99.86 | |
| PLN03110 | 216 | Rab GTPase; Provisional | 99.86 | |
| cd04134 | 189 | Rho3 Rho3 subfamily. Rho3 is a member of the Rho f | 99.86 | |
| cd04115 | 170 | Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is u | 99.86 | |
| cd04106 | 162 | Rab23_lke Rab23-like subfamily. Rab23 is a member | 99.86 | |
| KOG1673 | 205 | consensus Ras GTPases [General function prediction | 99.86 | |
| cd01892 | 169 | Miro2 Miro2 subfamily. Miro (mitochondrial Rho) pr | 99.86 | |
| cd04138 | 162 | H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, | 99.85 | |
| smart00176 | 200 | RAN Ran (Ras-related nuclear proteins) /TC4 subfam | 99.85 | |
| cd01864 | 165 | Rab19 Rab19 subfamily. Rab19 proteins are associat | 99.85 | |
| cd04113 | 161 | Rab4 Rab4 subfamily. Rab4 has been implicated in n | 99.85 | |
| KOG0097 | 215 | consensus GTPase Rab14, small G protein superfamil | 99.85 | |
| cd01868 | 165 | Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a | 99.85 | |
| cd04103 | 158 | Centaurin_gamma Centaurin gamma. The centaurins (a | 99.85 | |
| cd04130 | 173 | Wrch_1 Wrch-1 subfamily. Wrch-1 (Wnt-1 responsive | 99.85 | |
| cd01866 | 168 | Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg | 99.85 | |
| cd04144 | 190 | Ras2 Ras2 subfamily. The Ras2 subfamily, found exc | 99.85 | |
| cd04112 | 191 | Rab26 Rab26 subfamily. First identified in rat pan | 99.85 | |
| cd04132 | 187 | Rho4_like Rho4-like subfamily. Rho4 is a GTPase th | 99.84 | |
| cd04126 | 220 | Rab20 Rab20 subfamily. Rab20 is one of several Rab | 99.84 | |
| cd04101 | 164 | RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove | 99.84 | |
| cd01861 | 161 | Rab6 Rab6 subfamily. Rab6 is involved in microtubu | 99.84 | |
| PLN03118 | 211 | Rab family protein; Provisional | 99.84 | |
| smart00173 | 164 | RAS Ras subfamily of RAS small GTPases. Similar in | 99.84 | |
| cd04140 | 165 | ARHI_like ARHI subfamily. ARHI (A Ras homolog memb | 99.83 | |
| cd01860 | 163 | Rab5_related Rab5-related subfamily. This subfamil | 99.83 | |
| KOG0395 | 196 | consensus Ras-related GTPase [General function pre | 99.83 | |
| PLN03108 | 210 | Rab family protein; Provisional | 99.83 | |
| cd01873 | 195 | RhoBTB RhoBTB subfamily. Members of the RhoBTB sub | 99.83 | |
| cd04145 | 164 | M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf | 99.83 | |
| smart00174 | 174 | RHO Rho (Ras homology) subfamily of Ras-like small | 99.83 | |
| PTZ00132 | 215 | GTP-binding nuclear protein Ran; Provisional | 99.82 | |
| cd04150 | 159 | Arf1_5_like Arf1-Arf5-like subfamily. This subfami | 99.82 | |
| smart00177 | 175 | ARF ARF-like small GTPases; ARF, ADP-ribosylation | 99.82 | |
| cd04142 | 198 | RRP22 RRP22 subfamily. RRP22 (Ras-related protein | 99.82 | |
| smart00175 | 164 | RAB Rab subfamily of small GTPases. Rab GTPases ar | 99.82 | |
| cd04177 | 168 | RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the | 99.81 | |
| cd01862 | 172 | Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th | 99.81 | |
| cd01870 | 175 | RhoA_like RhoA-like subfamily. The RhoA subfamily | 99.81 | |
| cd04152 | 183 | Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) i | 99.81 | |
| cd04149 | 168 | Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor | 99.81 | |
| PLN00223 | 181 | ADP-ribosylation factor; Provisional | 99.81 | |
| cd01863 | 161 | Rab18 Rab18 subfamily. Mammalian Rab18 is implicat | 99.81 | |
| cd04135 | 174 | Tc10 TC10 subfamily. TC10 is a Rho family protein | 99.8 | |
| cd04148 | 221 | RGK RGK subfamily. The RGK (Rem, Rem2, Rad, Gem/Ki | 99.8 | |
| cd04162 | 164 | Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9 | 99.8 | |
| PTZ00133 | 182 | ADP-ribosylation factor; Provisional | 99.8 | |
| cd04146 | 165 | RERG_RasL11_like RERG/RasL11-like subfamily. RERG | 99.8 | |
| cd04114 | 169 | Rab30 Rab30 subfamily. Rab30 appears to be associa | 99.79 | |
| cd04123 | 162 | Rab21 Rab21 subfamily. The localization and functi | 99.79 | |
| cd04158 | 169 | ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor | 99.79 | |
| cd04147 | 198 | Ras_dva Ras-dva subfamily. Ras-dva (Ras - dorsal-v | 99.78 | |
| KOG4252 | 246 | consensus GTP-binding protein [Signal transduction | 99.77 | |
| cd00154 | 159 | Rab Rab family. Rab GTPases form the largest famil | 99.77 | |
| COG1100 | 219 | GTPase SAR1 and related small G proteins [General | 99.77 | |
| cd01893 | 166 | Miro1 Miro1 subfamily. Miro (mitochondrial Rho) pr | 99.76 | |
| cd04154 | 173 | Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are | 99.76 | |
| cd04139 | 164 | RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) | 99.76 | |
| PF08477 | 119 | Miro: Miro-like protein; InterPro: IPR013684 Mitoc | 99.75 | |
| cd00157 | 171 | Rho Rho (Ras homology) family. Members of the Rho | 99.75 | |
| cd04161 | 167 | Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 ( | 99.75 | |
| cd04129 | 187 | Rho2 Rho2 subfamily. Rho2 is a fungal GTPase that | 99.74 | |
| cd00876 | 160 | Ras Ras family. The Ras family of the Ras superfam | 99.74 | |
| cd04153 | 174 | Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) a | 99.73 | |
| cd04156 | 160 | ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su | 99.73 | |
| cd04157 | 162 | Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a sub | 99.73 | |
| cd04137 | 180 | RheB Rheb (Ras Homolog Enriched in Brain) subfamil | 99.72 | |
| cd04151 | 158 | Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes t | 99.72 | |
| KOG0070 | 181 | consensus GTP-binding ADP-ribosylation factor Arf1 | 99.71 | |
| cd00878 | 158 | Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik | 99.7 | |
| smart00178 | 184 | SAR Sar1p-like members of the Ras-family of small | 99.69 | |
| cd00879 | 190 | Sar1 Sar1 subfamily. Sar1 is an essential componen | 99.68 | |
| cd04159 | 159 | Arl10_like Arl10-like subfamily. Arl9/Arl10 was id | 99.67 | |
| PF00025 | 175 | Arf: ADP-ribosylation factor family The prints ent | 99.66 | |
| KOG0096 | 216 | consensus GTPase Ran/TC4/GSP1 (nuclear protein tra | 99.66 | |
| cd04160 | 167 | Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote | 99.66 | |
| KOG0073 | 185 | consensus GTP-binding ADP-ribosylation factor-like | 99.62 | |
| cd04155 | 173 | Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f | 99.61 | |
| cd01890 | 179 | LepA LepA subfamily. LepA belongs to the GTPase fa | 99.6 | |
| KOG0071 | 180 | consensus GTP-binding ADP-ribosylation factor Arf6 | 99.6 | |
| TIGR00231 | 161 | small_GTP small GTP-binding protein domain. This m | 99.59 | |
| KOG4423 | 229 | consensus GTP-binding protein-like, RAS superfamil | 99.58 | |
| cd04105 | 203 | SR_beta Signal recognition particle receptor, beta | 99.55 | |
| PTZ00099 | 176 | rab6; Provisional | 99.55 | |
| cd04171 | 164 | SelB SelB subfamily. SelB is an elongation factor | 99.51 | |
| cd01891 | 194 | TypA_BipA TypA (tyrosine phosphorylated protein A) | 99.51 | |
| KOG0074 | 185 | consensus GTP-binding ADP-ribosylation factor-like | 99.49 | |
| TIGR02528 | 142 | EutP ethanolamine utilization protein, EutP. This | 99.48 | |
| cd01887 | 168 | IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryo | 99.44 | |
| KOG3883 | 198 | consensus Ras family small GTPase [Signal transduc | 99.42 | |
| cd00882 | 157 | Ras_like_GTPase Ras-like GTPase superfamily. The R | 99.42 | |
| TIGR00450 | 442 | mnmE_trmE_thdF tRNA modification GTPase TrmE. TrmE | 99.4 | |
| KOG0075 | 186 | consensus GTP-binding ADP-ribosylation factor-like | 99.4 | |
| cd01898 | 170 | Obg Obg subfamily. The Obg nucleotide binding prot | 99.4 | |
| cd01897 | 168 | NOG NOG1 is a nucleolar GTP-binding protein presen | 99.37 | |
| cd01879 | 158 | FeoB Ferrous iron transport protein B (FeoB) subfa | 99.37 | |
| cd04164 | 157 | trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein | 99.35 | |
| cd01878 | 204 | HflX HflX subfamily. A distinct conserved domain w | 99.34 | |
| PRK05291 | 449 | trmE tRNA modification GTPase TrmE; Reviewed | 99.3 | |
| PRK04213 | 201 | GTP-binding protein; Provisional | 99.3 | |
| TIGR01393 | 595 | lepA GTP-binding protein LepA. LepA (GUF1 in Sacca | 99.29 | |
| PRK03003 | 472 | GTP-binding protein Der; Reviewed | 99.28 | |
| TIGR03156 | 351 | GTP_HflX GTP-binding protein HflX. This protein fa | 99.27 | |
| PRK03003 | 472 | GTP-binding protein Der; Reviewed | 99.27 | |
| PRK15494 | 339 | era GTPase Era; Provisional | 99.25 | |
| cd04167 | 213 | Snu114p Snu114p subfamily. Snu114p is one of sever | 99.22 | |
| PRK00093 | 435 | GTP-binding protein Der; Reviewed | 99.22 | |
| cd01895 | 174 | EngA2 EngA2 subfamily. This CD represents the seco | 99.2 | |
| cd01894 | 157 | EngA1 EngA1 subfamily. This CD represents the firs | 99.19 | |
| TIGR03598 | 179 | GTPase_YsxC ribosome biogenesis GTP-binding protei | 99.18 | |
| cd01881 | 176 | Obg_like The Obg-like subfamily consists of five w | 99.18 | |
| KOG0076 | 197 | consensus GTP-binding ADP-ribosylation factor-like | 99.17 | |
| cd01889 | 192 | SelB_euk SelB subfamily. SelB is an elongation fac | 99.16 | |
| TIGR00487 | 587 | IF-2 translation initiation factor IF-2. This mode | 99.15 | |
| KOG0072 | 182 | consensus GTP-binding ADP-ribosylation factor-like | 99.15 | |
| cd00881 | 189 | GTP_translation_factor GTP translation factor fami | 99.14 | |
| TIGR03594 | 429 | GTPase_EngA ribosome-associated GTPase EngA. EngA | 99.13 | |
| PRK00454 | 196 | engB GTP-binding protein YsxC; Reviewed | 99.13 | |
| PRK11058 | 426 | GTPase HflX; Provisional | 99.13 | |
| cd01896 | 233 | DRG The developmentally regulated GTP-binding prot | 99.12 | |
| KOG1707 | 625 | consensus Predicted Ras related/Rac-GTP binding pr | 99.09 | |
| PRK05306 | 787 | infB translation initiation factor IF-2; Validated | 99.07 | |
| smart00010 | 124 | small_GTPase Small GTPase of the Ras superfamily; | 99.07 | |
| cd04163 | 168 | Era Era subfamily. Era (E. coli Ras-like protein) | 99.07 | |
| TIGR00475 | 581 | selB selenocysteine-specific elongation factor Sel | 99.06 | |
| TIGR03594 | 429 | GTPase_EngA ribosome-associated GTPase EngA. EngA | 99.06 | |
| CHL00189 | 742 | infB translation initiation factor 2; Provisional | 99.05 | |
| PRK05433 | 600 | GTP-binding protein LepA; Provisional | 99.04 | |
| cd01850 | 276 | CDC_Septin CDC/Septin. Septins are a conserved fam | 99.04 | |
| cd04168 | 237 | TetM_like Tet(M)-like subfamily. Tet(M), Tet(O), T | 99.04 | |
| PRK09518 | 712 | bifunctional cytidylate kinase/GTPase Der; Reviewe | 99.03 | |
| TIGR00491 | 590 | aIF-2 translation initiation factor aIF-2/yIF-2. T | 99.03 | |
| PRK10218 | 607 | GTP-binding protein; Provisional | 99.03 | |
| cd01876 | 170 | YihA_EngB The YihA (EngB) subfamily. This subfamil | 99.02 | |
| TIGR00436 | 270 | era GTP-binding protein Era. Era is an essential G | 98.99 | |
| PRK15467 | 158 | ethanolamine utilization protein EutP; Provisional | 98.99 | |
| PRK12299 | 335 | obgE GTPase CgtA; Reviewed | 98.99 | |
| TIGR02729 | 329 | Obg_CgtA Obg family GTPase CgtA. This model descri | 98.99 | |
| KOG0077 | 193 | consensus Vesicle coat complex COPII, GTPase subun | 98.95 | |
| PRK09518 | 712 | bifunctional cytidylate kinase/GTPase Der; Reviewe | 98.94 | |
| PF04670 | 232 | Gtr1_RagA: Gtr1/RagA G protein conserved region; I | 98.93 | |
| cd00880 | 163 | Era_like Era (E. coli Ras-like protein)-like. This | 98.92 | |
| PRK04004 | 586 | translation initiation factor IF-2; Validated | 98.92 | |
| TIGR00483 | 426 | EF-1_alpha translation elongation factor EF-1 alph | 98.9 | |
| cd01899 | 318 | Ygr210 Ygr210 subfamily. Ygr210 is a member of Obg | 98.89 | |
| PRK00093 | 435 | GTP-binding protein Der; Reviewed | 98.89 | |
| cd04169 | 267 | RF3 RF3 subfamily. Peptide chain release factor 3 | 98.88 | |
| PF01926 | 116 | MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I | 98.87 | |
| cd01885 | 222 | EF2 EF2 (for archaea and eukarya). Translocation r | 98.84 | |
| PRK13351 | 687 | elongation factor G; Reviewed | 98.81 | |
| PRK00089 | 292 | era GTPase Era; Reviewed | 98.8 | |
| PRK12297 | 424 | obgE GTPase CgtA; Reviewed | 98.79 | |
| TIGR00437 | 591 | feoB ferrous iron transporter FeoB. FeoB (773 amin | 98.76 | |
| cd04104 | 197 | p47_IIGP_like p47 (47-kDa) family. The p47 GTPase | 98.76 | |
| cd04170 | 268 | EF-G_bact Elongation factor G (EF-G) subfamily. Tr | 98.74 | |
| COG2229 | 187 | Predicted GTPase [General function prediction only | 98.74 | |
| cd04166 | 208 | CysN_ATPS CysN_ATPS subfamily. CysN, together with | 98.73 | |
| TIGR01394 | 594 | TypA_BipA GTP-binding protein TypA/BipA. This bact | 98.73 | |
| cd01888 | 203 | eIF2_gamma eIF2-gamma (gamma subunit of initiation | 98.71 | |
| PRK09554 | 772 | feoB ferrous iron transport protein B; Reviewed | 98.7 | |
| PRK00741 | 526 | prfC peptide chain release factor 3; Provisional | 98.69 | |
| PRK12317 | 425 | elongation factor 1-alpha; Reviewed | 98.69 | |
| TIGR00490 | 720 | aEF-2 translation elongation factor aEF-2. This mo | 98.69 | |
| PRK09602 | 396 | translation-associated GTPase; Reviewed | 98.66 | |
| PRK12296 | 500 | obgE GTPase CgtA; Reviewed | 98.65 | |
| TIGR00503 | 527 | prfC peptide chain release factor 3. This translat | 98.63 | |
| PF09439 | 181 | SRPRB: Signal recognition particle receptor beta s | 98.58 | |
| COG0486 | 454 | ThdF Predicted GTPase [General function prediction | 98.58 | |
| TIGR00991 | 313 | 3a0901s02IAP34 GTP-binding protein (Chloroplast En | 98.54 | |
| PF02421 | 156 | FeoB_N: Ferrous iron transport protein B; InterPro | 98.52 | |
| PRK10512 | 614 | selenocysteinyl-tRNA-specific translation factor; | 98.5 | |
| TIGR00485 | 394 | EF-Tu translation elongation factor TU. This align | 98.49 | |
| cd01883 | 219 | EF1_alpha Eukaryotic elongation factor 1 (EF1) alp | 98.47 | |
| TIGR03680 | 406 | eif2g_arch translation initiation factor 2 subunit | 98.47 | |
| PF10662 | 143 | PduV-EutP: Ethanolamine utilisation - propanediol | 98.44 | |
| KOG0705 | 749 | consensus GTPase-activating protein Centaurin gamm | 98.44 | |
| PRK04000 | 411 | translation initiation factor IF-2 subunit gamma; | 98.41 | |
| cd01857 | 141 | HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t | 98.41 | |
| PRK12298 | 390 | obgE GTPase CgtA; Reviewed | 98.39 | |
| cd01886 | 270 | EF-G Elongation factor G (EF-G) subfamily. Translo | 98.38 | |
| PF00009 | 188 | GTP_EFTU: Elongation factor Tu GTP binding domain; | 98.37 | |
| TIGR00484 | 689 | EF-G translation elongation factor EF-G. After pep | 98.35 | |
| cd01884 | 195 | EF_Tu EF-Tu subfamily. This subfamily includes ort | 98.3 | |
| cd01853 | 249 | Toc34_like Toc34-like (Translocon at the Outer-env | 98.27 | |
| cd01859 | 156 | MJ1464 MJ1464. This family represents archaeal GTP | 98.26 | |
| cd01852 | 196 | AIG1 AIG1 (avrRpt2-induced gene 1). This represent | 98.24 | |
| PRK12735 | 396 | elongation factor Tu; Reviewed | 98.24 | |
| PRK12736 | 394 | elongation factor Tu; Reviewed | 98.24 | |
| COG1160 | 444 | Predicted GTPases [General function prediction onl | 98.23 | |
| COG1163 | 365 | DRG Predicted GTPase [General function prediction | 98.22 | |
| PLN03126 | 478 | Elongation factor Tu; Provisional | 98.2 | |
| cd04165 | 224 | GTPBP1_like GTPBP1-like. Mammalian GTP binding pro | 98.19 | |
| cd00066 | 317 | G-alpha G protein alpha subunit. The alpha subunit | 98.18 | |
| cd01856 | 171 | YlqF YlqF. Proteins of the YlqF family contain all | 98.18 | |
| PLN00043 | 447 | elongation factor 1-alpha; Provisional | 98.18 | |
| KOG1191 | 531 | consensus Mitochondrial GTPase [Translation, ribos | 98.17 | |
| TIGR02034 | 406 | CysN sulfate adenylyltransferase, large subunit. H | 98.11 | |
| KOG3886 | 295 | consensus GTP-binding protein [Signal transduction | 98.1 | |
| PRK12740 | 668 | elongation factor G; Reviewed | 98.1 | |
| PRK05124 | 474 | cysN sulfate adenylyltransferase subunit 1; Provis | 98.09 | |
| PF00735 | 281 | Septin: Septin; InterPro: IPR000038 Septins consti | 98.08 | |
| KOG1423 | 379 | consensus Ras-like GTPase ERA [Cell cycle control, | 98.08 | |
| COG1160 | 444 | Predicted GTPases [General function prediction onl | 98.07 | |
| PF05783 | 472 | DLIC: Dynein light intermediate chain (DLIC); Inte | 98.06 | |
| COG3596 | 296 | Predicted GTPase [General function prediction only | 98.05 | |
| CHL00071 | 409 | tufA elongation factor Tu | 98.04 | |
| PF04548 | 212 | AIG1: AIG1 family; InterPro: IPR006703 This entry | 98.01 | |
| KOG0090 | 238 | consensus Signal recognition particle receptor, be | 97.98 | |
| KOG3905 | 473 | consensus Dynein light intermediate chain [Cell mo | 97.98 | |
| PTZ00258 | 390 | GTP-binding protein; Provisional | 97.97 | |
| KOG1707 | 625 | consensus Predicted Ras related/Rac-GTP binding pr | 97.96 | |
| PTZ00141 | 446 | elongation factor 1- alpha; Provisional | 97.95 | |
| cd01900 | 274 | YchF YchF subfamily. YchF is a member of the Obg f | 97.92 | |
| PRK00049 | 396 | elongation factor Tu; Reviewed | 97.91 | |
| PRK09601 | 364 | GTP-binding protein YchF; Reviewed | 97.9 | |
| PRK05506 | 632 | bifunctional sulfate adenylyltransferase subunit 1 | 97.89 | |
| PRK12739 | 691 | elongation factor G; Reviewed | 97.88 | |
| COG1159 | 298 | Era GTPase [General function prediction only] | 97.86 | |
| cd01858 | 157 | NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei | 97.83 | |
| KOG4273 | 418 | consensus Uncharacterized conserved protein [Funct | 97.81 | |
| PLN03127 | 447 | Elongation factor Tu; Provisional | 97.8 | |
| COG1084 | 346 | Predicted GTPase [General function prediction only | 97.79 | |
| TIGR03596 | 276 | GTPase_YlqF ribosome biogenesis GTP-binding protei | 97.77 | |
| PRK09563 | 287 | rbgA GTPase YlqF; Reviewed | 97.72 | |
| cd04178 | 172 | Nucleostemin_like Nucleostemin-like. Nucleostemin | 97.71 | |
| TIGR00993 | 763 | 3a0901s04IAP86 chloroplast protein import componen | 97.65 | |
| PRK00007 | 693 | elongation factor G; Reviewed | 97.62 | |
| PTZ00416 | 836 | elongation factor 2; Provisional | 97.55 | |
| PLN00116 | 843 | translation elongation factor EF-2 subunit; Provis | 97.51 | |
| PRK07560 | 731 | elongation factor EF-2; Reviewed | 97.5 | |
| PRK14845 | 1049 | translation initiation factor IF-2; Provisional | 97.46 | |
| COG0370 | 653 | FeoB Fe2+ transport system protein B [Inorganic io | 97.43 | |
| cd01855 | 190 | YqeH YqeH. YqeH is an essential GTP-binding protei | 97.4 | |
| KOG1547 | 336 | consensus Septin CDC10 and related P-loop GTPases | 97.38 | |
| PF05049 | 376 | IIGP: Interferon-inducible GTPase (IIGP); InterPro | 97.32 | |
| COG1161 | 322 | Predicted GTPases [General function prediction onl | 97.28 | |
| PF00350 | 168 | Dynamin_N: Dynamin family; InterPro: IPR001401 Mem | 97.25 | |
| KOG1486 | 364 | consensus GTP-binding protein DRG2 (ODN superfamil | 97.25 | |
| COG5019 | 373 | CDC3 Septin family protein [Cell division and chro | 97.22 | |
| COG4917 | 148 | EutP Ethanolamine utilization protein [Amino acid | 97.2 | |
| cd01882 | 225 | BMS1 Bms1. Bms1 is an essential, evolutionarily co | 97.17 | |
| COG5256 | 428 | TEF1 Translation elongation factor EF-1alpha (GTPa | 97.16 | |
| KOG2655 | 366 | consensus Septin family protein (P-loop GTPase) [C | 97.12 | |
| cd01851 | 224 | GBP Guanylate-binding protein (GBP), N-terminal do | 97.12 | |
| smart00275 | 342 | G_alpha G protein alpha subunit. Subunit of G prot | 97.04 | |
| cd01849 | 155 | YlqF_related_GTPase YlqF-related GTPases. These pr | 97.04 | |
| COG0218 | 200 | Predicted GTPase [General function prediction only | 97.01 | |
| TIGR00092 | 368 | GTP-binding protein YchF. This predicted GTP-bindi | 96.98 | |
| PRK12289 | 352 | GTPase RsgA; Reviewed | 96.97 | |
| PRK13768 | 253 | GTPase; Provisional | 96.88 | |
| TIGR00157 | 245 | ribosome small subunit-dependent GTPase A. The Aqu | 96.88 | |
| KOG3859 | 406 | consensus Septins (P-loop GTPases) [Cell cycle con | 96.87 | |
| PF03193 | 161 | DUF258: Protein of unknown function, DUF258; Inter | 96.84 | |
| PRK12288 | 347 | GTPase RsgA; Reviewed | 96.79 | |
| KOG0082 | 354 | consensus G-protein alpha subunit (small G protein | 96.79 | |
| PF03266 | 168 | NTPase_1: NTPase; InterPro: IPR004948 This entry r | 96.72 | |
| COG0532 | 509 | InfB Translation initiation factor 2 (IF-2; GTPase | 96.71 | |
| cd01854 | 287 | YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtil | 96.68 | |
| KOG0468 | 971 | consensus U5 snRNP-specific protein [Translation, | 96.62 | |
| PF03029 | 238 | ATP_bind_1: Conserved hypothetical ATP binding pro | 96.62 | |
| COG1618 | 179 | Predicted nucleotide kinase [Nucleotide transport | 96.51 | |
| TIGR03597 | 360 | GTPase_YqeH ribosome biogenesis GTPase YqeH. This | 96.37 | |
| PRK00098 | 298 | GTPase RsgA; Reviewed | 96.33 | |
| PRK13796 | 365 | GTPase YqeH; Provisional | 96.25 | |
| COG2262 | 411 | HflX GTPases [General function prediction only] | 96.22 | |
| COG0012 | 372 | Predicted GTPase, probable translation factor [Tra | 96.15 | |
| KOG1489 | 366 | consensus Predicted GTP-binding protein (ODN super | 96.06 | |
| COG4108 | 528 | PrfC Peptide chain release factor RF-3 [Translatio | 95.98 | |
| PF13207 | 121 | AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 | 95.79 | |
| PRK08118 | 167 | topology modulation protein; Reviewed | 95.71 | |
| COG1116 | 248 | TauB ABC-type nitrate/sulfonate/bicarbonate transp | 95.64 | |
| KOG1491 | 391 | consensus Predicted GTP-binding protein (ODN super | 95.64 | |
| COG1125 | 309 | OpuBA ABC-type proline/glycine betaine transport s | 95.63 | |
| PRK07261 | 171 | topology modulation protein; Provisional | 95.63 | |
| PF13671 | 143 | AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 | 95.58 | |
| COG1162 | 301 | Predicted GTPases [General function prediction onl | 95.55 | |
| COG0480 | 697 | FusA Translation elongation factors (GTPases) [Tra | 95.51 | |
| smart00382 | 148 | AAA ATPases associated with a variety of cellular | 95.46 | |
| COG0563 | 178 | Adk Adenylate kinase and related kinases [Nucleoti | 95.4 | |
| COG3839 | 338 | MalK ABC-type sugar transport systems, ATPase comp | 95.4 | |
| PF13521 | 163 | AAA_28: AAA domain; PDB: 1LW7_A. | 95.38 | |
| KOG0462 | 650 | consensus Elongation factor-type GTP-binding prote | 95.32 | |
| smart00072 | 184 | GuKc Guanylate kinase homologues. Active enzymes c | 95.31 | |
| PF00004 | 132 | AAA: ATPase family associated with various cellula | 95.3 | |
| KOG1424 | 562 | consensus Predicted GTP-binding protein MMR1 [Gene | 95.28 | |
| PF05729 | 166 | NACHT: NACHT domain | 95.27 | |
| PF07728 | 139 | AAA_5: AAA domain (dynein-related subfamily); Inte | 95.26 | |
| PF13191 | 185 | AAA_16: AAA ATPase domain; PDB: 2V1U_A. | 95.21 | |
| KOG0458 | 603 | consensus Elongation factor 1 alpha [Translation, | 95.18 | |
| cd02042 | 104 | ParA ParA and ParB of Caulobacter crescentus belon | 95.14 | |
| COG3842 | 352 | PotA ABC-type spermidine/putrescine transport syst | 95.13 | |
| PF13401 | 131 | AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S | 95.09 | |
| KOG1145 | 683 | consensus Mitochondrial translation initiation fac | 95.07 | |
| COG3638 | 258 | ABC-type phosphate/phosphonate transport system, A | 95.05 | |
| PRK06217 | 183 | hypothetical protein; Validated | 95.02 | |
| cd00009 | 151 | AAA The AAA+ (ATPases Associated with a wide varie | 94.8 | |
| cd03233 | 202 | ABC_PDR_domain1 The pleiotropic drug resistance (P | 94.77 | |
| PRK13695 | 174 | putative NTPase; Provisional | 94.75 | |
| COG1126 | 240 | GlnQ ABC-type polar amino acid transport system, A | 94.75 | |
| PRK14269 | 246 | phosphate ABC transporter ATP-binding protein; Pro | 94.74 | |
| PRK14738 | 206 | gmk guanylate kinase; Provisional | 94.73 | |
| PF13479 | 213 | AAA_24: AAA domain | 94.66 | |
| PF00005 | 137 | ABC_tran: ABC transporter This structure is on hol | 94.64 | |
| PTZ00327 | 460 | eukaryotic translation initiation factor 2 gamma s | 94.61 | |
| cd03234 | 226 | ABCG_White The White subfamily represents ABC tran | 94.58 | |
| PRK10418 | 254 | nikD nickel transporter ATP-binding protein NikD; | 94.57 | |
| PRK10078 | 186 | ribose 1,5-bisphosphokinase; Provisional | 94.55 | |
| TIGR03263 | 180 | guanyl_kin guanylate kinase. Members of this famil | 94.5 | |
| COG4525 | 259 | TauB ABC-type taurine transport system, ATPase com | 94.47 | |
| COG1217 | 603 | TypA Predicted membrane GTPase involved in stress | 94.46 | |
| cd00071 | 137 | GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. | 94.43 | |
| TIGR01425 | 429 | SRP54_euk signal recognition particle protein SRP5 | 94.43 | |
| cd01983 | 99 | Fer4_NifH The Fer4_NifH superfamily contains a var | 94.41 | |
| PF13238 | 129 | AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB | 94.39 | |
| TIGR00101 | 199 | ureG urease accessory protein UreG. This model rep | 94.39 | |
| PF00448 | 196 | SRP54: SRP54-type protein, GTPase domain; InterPro | 94.39 | |
| PF13555 | 62 | AAA_29: P-loop containing region of AAA domain | 94.35 | |
| PRK14737 | 186 | gmk guanylate kinase; Provisional | 94.32 | |
| TIGR02322 | 179 | phosphon_PhnN phosphonate metabolism protein/1,5-b | 94.26 | |
| KOG1532 | 366 | consensus GTPase XAB1, interacts with DNA repair p | 94.16 | |
| PRK03839 | 180 | putative kinase; Provisional | 94.16 | |
| PF04665 | 241 | Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 | 94.16 | |
| cd02019 | 69 | NK Nucleoside/nucleotide kinase (NK) is a protein | 94.15 | |
| TIGR00960 | 216 | 3a0501s02 Type II (General) Secretory Pathway (IIS | 94.13 | |
| PRK09984 | 262 | phosphonate/organophosphate ester transporter subu | 94.06 | |
| PRK00300 | 205 | gmk guanylate kinase; Provisional | 94.05 | |
| PRK14532 | 188 | adenylate kinase; Provisional | 94.02 | |
| TIGR03348 | 1169 | VI_IcmF type VI secretion protein IcmF. Members of | 94.02 | |
| KOG1954 | 532 | consensus Endocytosis/signaling protein EHD1 [Sign | 94.0 | |
| PF03205 | 140 | MobB: Molybdopterin guanine dinucleotide synthesis | 94.0 | |
| cd03213 | 194 | ABCG_EPDR ABCG transporters are involved in eye pi | 93.99 | |
| TIGR03797 | 686 | NHPM_micro_ABC2 NHPM bacteriocin system ABC transp | 93.99 | |
| cd00820 | 107 | PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC | 93.99 | |
| COG1136 | 226 | SalX ABC-type antimicrobial peptide transport syst | 93.93 | |
| PF01637 | 234 | Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 | 93.89 | |
| cd03292 | 214 | ABC_FtsE_transporter FtsE is a hydrophilic nucleot | 93.89 | |
| PRK08233 | 182 | hypothetical protein; Provisional | 93.87 | |
| cd03257 | 228 | ABC_NikE_OppD_transporters The ABC transporter sub | 93.84 | |
| PRK14530 | 215 | adenylate kinase; Provisional | 93.83 | |
| TIGR01166 | 190 | cbiO cobalt transport protein ATP-binding subunit. | 93.83 | |
| TIGR00150 | 133 | HI0065_YjeE ATPase, YjeE family. Members of this f | 93.82 | |
| TIGR01360 | 188 | aden_kin_iso1 adenylate kinase, isozyme 1 subfamil | 93.82 | |
| PRK14238 | 271 | phosphate transporter ATP-binding protein; Provisi | 93.8 | |
| cd03265 | 220 | ABC_DrrA DrrA is the ATP-binding protein component | 93.77 | |
| PRK02496 | 184 | adk adenylate kinase; Provisional | 93.76 | |
| PF13173 | 128 | AAA_14: AAA domain | 93.75 | |
| TIGR02868 | 529 | CydC thiol reductant ABC exporter, CydC subunit. T | 93.73 | |
| cd03266 | 218 | ABC_NatA_sodium_exporter NatA is the ATPase compon | 93.68 | |
| cd03235 | 213 | ABC_Metallic_Cations ABC component of the metal-ty | 93.66 | |
| cd03214 | 180 | ABC_Iron-Siderophores_B12_Hemin ABC transporters, | 93.64 | |
| PRK14531 | 183 | adenylate kinase; Provisional | 93.61 | |
| TIGR03015 | 269 | pepcterm_ATPase putative secretion ATPase, PEP-CTE | 93.54 | |
| PRK13949 | 169 | shikimate kinase; Provisional | 93.53 | |
| PRK13540 | 200 | cytochrome c biogenesis protein CcmA; Provisional | 93.53 | |
| TIGR03410 | 230 | urea_trans_UrtE urea ABC transporter, ATP-binding | 93.52 | |
| cd03216 | 163 | ABC_Carb_Monos_I This family represents the domain | 93.52 | |
| PRK15093 | 330 | antimicrobial peptide ABC transporter ATP-binding | 93.51 | |
| COG0194 | 191 | Gmk Guanylate kinase [Nucleotide transport and met | 93.51 | |
| cd01124 | 187 | KaiC KaiC is a circadian clock protein primarily f | 93.48 | |
| cd01120 | 165 | RecA-like_NTPases RecA-like NTPases. This family i | 93.48 | |
| PRK10895 | 241 | lipopolysaccharide ABC transporter ATP-binding pro | 93.47 | |
| cd03238 | 176 | ABC_UvrA The excision repair protein UvrA; Nucleot | 93.47 | |
| KOG1487 | 358 | consensus GTP-binding protein DRG1 (ODN superfamil | 93.45 | |
| TIGR01978 | 243 | sufC FeS assembly ATPase SufC. SufC is part of the | 93.42 | |
| cd01428 | 194 | ADK Adenylate kinase (ADK) catalyzes the reversibl | 93.42 | |
| COG0481 | 603 | LepA Membrane GTPase LepA [Cell envelope biogenesi | 93.41 | |
| PHA00729 | 226 | NTP-binding motif containing protein | 93.37 | |
| TIGR02323 | 253 | CP_lyasePhnK phosphonate C-P lyase system protein | 93.37 | |
| smart00053 | 240 | DYNc Dynamin, GTPase. Large GTPases that mediate v | 93.33 | |
| cd03263 | 220 | ABC_subfamily_A The ABCA subfamily mediates the tr | 93.31 | |
| PTZ00088 | 229 | adenylate kinase 1; Provisional | 93.27 | |
| cd03255 | 218 | ABC_MJ0796_Lo1CDE_FtsE This family is comprised of | 93.26 | |
| cd03231 | 201 | ABC_CcmA_heme_exporter CcmA, the ATP-binding compo | 93.24 | |
| cd01128 | 249 | rho_factor Transcription termination factor rho is | 93.23 | |
| cd01129 | 264 | PulE-GspE PulE/GspE The type II secretory pathway | 93.23 | |
| cd02023 | 198 | UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. | 93.23 | |
| cd01131 | 198 | PilT Pilus retraction ATPase PilT. PilT is a nucle | 93.19 | |
| PF00625 | 183 | Guanylate_kin: Guanylate kinase; InterPro: IPR0081 | 93.18 | |
| cd03215 | 182 | ABC_Carb_Monos_II This family represents domain II | 93.18 | |
| TIGR01313 | 163 | therm_gnt_kin carbohydrate kinase, thermoresistant | 93.18 | |
| TIGR03864 | 236 | PQQ_ABC_ATP ABC transporter, ATP-binding subunit, | 93.16 | |
| KOG3887 | 347 | consensus Predicted small GTPase involved in nucle | 93.15 | |
| cd03230 | 173 | ABC_DR_subfamily_A This family of ATP-binding prot | 93.11 | |
| cd03223 | 166 | ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass | 93.11 | |
| COG5192 | 1077 | BMS1 GTP-binding protein required for 40S ribosome | 93.11 | |
| TIGR00073 | 207 | hypB hydrogenase accessory protein HypB. HypB is i | 93.11 | |
| cd03237 | 246 | ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o | 93.11 | |
| PRK13638 | 271 | cbiO cobalt transporter ATP-binding subunit; Provi | 93.09 | |
| PF05496 | 233 | RuvB_N: Holliday junction DNA helicase ruvB N-term | 93.08 | |
| PRK10751 | 173 | molybdopterin-guanine dinucleotide biosynthesis pr | 93.08 | |
| CHL00131 | 252 | ycf16 sulfate ABC transporter protein; Validated | 93.03 | |
| PF00910 | 107 | RNA_helicase: RNA helicase; InterPro: IPR000605 He | 93.02 | |
| TIGR01351 | 210 | adk adenylate kinases. Adenylate kinase (EC 2.7.4. | 92.99 | |
| cd03232 | 192 | ABC_PDR_domain2 The pleiotropic drug resistance-li | 92.99 | |
| PRK10247 | 225 | putative ABC transporter ATP-binding protein YbbL; | 92.98 | |
| KOG1144 | 1064 | consensus Translation initiation factor 5B (eIF-5B | 92.96 | |
| cd03221 | 144 | ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is | 92.94 | |
| TIGR02770 | 230 | nickel_nikD nickel import ATP-binding protein NikD | 92.93 | |
| PRK11701 | 258 | phnK phosphonate C-P lyase system protein PhnK; Pr | 92.93 | |
| TIGR00235 | 207 | udk uridine kinase. Model contains a number of lon | 92.92 | |
| PRK13649 | 280 | cbiO cobalt transporter ATP-binding subunit; Provi | 92.92 | |
| PRK13543 | 214 | cytochrome c biogenesis protein CcmA; Provisional | 92.9 | |
| PRK05480 | 209 | uridine/cytidine kinase; Provisional | 92.89 | |
| TIGR03005 | 252 | ectoine_ehuA ectoine/hydroxyectoine ABC transporte | 92.89 | |
| PRK09580 | 248 | sufC cysteine desulfurase ATPase component; Review | 92.86 | |
| PRK14247 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 92.85 | |
| TIGR02315 | 243 | ABC_phnC phosphonate ABC transporter, ATP-binding | 92.85 | |
| PRK05057 | 172 | aroK shikimate kinase I; Reviewed | 92.84 | |
| TIGR03608 | 206 | L_ocin_972_ABC putative bacteriocin export ABC tra | 92.82 | |
| cd03226 | 205 | ABC_cobalt_CbiO_domain2 Domain II of the ABC compo | 92.81 | |
| TIGR01359 | 183 | UMP_CMP_kin_fam UMP-CMP kinase family. This subfam | 92.81 | |
| COG1118 | 345 | CysA ABC-type sulfate/molybdate transport systems, | 92.8 | |
| PRK00625 | 173 | shikimate kinase; Provisional | 92.78 | |
| cd03228 | 171 | ABCC_MRP_Like The MRP (Mutidrug Resistance Protein | 92.77 | |
| PRK15056 | 272 | manganese/iron transporter ATP-binding protein; Pr | 92.73 | |
| TIGR03411 | 242 | urea_trans_UrtD urea ABC transporter, ATP-binding | 92.73 | |
| PRK10575 | 265 | iron-hydroxamate transporter ATP-binding subunit; | 92.71 | |
| cd03225 | 211 | ABC_cobalt_CbiO_domain1 Domain I of the ABC compon | 92.7 | |
| PRK00279 | 215 | adk adenylate kinase; Reviewed | 92.68 | |
| PRK10771 | 232 | thiQ thiamine transporter ATP-binding subunit; Pro | 92.68 | |
| PRK11300 | 255 | livG leucine/isoleucine/valine transporter ATP-bin | 92.68 | |
| cd03269 | 210 | ABC_putative_ATPase This subfamily is involved in | 92.68 | |
| PF00503 | 389 | G-alpha: G-protein alpha subunit; InterPro: IPR001 | 92.67 | |
| TIGR02769 | 265 | nickel_nikE nickel import ATP-binding protein NikE | 92.66 | |
| COG4615 | 546 | PvdE ABC-type siderophore export system, fused ATP | 92.65 | |
| PRK14241 | 258 | phosphate transporter ATP-binding protein; Provisi | 92.62 | |
| TIGR03771 | 223 | anch_rpt_ABC anchored repeat-type ABC transporter, | 92.61 | |
| cd01918 | 149 | HprK_C HprK/P, the bifunctional histidine-containi | 92.61 | |
| cd03262 | 213 | ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- | 92.61 | |
| cd01672 | 200 | TMPK Thymidine monophosphate kinase (TMPK), also k | 92.59 | |
| cd03224 | 222 | ABC_TM1139_LivF_branched LivF (TM1139) is part of | 92.57 | |
| COG1120 | 258 | FepC ABC-type cobalamin/Fe3+-siderophores transpor | 92.55 | |
| COG2274 | 709 | SunT ABC-type bacteriocin/lantibiotic exporters, c | 92.53 | |
| cd03264 | 211 | ABC_drug_resistance_like ABC-type multidrug transp | 92.52 | |
| cd03218 | 232 | ABC_YhbG The ABC transporters belonging to the Yhb | 92.51 | |
| PF12775 | 272 | AAA_7: P-loop containing dynein motor region D3; P | 92.51 | |
| TIGR00176 | 155 | mobB molybdopterin-guanine dinucleotide biosynthes | 92.47 | |
| cd02021 | 150 | GntK Gluconate kinase (GntK) catalyzes the phospho | 92.47 | |
| PRK14262 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 92.46 | |
| TIGR02673 | 214 | FtsE cell division ATP-binding protein FtsE. This | 92.46 | |
| PRK14240 | 250 | phosphate transporter ATP-binding protein; Provisi | 92.46 | |
| PRK11831 | 269 | putative ABC transporter ATP-binding protein YrbF; | 92.45 | |
| cd03260 | 227 | ABC_PstB_phosphate_transporter Phosphate uptake is | 92.45 | |
| cd03222 | 177 | ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi | 92.43 | |
| PRK08099 | 399 | bifunctional DNA-binding transcriptional repressor | 92.42 | |
| PRK11650 | 356 | ugpC glycerol-3-phosphate transporter ATP-binding | 92.42 |
| >KOG0084 consensus GTPase Rab1/YPT1, small G protein superfamily, and related GTP-binding proteins [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
Probab=99.97 E-value=2e-31 Score=213.29 Aligned_cols=96 Identities=24% Similarity=0.448 Sum_probs=93.6
Q ss_pred ceeeEEEEECCCCCChhhHH-hhhcCccc-cccccceeeeEEEEEEECCeEEEEEEEeCCCCCCCCcchhhhccCCcEEE
Q 029430 98 LVSLKISLLGDCQIGKTSFV-KYVGNEQE-RSLQMAGLNLINKTLMVQGARIAFSIWDVGGDSRSFDHVPIACKDAVAIL 175 (193)
Q Consensus 98 ~~~~KivllGd~gvGKTSLl-r~~~~~f~-~~~~t~g~~~~~~~i~v~~~~v~l~iwD~~G~e~~~~~~~~~~~~a~~il 175 (193)
...|||+|+||+|||||||+ ||.++.|. .|..|+|+||..++++++|+.++++||||+|||+|+.+...||++|||+|
T Consensus 7 dylFKiiliGds~VGKtCL~~Rf~~~~f~e~~~sTIGVDf~~rt~e~~gk~iKlQIWDTAGQERFrtit~syYR~ahGii 86 (205)
T KOG0084|consen 7 DYLFKIILIGDSGVGKTCLLLRFKDDTFTESYISTIGVDFKIRTVELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGII 86 (205)
T ss_pred ceEEEEEEECCCCcChhhhhhhhccCCcchhhcceeeeEEEEEEeeecceEEEEEeeeccccHHHhhhhHhhccCCCeEE
Confidence 45899999999999999999 99999999 89999999999999999999999999999999999999999999999999
Q ss_pred EEEECCChhhHHHHHhcC
Q 029430 176 FMFDLTSRCTLNRFDHNQ 193 (193)
Q Consensus 176 lvyDit~~~Sf~~l~~W~ 193 (193)
+|||+|+++||+++..|+
T Consensus 87 ~vyDiT~~~SF~~v~~Wi 104 (205)
T KOG0084|consen 87 FVYDITKQESFNNVKRWI 104 (205)
T ss_pred EEEEcccHHHhhhHHHHH
Confidence 999999999999999995
|
|
| >KOG0094 consensus GTPase Rab6/YPT6/Ryh1, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0092 consensus GTPase Rab5/YPT51 and related small G protein superfamily GTPases [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0080 consensus GTPase Rab18, small G protein superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0078 consensus GTP-binding protein SEC4, small G protein superfamily, and related Ras family GTP-binding proteins [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0095 consensus GTPase Rab30, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0394 consensus Ras-related GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0079 consensus GTP-binding protein H-ray, small G protein superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0098 consensus GTPase Rab2, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0087 consensus GTPase Rab11/YPT3, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0088 consensus GTPase Rab21, small G protein superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0086 consensus GTPase Rab4, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >cd04120 Rab12 Rab12 subfamily | Back alignment and domain information |
|---|
| >KOG0093 consensus GTPase Rab3, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >cd04172 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily | Back alignment and domain information |
|---|
| >cd04133 Rop_like Rop subfamily | Back alignment and domain information |
|---|
| >cd04128 Spg1 Spg1p | Back alignment and domain information |
|---|
| >cd04121 Rab40 Rab40 subfamily | Back alignment and domain information |
|---|
| >KOG0091 consensus GTPase Rab39, small G protein superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >cd04131 Rnd Rnd subfamily | Back alignment and domain information |
|---|
| >cd01875 RhoG RhoG subfamily | Back alignment and domain information |
|---|
| >cd04102 RabL3 RabL3 (Rab-like3) subfamily | Back alignment and domain information |
|---|
| >KOG0083 consensus GTPase Rab26/Rab37, small G protein superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >cd04174 Rnd1_Rho6 Rnd1/Rho6 subfamily | Back alignment and domain information |
|---|
| >cd01874 Cdc42 Cdc42 subfamily | Back alignment and domain information |
|---|
| >PLN03071 GTP-binding nuclear protein Ran; Provisional | Back alignment and domain information |
|---|
| >cd04173 Rnd2_Rho7 Rnd2/Rho7 subfamily | Back alignment and domain information |
|---|
| >cd04107 Rab32_Rab38 Rab38/Rab32 subfamily | Back alignment and domain information |
|---|
| >cd04122 Rab14 Rab14 subfamily | Back alignment and domain information |
|---|
| >PLN00023 GTP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd04108 Rab36_Rab34 Rab34/Rab36 subfamily | Back alignment and domain information |
|---|
| >cd04117 Rab15 Rab15 subfamily | Back alignment and domain information |
|---|
| >PF00071 Ras: Ras family; InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases | Back alignment and domain information |
|---|
| >cd04136 Rap_like Rap-like subfamily | Back alignment and domain information |
|---|
| >cd04176 Rap2 Rap2 subgroup | Back alignment and domain information |
|---|
| >cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily | Back alignment and domain information |
|---|
| >cd04119 RJL RJL (RabJ-Like) subfamily | Back alignment and domain information |
|---|
| >cd01871 Rac1_like Rac1-like subfamily | Back alignment and domain information |
|---|
| >cd01865 Rab3 Rab3 subfamily | Back alignment and domain information |
|---|
| >cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily | Back alignment and domain information |
|---|
| >cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2 | Back alignment and domain information |
|---|
| >cd04109 Rab28 Rab28 subfamily | Back alignment and domain information |
|---|
| >cd04110 Rab35 Rab35 subfamily | Back alignment and domain information |
|---|
| >cd04124 RabL2 RabL2 subfamily | Back alignment and domain information |
|---|
| >cd04127 Rab27A Rab27a subfamily | Back alignment and domain information |
|---|
| >PTZ00369 Ras-like protein; Provisional | Back alignment and domain information |
|---|
| >cd04116 Rab9 Rab9 subfamily | Back alignment and domain information |
|---|
| >KOG0081 consensus GTPase Rab27, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >cd04111 Rab39 Rab39 subfamily | Back alignment and domain information |
|---|
| >cd04175 Rap1 Rap1 subgroup | Back alignment and domain information |
|---|
| >cd04125 RabA_like RabA-like subfamily | Back alignment and domain information |
|---|
| >cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases | Back alignment and domain information |
|---|
| >KOG0393 consensus Ras-related small GTPase, Rho type [General function prediction only] | Back alignment and domain information |
|---|
| >cd04118 Rab24 Rab24 subfamily | Back alignment and domain information |
|---|
| >cd04143 Rhes_like Rhes_like subfamily | Back alignment and domain information |
|---|
| >PLN03110 Rab GTPase; Provisional | Back alignment and domain information |
|---|
| >cd04134 Rho3 Rho3 subfamily | Back alignment and domain information |
|---|
| >cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily | Back alignment and domain information |
|---|
| >cd04106 Rab23_lke Rab23-like subfamily | Back alignment and domain information |
|---|
| >KOG1673 consensus Ras GTPases [General function prediction only] | Back alignment and domain information |
|---|
| >cd01892 Miro2 Miro2 subfamily | Back alignment and domain information |
|---|
| >cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily | Back alignment and domain information |
|---|
| >smart00176 RAN Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases | Back alignment and domain information |
|---|
| >cd01864 Rab19 Rab19 subfamily | Back alignment and domain information |
|---|
| >cd04113 Rab4 Rab4 subfamily | Back alignment and domain information |
|---|
| >KOG0097 consensus GTPase Rab14, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >cd01868 Rab11_like Rab11-like | Back alignment and domain information |
|---|
| >cd04103 Centaurin_gamma Centaurin gamma | Back alignment and domain information |
|---|
| >cd04130 Wrch_1 Wrch-1 subfamily | Back alignment and domain information |
|---|
| >cd01866 Rab2 Rab2 subfamily | Back alignment and domain information |
|---|
| >cd04144 Ras2 Ras2 subfamily | Back alignment and domain information |
|---|
| >cd04112 Rab26 Rab26 subfamily | Back alignment and domain information |
|---|
| >cd04132 Rho4_like Rho4-like subfamily | Back alignment and domain information |
|---|
| >cd04126 Rab20 Rab20 subfamily | Back alignment and domain information |
|---|
| >cd04101 RabL4 RabL4 (Rab-like4) subfamily | Back alignment and domain information |
|---|
| >cd01861 Rab6 Rab6 subfamily | Back alignment and domain information |
|---|
| >PLN03118 Rab family protein; Provisional | Back alignment and domain information |
|---|
| >smart00173 RAS Ras subfamily of RAS small GTPases | Back alignment and domain information |
|---|
| >cd04140 ARHI_like ARHI subfamily | Back alignment and domain information |
|---|
| >cd01860 Rab5_related Rab5-related subfamily | Back alignment and domain information |
|---|
| >KOG0395 consensus Ras-related GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >PLN03108 Rab family protein; Provisional | Back alignment and domain information |
|---|
| >cd01873 RhoBTB RhoBTB subfamily | Back alignment and domain information |
|---|
| >cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily | Back alignment and domain information |
|---|
| >smart00174 RHO Rho (Ras homology) subfamily of Ras-like small GTPases | Back alignment and domain information |
|---|
| >PTZ00132 GTP-binding nuclear protein Ran; Provisional | Back alignment and domain information |
|---|
| >cd04150 Arf1_5_like Arf1-Arf5-like subfamily | Back alignment and domain information |
|---|
| >smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor | Back alignment and domain information |
|---|
| >cd04142 RRP22 RRP22 subfamily | Back alignment and domain information |
|---|
| >smart00175 RAB Rab subfamily of small GTPases | Back alignment and domain information |
|---|
| >cd04177 RSR1 RSR1 subgroup | Back alignment and domain information |
|---|
| >cd01862 Rab7 Rab7 subfamily | Back alignment and domain information |
|---|
| >cd01870 RhoA_like RhoA-like subfamily | Back alignment and domain information |
|---|
| >cd04152 Arl4_Arl7 Arl4/Arl7 subfamily | Back alignment and domain information |
|---|
| >cd04149 Arf6 Arf6 subfamily | Back alignment and domain information |
|---|
| >PLN00223 ADP-ribosylation factor; Provisional | Back alignment and domain information |
|---|
| >cd01863 Rab18 Rab18 subfamily | Back alignment and domain information |
|---|
| >cd04135 Tc10 TC10 subfamily | Back alignment and domain information |
|---|
| >cd04148 RGK RGK subfamily | Back alignment and domain information |
|---|
| >cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily | Back alignment and domain information |
|---|
| >PTZ00133 ADP-ribosylation factor; Provisional | Back alignment and domain information |
|---|
| >cd04146 RERG_RasL11_like RERG/RasL11-like subfamily | Back alignment and domain information |
|---|
| >cd04114 Rab30 Rab30 subfamily | Back alignment and domain information |
|---|
| >cd04123 Rab21 Rab21 subfamily | Back alignment and domain information |
|---|
| >cd04158 ARD1 ARD1 subfamily | Back alignment and domain information |
|---|
| >cd04147 Ras_dva Ras-dva subfamily | Back alignment and domain information |
|---|
| >KOG4252 consensus GTP-binding protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd00154 Rab Rab family | Back alignment and domain information |
|---|
| >COG1100 GTPase SAR1 and related small G proteins [General function prediction only] | Back alignment and domain information |
|---|
| >cd01893 Miro1 Miro1 subfamily | Back alignment and domain information |
|---|
| >cd04154 Arl2 Arl2 subfamily | Back alignment and domain information |
|---|
| >cd04139 RalA_RalB RalA/RalB subfamily | Back alignment and domain information |
|---|
| >PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases | Back alignment and domain information |
|---|
| >cd00157 Rho Rho (Ras homology) family | Back alignment and domain information |
|---|
| >cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily | Back alignment and domain information |
|---|
| >cd04129 Rho2 Rho2 subfamily | Back alignment and domain information |
|---|
| >cd00876 Ras Ras family | Back alignment and domain information |
|---|
| >cd04153 Arl5_Arl8 Arl5/Arl8 subfamily | Back alignment and domain information |
|---|
| >cd04156 ARLTS1 ARLTS1 subfamily | Back alignment and domain information |
|---|
| >cd04157 Arl6 Arl6 subfamily | Back alignment and domain information |
|---|
| >cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily | Back alignment and domain information |
|---|
| >cd04151 Arl1 Arl1 subfamily | Back alignment and domain information |
|---|
| >KOG0070 consensus GTP-binding ADP-ribosylation factor Arf1 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases | Back alignment and domain information |
|---|
| >smart00178 SAR Sar1p-like members of the Ras-family of small GTPases | Back alignment and domain information |
|---|
| >cd00879 Sar1 Sar1 subfamily | Back alignment and domain information |
|---|
| >cd04159 Arl10_like Arl10-like subfamily | Back alignment and domain information |
|---|
| >PF00025 Arf: ADP-ribosylation factor family The prints entry specific to Sar1 proteins The Prosite entry specific to Sar1 proteins; InterPro: IPR006689 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases | Back alignment and domain information |
|---|
| >KOG0096 consensus GTPase Ran/TC4/GSP1 (nuclear protein transport pathway), small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >cd04160 Arfrp1 Arfrp1 subfamily | Back alignment and domain information |
|---|
| >KOG0073 consensus GTP-binding ADP-ribosylation factor-like protein ARL2 [Intracellular trafficking, secretion, and vesicular transport; Cytoskeleton] | Back alignment and domain information |
|---|
| >cd04155 Arl3 Arl3 subfamily | Back alignment and domain information |
|---|
| >cd01890 LepA LepA subfamily | Back alignment and domain information |
|---|
| >KOG0071 consensus GTP-binding ADP-ribosylation factor Arf6 (dArf3) [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >TIGR00231 small_GTP small GTP-binding protein domain | Back alignment and domain information |
|---|
| >KOG4423 consensus GTP-binding protein-like, RAS superfamily [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd04105 SR_beta Signal recognition particle receptor, beta subunit (SR-beta) | Back alignment and domain information |
|---|
| >PTZ00099 rab6; Provisional | Back alignment and domain information |
|---|
| >cd04171 SelB SelB subfamily | Back alignment and domain information |
|---|
| >cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily | Back alignment and domain information |
|---|
| >KOG0074 consensus GTP-binding ADP-ribosylation factor-like protein ARL3 [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02528 EutP ethanolamine utilization protein, EutP | Back alignment and domain information |
|---|
| >cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily | Back alignment and domain information |
|---|
| >KOG3883 consensus Ras family small GTPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd00882 Ras_like_GTPase Ras-like GTPase superfamily | Back alignment and domain information |
|---|
| >TIGR00450 mnmE_trmE_thdF tRNA modification GTPase TrmE | Back alignment and domain information |
|---|
| >KOG0075 consensus GTP-binding ADP-ribosylation factor-like protein [General function prediction only] | Back alignment and domain information |
|---|
| >cd01898 Obg Obg subfamily | Back alignment and domain information |
|---|
| >cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans | Back alignment and domain information |
|---|
| >cd01879 FeoB Ferrous iron transport protein B (FeoB) subfamily | Back alignment and domain information |
|---|
| >cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes | Back alignment and domain information |
|---|
| >cd01878 HflX HflX subfamily | Back alignment and domain information |
|---|
| >PRK05291 trmE tRNA modification GTPase TrmE; Reviewed | Back alignment and domain information |
|---|
| >PRK04213 GTP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01393 lepA GTP-binding protein LepA | Back alignment and domain information |
|---|
| >PRK03003 GTP-binding protein Der; Reviewed | Back alignment and domain information |
|---|
| >TIGR03156 GTP_HflX GTP-binding protein HflX | Back alignment and domain information |
|---|
| >PRK03003 GTP-binding protein Der; Reviewed | Back alignment and domain information |
|---|
| >PRK15494 era GTPase Era; Provisional | Back alignment and domain information |
|---|
| >cd04167 Snu114p Snu114p subfamily | Back alignment and domain information |
|---|
| >PRK00093 GTP-binding protein Der; Reviewed | Back alignment and domain information |
|---|
| >cd01895 EngA2 EngA2 subfamily | Back alignment and domain information |
|---|
| >cd01894 EngA1 EngA1 subfamily | Back alignment and domain information |
|---|
| >TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB | Back alignment and domain information |
|---|
| >cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1 | Back alignment and domain information |
|---|
| >KOG0076 consensus GTP-binding ADP-ribosylation factor-like protein yARL3 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >cd01889 SelB_euk SelB subfamily | Back alignment and domain information |
|---|
| >TIGR00487 IF-2 translation initiation factor IF-2 | Back alignment and domain information |
|---|
| >KOG0072 consensus GTP-binding ADP-ribosylation factor-like protein ARL1 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >cd00881 GTP_translation_factor GTP translation factor family | Back alignment and domain information |
|---|
| >TIGR03594 GTPase_EngA ribosome-associated GTPase EngA | Back alignment and domain information |
|---|
| >PRK00454 engB GTP-binding protein YsxC; Reviewed | Back alignment and domain information |
|---|
| >PRK11058 GTPase HflX; Provisional | Back alignment and domain information |
|---|
| >cd01896 DRG The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins | Back alignment and domain information |
|---|
| >KOG1707 consensus Predicted Ras related/Rac-GTP binding protein [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK05306 infB translation initiation factor IF-2; Validated | Back alignment and domain information |
|---|
| >smart00010 small_GTPase Small GTPase of the Ras superfamily; ill-defined subfamily | Back alignment and domain information |
|---|
| >cd04163 Era Era subfamily | Back alignment and domain information |
|---|
| >TIGR00475 selB selenocysteine-specific elongation factor SelB | Back alignment and domain information |
|---|
| >TIGR03594 GTPase_EngA ribosome-associated GTPase EngA | Back alignment and domain information |
|---|
| >CHL00189 infB translation initiation factor 2; Provisional | Back alignment and domain information |
|---|
| >PRK05433 GTP-binding protein LepA; Provisional | Back alignment and domain information |
|---|
| >cd01850 CDC_Septin CDC/Septin | Back alignment and domain information |
|---|
| >cd04168 TetM_like Tet(M)-like subfamily | Back alignment and domain information |
|---|
| >PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed | Back alignment and domain information |
|---|
| >TIGR00491 aIF-2 translation initiation factor aIF-2/yIF-2 | Back alignment and domain information |
|---|
| >PRK10218 GTP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd01876 YihA_EngB The YihA (EngB) subfamily | Back alignment and domain information |
|---|
| >TIGR00436 era GTP-binding protein Era | Back alignment and domain information |
|---|
| >PRK15467 ethanolamine utilization protein EutP; Provisional | Back alignment and domain information |
|---|
| >PRK12299 obgE GTPase CgtA; Reviewed | Back alignment and domain information |
|---|
| >TIGR02729 Obg_CgtA Obg family GTPase CgtA | Back alignment and domain information |
|---|
| >KOG0077 consensus Vesicle coat complex COPII, GTPase subunit SAR1 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed | Back alignment and domain information |
|---|
| >PF04670 Gtr1_RagA: Gtr1/RagA G protein conserved region; InterPro: IPR006762 GTR1 was first identified in Saccharomyces cerevisiae (Baker's yeast) as a suppressor of a mutation in RCC1 | Back alignment and domain information |
|---|
| >cd00880 Era_like Era (E | Back alignment and domain information |
|---|
| >PRK04004 translation initiation factor IF-2; Validated | Back alignment and domain information |
|---|
| >TIGR00483 EF-1_alpha translation elongation factor EF-1 alpha | Back alignment and domain information |
|---|
| >cd01899 Ygr210 Ygr210 subfamily | Back alignment and domain information |
|---|
| >PRK00093 GTP-binding protein Der; Reviewed | Back alignment and domain information |
|---|
| >cd04169 RF3 RF3 subfamily | Back alignment and domain information |
|---|
| >PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse | Back alignment and domain information |
|---|
| >cd01885 EF2 EF2 (for archaea and eukarya) | Back alignment and domain information |
|---|
| >PRK13351 elongation factor G; Reviewed | Back alignment and domain information |
|---|
| >PRK00089 era GTPase Era; Reviewed | Back alignment and domain information |
|---|
| >PRK12297 obgE GTPase CgtA; Reviewed | Back alignment and domain information |
|---|
| >TIGR00437 feoB ferrous iron transporter FeoB | Back alignment and domain information |
|---|
| >cd04104 p47_IIGP_like p47 (47-kDa) family | Back alignment and domain information |
|---|
| >cd04170 EF-G_bact Elongation factor G (EF-G) subfamily | Back alignment and domain information |
|---|
| >COG2229 Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >cd04166 CysN_ATPS CysN_ATPS subfamily | Back alignment and domain information |
|---|
| >TIGR01394 TypA_BipA GTP-binding protein TypA/BipA | Back alignment and domain information |
|---|
| >cd01888 eIF2_gamma eIF2-gamma (gamma subunit of initiation factor 2) | Back alignment and domain information |
|---|
| >PRK09554 feoB ferrous iron transport protein B; Reviewed | Back alignment and domain information |
|---|
| >PRK00741 prfC peptide chain release factor 3; Provisional | Back alignment and domain information |
|---|
| >PRK12317 elongation factor 1-alpha; Reviewed | Back alignment and domain information |
|---|
| >TIGR00490 aEF-2 translation elongation factor aEF-2 | Back alignment and domain information |
|---|
| >PRK09602 translation-associated GTPase; Reviewed | Back alignment and domain information |
|---|
| >PRK12296 obgE GTPase CgtA; Reviewed | Back alignment and domain information |
|---|
| >TIGR00503 prfC peptide chain release factor 3 | Back alignment and domain information |
|---|
| >PF09439 SRPRB: Signal recognition particle receptor beta subunit; InterPro: IPR019009 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] | Back alignment and domain information |
|---|
| >COG0486 ThdF Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00991 3a0901s02IAP34 GTP-binding protein (Chloroplast Envelope Protein Translocase) | Back alignment and domain information |
|---|
| >PF02421 FeoB_N: Ferrous iron transport protein B; InterPro: IPR011619 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions | Back alignment and domain information |
|---|
| >PRK10512 selenocysteinyl-tRNA-specific translation factor; Provisional | Back alignment and domain information |
|---|
| >TIGR00485 EF-Tu translation elongation factor TU | Back alignment and domain information |
|---|
| >cd01883 EF1_alpha Eukaryotic elongation factor 1 (EF1) alpha subfamily | Back alignment and domain information |
|---|
| >TIGR03680 eif2g_arch translation initiation factor 2 subunit gamma | Back alignment and domain information |
|---|
| >PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways | Back alignment and domain information |
|---|
| >KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK04000 translation initiation factor IF-2 subunit gamma; Validated | Back alignment and domain information |
|---|
| >cd01857 HSR1_MMR1 HSR1/MMR1 | Back alignment and domain information |
|---|
| >PRK12298 obgE GTPase CgtA; Reviewed | Back alignment and domain information |
|---|
| >cd01886 EF-G Elongation factor G (EF-G) subfamily | Back alignment and domain information |
|---|
| >PF00009 GTP_EFTU: Elongation factor Tu GTP binding domain; InterPro: IPR000795 Elongation factors belong to a family of proteins that promote the GTP-dependent binding of aminoacyl tRNA to the A site of ribosomes during protein biosynthesis, and catalyse the translocation of the synthesised protein chain from the A to the P site | Back alignment and domain information |
|---|
| >TIGR00484 EF-G translation elongation factor EF-G | Back alignment and domain information |
|---|
| >cd01884 EF_Tu EF-Tu subfamily | Back alignment and domain information |
|---|
| >cd01853 Toc34_like Toc34-like (Translocon at the Outer-envelope membrane of Chloroplasts) | Back alignment and domain information |
|---|
| >cd01859 MJ1464 MJ1464 | Back alignment and domain information |
|---|
| >cd01852 AIG1 AIG1 (avrRpt2-induced gene 1) | Back alignment and domain information |
|---|
| >PRK12735 elongation factor Tu; Reviewed | Back alignment and domain information |
|---|
| >PRK12736 elongation factor Tu; Reviewed | Back alignment and domain information |
|---|
| >COG1160 Predicted GTPases [General function prediction only] | Back alignment and domain information |
|---|
| >COG1163 DRG Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >PLN03126 Elongation factor Tu; Provisional | Back alignment and domain information |
|---|
| >cd04165 GTPBP1_like GTPBP1-like | Back alignment and domain information |
|---|
| >cd00066 G-alpha G protein alpha subunit | Back alignment and domain information |
|---|
| >cd01856 YlqF YlqF | Back alignment and domain information |
|---|
| >PLN00043 elongation factor 1-alpha; Provisional | Back alignment and domain information |
|---|
| >KOG1191 consensus Mitochondrial GTPase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR02034 CysN sulfate adenylyltransferase, large subunit | Back alignment and domain information |
|---|
| >KOG3886 consensus GTP-binding protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK12740 elongation factor G; Reviewed | Back alignment and domain information |
|---|
| >PRK05124 cysN sulfate adenylyltransferase subunit 1; Provisional | Back alignment and domain information |
|---|
| >PF00735 Septin: Septin; InterPro: IPR000038 Septins constitute a eukaryotic family of guanine nucleotide-binding proteins, most of which polymerise to form filaments [] | Back alignment and domain information |
|---|
| >KOG1423 consensus Ras-like GTPase ERA [Cell cycle control, cell division, chromosome partitioning; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG1160 Predicted GTPases [General function prediction only] | Back alignment and domain information |
|---|
| >PF05783 DLIC: Dynein light intermediate chain (DLIC); InterPro: IPR022780 This entry consists of several eukaryotic dynein light intermediate chain proteins | Back alignment and domain information |
|---|
| >COG3596 Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >CHL00071 tufA elongation factor Tu | Back alignment and domain information |
|---|
| >PF04548 AIG1: AIG1 family; InterPro: IPR006703 This entry represents a domain found in Arabidopsis protein AIG1 which appears to be involved in plant resistance to bacteria | Back alignment and domain information |
|---|
| >KOG0090 consensus Signal recognition particle receptor, beta subunit (small G protein superfamily) [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG3905 consensus Dynein light intermediate chain [Cell motility] | Back alignment and domain information |
|---|
| >PTZ00258 GTP-binding protein; Provisional | Back alignment and domain information |
|---|
| >KOG1707 consensus Predicted Ras related/Rac-GTP binding protein [Defense mechanisms] | Back alignment and domain information |
|---|
| >PTZ00141 elongation factor 1- alpha; Provisional | Back alignment and domain information |
|---|
| >cd01900 YchF YchF subfamily | Back alignment and domain information |
|---|
| >PRK00049 elongation factor Tu; Reviewed | Back alignment and domain information |
|---|
| >PRK09601 GTP-binding protein YchF; Reviewed | Back alignment and domain information |
|---|
| >PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional | Back alignment and domain information |
|---|
| >PRK12739 elongation factor G; Reviewed | Back alignment and domain information |
|---|
| >COG1159 Era GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >cd01858 NGP_1 NGP-1 | Back alignment and domain information |
|---|
| >KOG4273 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PLN03127 Elongation factor Tu; Provisional | Back alignment and domain information |
|---|
| >COG1084 Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03596 GTPase_YlqF ribosome biogenesis GTP-binding protein YlqF | Back alignment and domain information |
|---|
| >PRK09563 rbgA GTPase YlqF; Reviewed | Back alignment and domain information |
|---|
| >cd04178 Nucleostemin_like Nucleostemin-like | Back alignment and domain information |
|---|
| >TIGR00993 3a0901s04IAP86 chloroplast protein import component Toc86/159, G and M domains | Back alignment and domain information |
|---|
| >PRK00007 elongation factor G; Reviewed | Back alignment and domain information |
|---|
| >PTZ00416 elongation factor 2; Provisional | Back alignment and domain information |
|---|
| >PLN00116 translation elongation factor EF-2 subunit; Provisional | Back alignment and domain information |
|---|
| >PRK07560 elongation factor EF-2; Reviewed | Back alignment and domain information |
|---|
| >PRK14845 translation initiation factor IF-2; Provisional | Back alignment and domain information |
|---|
| >COG0370 FeoB Fe2+ transport system protein B [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd01855 YqeH YqeH | Back alignment and domain information |
|---|
| >KOG1547 consensus Septin CDC10 and related P-loop GTPases [Cell cycle control, cell division, chromosome partitioning; Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >PF05049 IIGP: Interferon-inducible GTPase (IIGP); InterPro: IPR007743 Interferon-inducible GTPase (IIGP) is thought to play a role in in intracellular defence | Back alignment and domain information |
|---|
| >COG1161 Predicted GTPases [General function prediction only] | Back alignment and domain information |
|---|
| >PF00350 Dynamin_N: Dynamin family; InterPro: IPR001401 Membrane transport between compartments in eukaryotic cells requires proteins that allow the budding and scission of nascent cargo vesicles from one compartment and their targeting and fusion with another | Back alignment and domain information |
|---|
| >KOG1486 consensus GTP-binding protein DRG2 (ODN superfamily) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG5019 CDC3 Septin family protein [Cell division and chromosome partitioning / Cytoskeleton] | Back alignment and domain information |
|---|
| >COG4917 EutP Ethanolamine utilization protein [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd01882 BMS1 Bms1 | Back alignment and domain information |
|---|
| >COG5256 TEF1 Translation elongation factor EF-1alpha (GTPase) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG2655 consensus Septin family protein (P-loop GTPase) [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >cd01851 GBP Guanylate-binding protein (GBP), N-terminal domain | Back alignment and domain information |
|---|
| >smart00275 G_alpha G protein alpha subunit | Back alignment and domain information |
|---|
| >cd01849 YlqF_related_GTPase YlqF-related GTPases | Back alignment and domain information |
|---|
| >COG0218 Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00092 GTP-binding protein YchF | Back alignment and domain information |
|---|
| >PRK12289 GTPase RsgA; Reviewed | Back alignment and domain information |
|---|
| >PRK13768 GTPase; Provisional | Back alignment and domain information |
|---|
| >TIGR00157 ribosome small subunit-dependent GTPase A | Back alignment and domain information |
|---|
| >KOG3859 consensus Septins (P-loop GTPases) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis | Back alignment and domain information |
|---|
| >PRK12288 GTPase RsgA; Reviewed | Back alignment and domain information |
|---|
| >KOG0082 consensus G-protein alpha subunit (small G protein superfamily) [Cell cycle control, cell division, chromosome partitioning; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] | Back alignment and domain information |
|---|
| >COG0532 InfB Translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd01854 YjeQ_engC YjeQ/EngC | Back alignment and domain information |
|---|
| >KOG0468 consensus U5 snRNP-specific protein [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity | Back alignment and domain information |
|---|
| >COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03597 GTPase_YqeH ribosome biogenesis GTPase YqeH | Back alignment and domain information |
|---|
| >PRK00098 GTPase RsgA; Reviewed | Back alignment and domain information |
|---|
| >PRK13796 GTPase YqeH; Provisional | Back alignment and domain information |
|---|
| >COG2262 HflX GTPases [General function prediction only] | Back alignment and domain information |
|---|
| >COG0012 Predicted GTPase, probable translation factor [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG1489 consensus Predicted GTP-binding protein (ODN superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >COG4108 PrfC Peptide chain release factor RF-3 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A | Back alignment and domain information |
|---|
| >PRK08118 topology modulation protein; Reviewed | Back alignment and domain information |
|---|
| >COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1491 consensus Predicted GTP-binding protein (ODN superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK07261 topology modulation protein; Provisional | Back alignment and domain information |
|---|
| >PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B | Back alignment and domain information |
|---|
| >COG1162 Predicted GTPases [General function prediction only] | Back alignment and domain information |
|---|
| >COG0480 FusA Translation elongation factors (GTPases) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >smart00382 AAA ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF13521 AAA_28: AAA domain; PDB: 1LW7_A | Back alignment and domain information |
|---|
| >KOG0462 consensus Elongation factor-type GTP-binding protein [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >smart00072 GuKc Guanylate kinase homologues | Back alignment and domain information |
|---|
| >PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport | Back alignment and domain information |
|---|
| >KOG1424 consensus Predicted GTP-binding protein MMR1 [General function prediction only] | Back alignment and domain information |
|---|
| >PF05729 NACHT: NACHT domain | Back alignment and domain information |
|---|
| >PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] | Back alignment and domain information |
|---|
| >PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A | Back alignment and domain information |
|---|
| >KOG0458 consensus Elongation factor 1 alpha [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd02042 ParA ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation | Back alignment and domain information |
|---|
| >COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B | Back alignment and domain information |
|---|
| >KOG1145 consensus Mitochondrial translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK06217 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters | Back alignment and domain information |
|---|
| >PRK13695 putative NTPase; Provisional | Back alignment and domain information |
|---|
| >COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14269 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14738 gmk guanylate kinase; Provisional | Back alignment and domain information |
|---|
| >PF13479 AAA_24: AAA domain | Back alignment and domain information |
|---|
| >PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems | Back alignment and domain information |
|---|
| >PTZ00327 eukaryotic translation initiation factor 2 gamma subunit; Provisional | Back alignment and domain information |
|---|
| >cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors | Back alignment and domain information |
|---|
| >PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional | Back alignment and domain information |
|---|
| >PRK10078 ribose 1,5-bisphosphokinase; Provisional | Back alignment and domain information |
|---|
| >TIGR03263 guanyl_kin guanylate kinase | Back alignment and domain information |
|---|
| >COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG1217 TypA Predicted membrane GTPase involved in stress response [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 | Back alignment and domain information |
|---|
| >TIGR01425 SRP54_euk signal recognition particle protein SRP54 | Back alignment and domain information |
|---|
| >cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain | Back alignment and domain information |
|---|
| >PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C | Back alignment and domain information |
|---|
| >TIGR00101 ureG urease accessory protein UreG | Back alignment and domain information |
|---|
| >PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] | Back alignment and domain information |
|---|
| >PF13555 AAA_29: P-loop containing region of AAA domain | Back alignment and domain information |
|---|
| >PRK14737 gmk guanylate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN | Back alignment and domain information |
|---|
| >KOG1532 consensus GTPase XAB1, interacts with DNA repair protein XPA [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK03839 putative kinase; Provisional | Back alignment and domain information |
|---|
| >PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein | Back alignment and domain information |
|---|
| >cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars | Back alignment and domain information |
|---|
| >TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein | Back alignment and domain information |
|---|
| >PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional | Back alignment and domain information |
|---|
| >PRK00300 gmk guanylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14532 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR03348 VI_IcmF type VI secretion protein IcmF | Back alignment and domain information |
|---|
| >KOG1954 consensus Endocytosis/signaling protein EHD1 [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A | Back alignment and domain information |
|---|
| >cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) | Back alignment and domain information |
|---|
| >TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis | Back alignment and domain information |
|---|
| >COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP | Back alignment and domain information |
|---|
| >cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane | Back alignment and domain information |
|---|
| >PRK08233 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) | Back alignment and domain information |
|---|
| >PRK14530 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR01166 cbiO cobalt transport protein ATP-binding subunit | Back alignment and domain information |
|---|
| >TIGR00150 HI0065_YjeE ATPase, YjeE family | Back alignment and domain information |
|---|
| >TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily | Back alignment and domain information |
|---|
| >PRK14238 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin | Back alignment and domain information |
|---|
| >PRK02496 adk adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PF13173 AAA_14: AAA domain | Back alignment and domain information |
|---|
| >TIGR02868 CydC thiol reductant ABC exporter, CydC subunit | Back alignment and domain information |
|---|
| >cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake | Back alignment and domain information |
|---|
| >cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters | Back alignment and domain information |
|---|
| >cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea | Back alignment and domain information |
|---|
| >PRK14531 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >PRK13949 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK13540 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE | Back alignment and domain information |
|---|
| >cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) | Back alignment and domain information |
|---|
| >PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs | Back alignment and domain information |
|---|
| >cd01120 RecA-like_NTPases RecA-like NTPases | Back alignment and domain information |
|---|
| >PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion | Back alignment and domain information |
|---|
| >KOG1487 consensus GTP-binding protein DRG1 (ODN superfamily) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR01978 sufC FeS assembly ATPase SufC | Back alignment and domain information |
|---|
| >cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) | Back alignment and domain information |
|---|
| >COG0481 LepA Membrane GTPase LepA [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PHA00729 NTP-binding motif containing protein | Back alignment and domain information |
|---|
| >TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK | Back alignment and domain information |
|---|
| >smart00053 DYNc Dynamin, GTPase | Back alignment and domain information |
|---|
| >cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds | Back alignment and domain information |
|---|
| >PTZ00088 adenylate kinase 1; Provisional | Back alignment and domain information |
|---|
| >cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) | Back alignment and domain information |
|---|
| >cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter | Back alignment and domain information |
|---|
| >cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase | Back alignment and domain information |
|---|
| >cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) | Back alignment and domain information |
|---|
| >cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 | Back alignment and domain information |
|---|
| >cd01131 PilT Pilus retraction ATPase PilT | Back alignment and domain information |
|---|
| >PF00625 Guanylate_kin: Guanylate kinase; InterPro: IPR008144 Guanylate kinase (2 | Back alignment and domain information |
|---|
| >cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) | Back alignment and domain information |
|---|
| >TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family | Back alignment and domain information |
|---|
| >TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system | Back alignment and domain information |
|---|
| >KOG3887 consensus Predicted small GTPase involved in nuclear protein import [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity | Back alignment and domain information |
|---|
| >cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome | Back alignment and domain information |
|---|
| >COG5192 BMS1 GTP-binding protein required for 40S ribosome biogenesis [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR00073 hypB hydrogenase accessory protein HypB | Back alignment and domain information |
|---|
| >cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor | Back alignment and domain information |
|---|
| >PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair | Back alignment and domain information |
|---|
| >PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional | Back alignment and domain information |
|---|
| >CHL00131 ycf16 sulfate ABC transporter protein; Validated | Back alignment and domain information |
|---|
| >PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) | Back alignment and domain information |
|---|
| >TIGR01351 adk adenylate kinases | Back alignment and domain information |
|---|
| >cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters | Back alignment and domain information |
|---|
| >PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional | Back alignment and domain information |
|---|
| >KOG1144 consensus Translation initiation factor 5B (eIF-5B) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth | Back alignment and domain information |
|---|
| >TIGR02770 nickel_nikD nickel import ATP-binding protein NikD | Back alignment and domain information |
|---|
| >PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional | Back alignment and domain information |
|---|
| >TIGR00235 udk uridine kinase | Back alignment and domain information |
|---|
| >PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13543 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >PRK05480 uridine/cytidine kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK09580 sufC cysteine desulfurase ATPase component; Reviewed | Back alignment and domain information |
|---|
| >PRK14247 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK05057 aroK shikimate kinase I; Reviewed | Back alignment and domain information |
|---|
| >TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group | Back alignment and domain information |
|---|
| >cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota | Back alignment and domain information |
|---|
| >TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family | Back alignment and domain information |
|---|
| >COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK00625 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export | Back alignment and domain information |
|---|
| >PRK15056 manganese/iron transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD | Back alignment and domain information |
|---|
| >PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota | Back alignment and domain information |
|---|
| >PRK00279 adk adenylate kinase; Reviewed | Back alignment and domain information |
|---|
| >PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity | Back alignment and domain information |
|---|
| >PF00503 G-alpha: G-protein alpha subunit; InterPro: IPR001019 Guanine nucleotide binding proteins (G proteins) are membrane-associated, heterotrimeric proteins composed of three subunits: alpha (IPR001019 from INTERPRO), beta (IPR001632 from INTERPRO) and gamma (IPR001770 from INTERPRO) [] | Back alignment and domain information |
|---|
| >TIGR02769 nickel_nikE nickel import ATP-binding protein NikE | Back alignment and domain information |
|---|
| >COG4615 PvdE ABC-type siderophore export system, fused ATPase and permease components [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14241 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit | Back alignment and domain information |
|---|
| >cd01918 HprK_C HprK/P, the bifunctional histidine-containing protein kinase/phosphatase, controls the phosphorylation state of the phosphocarrier protein HPr and regulates the utilization of carbon sources by gram-positive bacteria | Back alignment and domain information |
|---|
| >cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively | Back alignment and domain information |
|---|
| >cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor | Back alignment and domain information |
|---|
| >cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids | Back alignment and domain information |
|---|
| >COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] | Back alignment and domain information |
|---|
| >COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] | Back alignment and domain information |
|---|
| >cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component | Back alignment and domain information |
|---|
| >cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids | Back alignment and domain information |
|---|
| >PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A | Back alignment and domain information |
|---|
| >TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB | Back alignment and domain information |
|---|
| >cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate | Back alignment and domain information |
|---|
| >PRK14262 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02673 FtsE cell division ATP-binding protein FtsE | Back alignment and domain information |
|---|
| >PRK14240 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional | Back alignment and domain information |
|---|
| >cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient | Back alignment and domain information |
|---|
| >cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids | Back alignment and domain information |
|---|
| >PRK08099 bifunctional DNA-binding transcriptional repressor/ NMN adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 193 | ||||
| 2efc_B | 181 | Ara7-GdpATVPS9A Length = 181 | 3e-08 | ||
| 1z08_A | 170 | Gppnhp-Bound Rab21 Q53g Mutant Gtpase Length = 170 | 3e-07 | ||
| 3cpj_B | 223 | Crystal Structure Of Ypt31 In Complex With Yeast Ra | 1e-06 | ||
| 2hup_A | 201 | Crystal Structure Of Human Rab43 In Complex With Gd | 1e-06 | ||
| 1yzu_A | 170 | Gppnhp-Bound Rab21 Gtpase At 2.50 A Resolution Leng | 2e-06 | ||
| 1yzt_A | 184 | Gppnhp-Bound Rab21 Gtpase At 2.05 A Resolution Leng | 3e-06 | ||
| 4dkx_A | 216 | Crystal Structure Of The Rab 6a'(Q72l) Length = 216 | 5e-06 | ||
| 2hei_A | 179 | Crystal Structure Of Human Rab5b In Complex With Gd | 5e-06 | ||
| 1z07_A | 166 | Gppnhp-Bound Rab5c G55q Mutant Gtpase Length = 166 | 8e-06 | ||
| 1huq_A | 164 | 1.8a Crystal Structure Of The Monomeric Gtpase Rab5 | 9e-06 | ||
| 1x3s_A | 195 | Crystal Structure Of Human Rab18 In Complex With Gp | 1e-05 | ||
| 1n6p_A | 170 | Crystal Structure Of Human Rab5a A30e Mutant Comple | 1e-05 | ||
| 1yzq_A | 170 | Gppnhp-Bound Rab6 Gtpase Length = 170 | 1e-05 | ||
| 1ek0_A | 170 | Gppnhp-Bound Ypt51 At 1.48 A Resolution Length = 17 | 1e-05 | ||
| 1n6o_A | 170 | Crystal Structure Of Human Rab5a A30k Mutant Comple | 1e-05 | ||
| 1n6n_A | 170 | Crystal Structure Of Human Rab5a A30r Mutant Comple | 1e-05 | ||
| 2g6b_A | 180 | Crystal Structure Of Human Rab26 In Complex With A | 1e-05 | ||
| 1yvd_A | 169 | Gppnhp-Bound Rab22 Gtpase Length = 169 | 2e-05 | ||
| 2y8e_A | 179 | Crystal Structure Of D. Melanogaster Rab6 Gtpase Bo | 2e-05 | ||
| 1n6i_A | 170 | Crystal Structure Of Human Rab5a A30p Mutant Comple | 2e-05 | ||
| 1z0d_A | 167 | Gdp-bound Rab5c Gtpase Length = 167 | 2e-05 | ||
| 1n6h_A | 170 | Crystal Structure Of Human Rab5a Length = 170 | 2e-05 | ||
| 1tu3_A | 171 | Crystal Structure Of Rab5 Complex With Rabaptin5 C- | 2e-05 | ||
| 3bbp_A | 211 | Rab6-Gtp:gcc185 Rab Binding Domain Complex Length = | 2e-05 | ||
| 1d5c_A | 162 | Crystal Structure Of Plasmodium Falciparum Rab6 Com | 3e-05 | ||
| 2p5s_A | 199 | Rab Domain Of Human Rasef In Complex With Gdp Lengt | 4e-05 | ||
| 1n6r_A | 170 | Crystal Structure Of Human Rab5a A30l Mutant Comple | 4e-05 | ||
| 1tu4_A | 171 | Crystal Structure Of Rab5-Gdp Complex Length = 171 | 4e-05 | ||
| 3mjh_A | 168 | Crystal Structure Of Human Rab5a In Complex With Th | 6e-05 | ||
| 2fe4_A | 171 | The Crystal Structure Of Human Neuronal Rab6b In It | 7e-05 | ||
| 1z0j_A | 170 | Structure Of Gtp-Bound Rab22q64l Gtpase In Complex | 8e-05 | ||
| 1yzl_A | 179 | Gppnhp-Bound Rab9 Gtpase Length = 179 | 9e-05 | ||
| 2ocb_A | 180 | Crystal Structure Of Human Rab9b In Complex With A | 1e-04 | ||
| 1wms_A | 177 | High Resolution Crystal Structure Of Human Rab9 Gtp | 1e-04 | ||
| 2gil_A | 162 | Structure Of The Extremely Slow Gtpase Rab6a In The | 1e-04 | ||
| 1s8f_A | 177 | Crystal Structure Of Rab9 Complexed To Gdp Reveals | 1e-04 | ||
| 2if0_A | 200 | Crystal Structure Of Mouse Rab27b Bound To Gdp In M | 1e-04 | ||
| 2fg5_A | 192 | Crystal Structure Of Human Rab31 In Complex With A | 1e-04 | ||
| 4djt_A | 218 | Crystal Structure Of A Nuclear Gtp-Binding Protein | 2e-04 | ||
| 2iez_A | 220 | Crystal Structure Of Mouse Rab27b Bound To Gdp In M | 2e-04 | ||
| 1vg0_B | 207 | The Crystal Structures Of The Rep-1 Protein In Comp | 2e-04 | ||
| 3rab_A | 169 | Gppnhp-bound Rab3a At 2.0 A Resolution Length = 169 | 2e-04 | ||
| 1vg1_A | 185 | Gdp-bound Rab7 Length = 185 | 2e-04 | ||
| 3gj4_A | 221 | Crystal Structure Of Human Rangdp-Nup153znf3 Comple | 2e-04 | ||
| 3law_A | 207 | Structure Of Gtp-Bound L129f Mutant Rab7 Length = 2 | 2e-04 | ||
| 3cwz_A | 188 | Strucure Of Rab6(Gtp)-R6ip1 Complex Length = 188 | 2e-04 | ||
| 1qg4_A | 216 | Canine Gdp-Ran F72y Mutant Length = 216 | 3e-04 | ||
| 3m1i_A | 219 | Crystal Structure Of Yeast Crm1 (Xpo1p) In Complex | 3e-04 | ||
| 1byu_A | 216 | Canine Gdp-Ran Length = 216 | 3e-04 | ||
| 3gj0_A | 221 | Crystal Structure Of Human Rangdp Length = 221 | 4e-04 | ||
| 1qg2_A | 216 | Canine Gdp-Ran R76e Mutant Length = 216 | 4e-04 | ||
| 1g17_A | 170 | Crystal Structure Of Sec4-Guanosine-5'-(Beta,Gamma) | 4e-04 | ||
| 1a2k_C | 216 | Gdpran-Ntf2 Complex Length = 216 | 4e-04 | ||
| 2bku_A | 177 | Kap95p:rangtp Complex Length = 177 | 4e-04 | ||
| 2x19_A | 172 | Crystal Structure Of Importin13 - Rangtp Complex Le | 4e-04 | ||
| 1rrp_A | 204 | Structure Of The Ran-Gppnhp-Ranbd1 Complex Length = | 4e-04 | ||
| 1t91_A | 207 | Crystal Structure Of Human Small Gtpase Rab7(Gtp) L | 4e-04 | ||
| 3ea5_A | 216 | Kap95p Binding Induces The Switch Loops Of Rangdp T | 5e-04 | ||
| 3icq_B | 171 | Karyopherin Nuclear State Length = 171 | 5e-04 | ||
| 2f7s_A | 217 | The Crystal Structure Of Human Rab27b Bound To Gdp | 5e-04 | ||
| 3tso_A | 178 | Structure Of The Cancer Associated Rab25 Protein In | 5e-04 | ||
| 2oil_A | 193 | Crystal Structure Of Human Rab25 In Complex With Gd | 5e-04 | ||
| 1wa5_A | 176 | Crystal Structure Of The Exportin Cse1p Complexed W | 5e-04 | ||
| 3cph_A | 213 | Crystal Structure Of Sec4 In Complex With Rab-Gdi L | 5e-04 | ||
| 2v55_B | 200 | Mechanism Of Multi-site Phosphorylation From A Rock | 6e-04 | ||
| 3dz8_A | 191 | Crystal Structure Of Human Rab3b Gtpase Bound With | 7e-04 | ||
| 1gwn_A | 205 | The Crystal Structure Of The Core Domain Of RhoeRND | 8e-04 | ||
| 1m7b_A | 184 | Crystal Structure Of Rnd3RHOE: FUNCTIONAL IMPLICATI | 8e-04 |
| >pdb|2EFC|B Chain B, Ara7-GdpATVPS9A Length = 181 | Back alignment and structure |
|
| >pdb|1Z08|A Chain A, Gppnhp-Bound Rab21 Q53g Mutant Gtpase Length = 170 | Back alignment and structure |
| >pdb|3CPJ|B Chain B, Crystal Structure Of Ypt31 In Complex With Yeast Rab-Gdi Length = 223 | Back alignment and structure |
| >pdb|2HUP|A Chain A, Crystal Structure Of Human Rab43 In Complex With Gdp Length = 201 | Back alignment and structure |
| >pdb|1YZU|A Chain A, Gppnhp-Bound Rab21 Gtpase At 2.50 A Resolution Length = 170 | Back alignment and structure |
| >pdb|1YZT|A Chain A, Gppnhp-Bound Rab21 Gtpase At 2.05 A Resolution Length = 184 | Back alignment and structure |
| >pdb|4DKX|A Chain A, Crystal Structure Of The Rab 6a'(Q72l) Length = 216 | Back alignment and structure |
| >pdb|2HEI|A Chain A, Crystal Structure Of Human Rab5b In Complex With Gdp Length = 179 | Back alignment and structure |
| >pdb|1Z07|A Chain A, Gppnhp-Bound Rab5c G55q Mutant Gtpase Length = 166 | Back alignment and structure |
| >pdb|1HUQ|A Chain A, 1.8a Crystal Structure Of The Monomeric Gtpase Rab5c (Mouse) Length = 164 | Back alignment and structure |
| >pdb|1X3S|A Chain A, Crystal Structure Of Human Rab18 In Complex With Gppnhp Length = 195 | Back alignment and structure |
| >pdb|1N6P|A Chain A, Crystal Structure Of Human Rab5a A30e Mutant Complex With Gppnhp Length = 170 | Back alignment and structure |
| >pdb|1YZQ|A Chain A, Gppnhp-Bound Rab6 Gtpase Length = 170 | Back alignment and structure |
| >pdb|1EK0|A Chain A, Gppnhp-Bound Ypt51 At 1.48 A Resolution Length = 170 | Back alignment and structure |
| >pdb|1N6O|A Chain A, Crystal Structure Of Human Rab5a A30k Mutant Complex With Gppnhp Length = 170 | Back alignment and structure |
| >pdb|1N6N|A Chain A, Crystal Structure Of Human Rab5a A30r Mutant Complex With Gppnhp Length = 170 | Back alignment and structure |
| >pdb|2G6B|A Chain A, Crystal Structure Of Human Rab26 In Complex With A Gtp Analogue Length = 180 | Back alignment and structure |
| >pdb|1YVD|A Chain A, Gppnhp-Bound Rab22 Gtpase Length = 169 | Back alignment and structure |
| >pdb|2Y8E|A Chain A, Crystal Structure Of D. Melanogaster Rab6 Gtpase Bound To Gmppnp Length = 179 | Back alignment and structure |
| >pdb|1N6I|A Chain A, Crystal Structure Of Human Rab5a A30p Mutant Complex With Gdp Length = 170 | Back alignment and structure |
| >pdb|1Z0D|A Chain A, Gdp-bound Rab5c Gtpase Length = 167 | Back alignment and structure |
| >pdb|1N6H|A Chain A, Crystal Structure Of Human Rab5a Length = 170 | Back alignment and structure |
| >pdb|1TU3|A Chain A, Crystal Structure Of Rab5 Complex With Rabaptin5 C-Terminal Domain Length = 171 | Back alignment and structure |
| >pdb|3BBP|A Chain A, Rab6-Gtp:gcc185 Rab Binding Domain Complex Length = 211 | Back alignment and structure |
| >pdb|1D5C|A Chain A, Crystal Structure Of Plasmodium Falciparum Rab6 Complexed With Gdp Length = 162 | Back alignment and structure |
| >pdb|2P5S|A Chain A, Rab Domain Of Human Rasef In Complex With Gdp Length = 199 | Back alignment and structure |
| >pdb|1N6R|A Chain A, Crystal Structure Of Human Rab5a A30l Mutant Complex With Gppnhp Length = 170 | Back alignment and structure |
| >pdb|1TU4|A Chain A, Crystal Structure Of Rab5-Gdp Complex Length = 171 | Back alignment and structure |
| >pdb|3MJH|A Chain A, Crystal Structure Of Human Rab5a In Complex With The C2h2 Zinc Finger Of Eea1 Length = 168 | Back alignment and structure |
| >pdb|2FE4|A Chain A, The Crystal Structure Of Human Neuronal Rab6b In Its Inactive Gdp-Bound Form Length = 171 | Back alignment and structure |
| >pdb|1Z0J|A Chain A, Structure Of Gtp-Bound Rab22q64l Gtpase In Complex With The Minimal Rab Binding Domain Of Rabenosyn-5 Length = 170 | Back alignment and structure |
| >pdb|1YZL|A Chain A, Gppnhp-Bound Rab9 Gtpase Length = 179 | Back alignment and structure |
| >pdb|2OCB|A Chain A, Crystal Structure Of Human Rab9b In Complex With A Gtp Analogue Length = 180 | Back alignment and structure |
| >pdb|1WMS|A Chain A, High Resolution Crystal Structure Of Human Rab9 Gtpase: A Novel Antiviral Drug Target Length = 177 | Back alignment and structure |
| >pdb|2GIL|A Chain A, Structure Of The Extremely Slow Gtpase Rab6a In The Gtp Bound Form At 1.8 Resolution Length = 162 | Back alignment and structure |
| >pdb|1S8F|A Chain A, Crystal Structure Of Rab9 Complexed To Gdp Reveals A Dimer With An Active Conformation Of Switch Ii Length = 177 | Back alignment and structure |
| >pdb|2IF0|A Chain A, Crystal Structure Of Mouse Rab27b Bound To Gdp In Monoclinic Space Group Length = 200 | Back alignment and structure |
| >pdb|2FG5|A Chain A, Crystal Structure Of Human Rab31 In Complex With A Gtp Analogue Length = 192 | Back alignment and structure |
| >pdb|4DJT|A Chain A, Crystal Structure Of A Nuclear Gtp-Binding Protein From Encephalitozoon Cuniculi Bound To Gdp-Mg2+ Length = 218 | Back alignment and structure |
| >pdb|2IEZ|A Chain A, Crystal Structure Of Mouse Rab27b Bound To Gdp In Monoclinic Space Group Length = 220 | Back alignment and structure |
| >pdb|1VG0|B Chain B, The Crystal Structures Of The Rep-1 Protein In Complex With Monoprenylated Rab7 Protein Length = 207 | Back alignment and structure |
| >pdb|3RAB|A Chain A, Gppnhp-bound Rab3a At 2.0 A Resolution Length = 169 | Back alignment and structure |
| >pdb|1VG1|A Chain A, Gdp-bound Rab7 Length = 185 | Back alignment and structure |
| >pdb|3GJ4|A Chain A, Crystal Structure Of Human Rangdp-Nup153znf3 Complex Length = 221 | Back alignment and structure |
| >pdb|3LAW|A Chain A, Structure Of Gtp-Bound L129f Mutant Rab7 Length = 207 | Back alignment and structure |
| >pdb|3CWZ|A Chain A, Strucure Of Rab6(Gtp)-R6ip1 Complex Length = 188 | Back alignment and structure |
| >pdb|1QG4|A Chain A, Canine Gdp-Ran F72y Mutant Length = 216 | Back alignment and structure |
| >pdb|3M1I|A Chain A, Crystal Structure Of Yeast Crm1 (Xpo1p) In Complex With Yeas (Yrb1p) And Yeast Rangtp (Gsp1pgtp) Length = 219 | Back alignment and structure |
| >pdb|1BYU|A Chain A, Canine Gdp-Ran Length = 216 | Back alignment and structure |
| >pdb|3GJ0|A Chain A, Crystal Structure Of Human Rangdp Length = 221 | Back alignment and structure |
| >pdb|1QG2|A Chain A, Canine Gdp-Ran R76e Mutant Length = 216 | Back alignment and structure |
| >pdb|1G17|A Chain A, Crystal Structure Of Sec4-Guanosine-5'-(Beta,Gamma)- Imidotriphosphate Length = 170 | Back alignment and structure |
| >pdb|1A2K|C Chain C, Gdpran-Ntf2 Complex Length = 216 | Back alignment and structure |
| >pdb|2BKU|A Chain A, Kap95p:rangtp Complex Length = 177 | Back alignment and structure |
| >pdb|2X19|A Chain A, Crystal Structure Of Importin13 - Rangtp Complex Length = 172 | Back alignment and structure |
| >pdb|1RRP|A Chain A, Structure Of The Ran-Gppnhp-Ranbd1 Complex Length = 204 | Back alignment and structure |
| >pdb|1T91|A Chain A, Crystal Structure Of Human Small Gtpase Rab7(Gtp) Length = 207 | Back alignment and structure |
| >pdb|3EA5|A Chain A, Kap95p Binding Induces The Switch Loops Of Rangdp To Adopt The Gtp- Bound Conformation: Implications For Nuclear Import Complex Assembly Dynamics Length = 216 | Back alignment and structure |
| >pdb|3ICQ|B Chain B, Karyopherin Nuclear State Length = 171 | Back alignment and structure |
| >pdb|2F7S|A Chain A, The Crystal Structure Of Human Rab27b Bound To Gdp Length = 217 | Back alignment and structure |
| >pdb|3TSO|A Chain A, Structure Of The Cancer Associated Rab25 Protein In Complex With Fip2 Length = 178 | Back alignment and structure |
| >pdb|2OIL|A Chain A, Crystal Structure Of Human Rab25 In Complex With Gdp Length = 193 | Back alignment and structure |
| >pdb|1WA5|A Chain A, Crystal Structure Of The Exportin Cse1p Complexed With Its Cargo (Kap60p) And Rangtp Length = 176 | Back alignment and structure |
| >pdb|3CPH|A Chain A, Crystal Structure Of Sec4 In Complex With Rab-Gdi Length = 213 | Back alignment and structure |
| >pdb|2V55|B Chain B, Mechanism Of Multi-site Phosphorylation From A Rock-i:rhoe Complex Structure Length = 200 | Back alignment and structure |
| >pdb|3DZ8|A Chain A, Crystal Structure Of Human Rab3b Gtpase Bound With Gdp Length = 191 | Back alignment and structure |
| >pdb|1GWN|A Chain A, The Crystal Structure Of The Core Domain Of RhoeRND3 - A Constitutively Activated Small G Protein Length = 205 | Back alignment and structure |
| >pdb|1M7B|A Chain A, Crystal Structure Of Rnd3RHOE: FUNCTIONAL IMPLICATIONS Length = 184 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 193 | |||
| 3gj0_A | 221 | GTP-binding nuclear protein RAN; G protein, GDP, a | 5e-09 | |
| 3bbp_A | 211 | RAB-6, RAS-related protein RAB-6A; golgi complex, | 9e-07 | |
| 3dz8_A | 191 | RAS-related protein RAB-3B; GDP, GTPase, structura | 3e-06 | |
| 4djt_A | 218 | GTP-binding nuclear protein GSP1; structural genom | 3e-06 | |
| 2gf9_A | 189 | RAS-related protein RAB-3D; G-protein, structural | 3e-06 | |
| 1x3s_A | 195 | RAS-related protein RAB-18; GTPase, GNP, structura | 3e-06 | |
| 1z06_A | 189 | RAS-related protein RAB-33B; RAB GTPase, RAB33B GT | 3e-06 | |
| 1z2a_A | 168 | RAS-related protein RAB-23; RAB GTPase, vesicular | 4e-06 | |
| 1g16_A | 170 | RAS-related protein SEC4; G protein RAB, signaling | 4e-06 | |
| 1vg8_A | 207 | RAS-related protein RAB-7; GTP-binding protein, pr | 4e-06 | |
| 1wms_A | 177 | RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p | 4e-06 | |
| 1z08_A | 170 | RAS-related protein RAB-21; RAB GTPase, vesicular | 5e-06 | |
| 1oix_A | 191 | RAS-related protein RAB-11A; small G protein, intr | 6e-06 | |
| 2f9l_A | 199 | RAB11B, member RAS oncogene family; RAB11B GTPase, | 6e-06 | |
| 3cph_A | 213 | RAS-related protein SEC4; RAB GTPase, prenylation, | 6e-06 | |
| 2oil_A | 193 | CATX-8, RAS-related protein RAB-25; G-protein, GDP | 6e-06 | |
| 2fu5_C | 183 | RAS-related protein RAB-8A; MSS4:RAB8 protein comp | 7e-06 | |
| 3q3j_B | 214 | RHO-related GTP-binding protein RHO6; RAS-binding | 7e-06 | |
| 3l0i_B | 199 | RAS-related protein RAB-1A; GEF-GDF-RAB complex, G | 8e-06 | |
| 2p5s_A | 199 | RAS and EF-hand domain containing; G-protein, RAB, | 8e-06 | |
| 1r2q_A | 170 | RAS-related protein RAB-5A; GTPase, GNP, atomic re | 9e-06 | |
| 1ek0_A | 170 | Protein (GTP-binding protein YPT51); vesicular tra | 9e-06 | |
| 2fg5_A | 192 | RAB-22B, RAS-related protein RAB-31; G-protein, GT | 1e-05 | |
| 2y8e_A | 179 | RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti | 1e-05 | |
| 2il1_A | 192 | RAB12; G-protein, GDP, GTPase, predicted, structur | 1e-05 | |
| 1z0f_A | 179 | RAB14, member RAS oncogene family; RAB GTPase, ves | 2e-05 | |
| 1ky3_A | 182 | GTP-binding protein YPT7P; vesicular traffic, GTP | 2e-05 | |
| 1zbd_A | 203 | Rabphilin-3A; G protein, effector, RABCDR, synapti | 2e-05 | |
| 3cpj_B | 223 | GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl | 2e-05 | |
| 3tw8_B | 181 | RAS-related protein RAB-35; longin domain, RAB GTP | 2e-05 | |
| 2ew1_A | 201 | RAS-related protein RAB-30; G-protein, GTP analogu | 2e-05 | |
| 2g6b_A | 180 | RAS-related protein RAB-26; G-protein, GTP analogu | 2e-05 | |
| 2bcg_Y | 206 | Protein YP2, GTP-binding protein YPT1; RABGTPase, | 2e-05 | |
| 2a5j_A | 191 | RAS-related protein RAB-2B; GTPase, signal transdu | 3e-05 | |
| 3tkl_A | 196 | RAS-related protein RAB-1A; vesicle trafficking, p | 3e-05 | |
| 1z0j_A | 170 | RAB-22, RAS-related protein RAB-22A; RAB GTPase, R | 4e-05 | |
| 2hup_A | 201 | RAS-related protein RAB-43; G-protein, GDP, struct | 5e-05 | |
| 2o52_A | 200 | RAS-related protein RAB-4B; G-protein, GDP, struct | 7e-05 | |
| 2zej_A | 184 | Dardarin, leucine-rich repeat kinase 2; parkinson' | 7e-05 | |
| 2efe_B | 181 | Small GTP-binding protein-like; GEF, GTPase, VPS9, | 1e-04 | |
| 2yc2_C | 208 | IFT27, small RAB-related GTPase; transport protein | 1e-04 | |
| 2bme_A | 186 | RAB4A, RAS-related protein RAB4A; GTP-binding prot | 2e-04 | |
| 3reg_A | 194 | RHO-like small GTPase; cytoskeleton, nucleotide-bi | 2e-04 | |
| 1mh1_A | 186 | RAC1; GTP-binding, GTPase, small G-protein, RHO fa | 2e-04 | |
| 2hxs_A | 178 | RAB-26, RAS-related protein RAB-28; GTPase, signal | 5e-04 | |
| 2j1l_A | 214 | RHO-related GTP-binding protein RHOD; GTPase, memb | 7e-04 | |
| 1gwn_A | 205 | RHO-related GTP-binding protein RHOE; GTPase, inac | 8e-04 | |
| 1m7b_A | 184 | RND3/RHOE small GTP-binding protein; small GTPase, | 8e-04 |
| >3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 1qg4_A* 3ea5_A* 1qg2_A* 1byu_A* 3ran_A* 3gjx_C* ... Length = 221 | Back alignment and structure |
|---|
Score = 53.1 bits (128), Expect = 5e-09
Identities = 27/96 (28%), Positives = 46/96 (47%), Gaps = 7/96 (7%)
Query: 99 VSLKISLLGDCQIGKTSFVK-YVGNE-QERSLQMAGLNLINKTLMVQGARIAFSIWDVGG 156
V K+ L+GD GKT+FVK ++ E +++ + G+ + I F++WD G
Sbjct: 14 VQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAG 73
Query: 157 DSRSFDHVPIAC-KDAVAILFMFDLTSRCTLNRFDH 191
+ F + A + MFD+TSR T + +
Sbjct: 74 QEK-FGGLRDGYYIQAQCAIIMFDVTSRVT---YKN 105
|
| >3bbp_A RAB-6, RAS-related protein RAB-6A; golgi complex, GRIP domain, RAB GTPase, ARL GTPase, golgin, RAB effector, clAsp protein; HET: GTP; 3.00A {Homo sapiens} Length = 211 | Back alignment and structure |
|---|
| >3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} Length = 191 | Back alignment and structure |
|---|
| >4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} Length = 218 | Back alignment and structure |
|---|
| >2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Length = 189 | Back alignment and structure |
|---|
| >1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Length = 195 | Back alignment and structure |
|---|
| >1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Length = 189 | Back alignment and structure |
|---|
| >1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Length = 168 | Back alignment and structure |
|---|
| >1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Length = 170 | Back alignment and structure |
|---|
| >1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Length = 207 | Back alignment and structure |
|---|
| >1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Length = 177 | Back alignment and structure |
|---|
| >1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Length = 170 | Back alignment and structure |
|---|
| >1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Length = 191 | Back alignment and structure |
|---|
| >2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Length = 199 | Back alignment and structure |
|---|
| >3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Length = 213 | Back alignment and structure |
|---|
| >2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Length = 193 | Back alignment and structure |
|---|
| >2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Length = 183 | Back alignment and structure |
|---|
| >3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Length = 214 | Back alignment and structure |
|---|
| >3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} Length = 199 | Back alignment and structure |
|---|
| >2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Length = 199 | Back alignment and structure |
|---|
| >1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Length = 170 | Back alignment and structure |
|---|
| >1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Length = 170 | Back alignment and structure |
|---|
| >2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Length = 192 | Back alignment and structure |
|---|
| >2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Length = 179 | Back alignment and structure |
|---|
| >2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Length = 192 | Back alignment and structure |
|---|
| >1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Length = 179 | Back alignment and structure |
|---|
| >1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Length = 182 | Back alignment and structure |
|---|
| >1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Length = 203 | Back alignment and structure |
|---|
| >3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Length = 223 | Back alignment and structure |
|---|
| >3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Length = 181 | Back alignment and structure |
|---|
| >2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Length = 201 | Back alignment and structure |
|---|
| >2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Length = 180 | Back alignment and structure |
|---|
| >2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Length = 206 | Back alignment and structure |
|---|
| >2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Length = 191 | Back alignment and structure |
|---|
| >3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Length = 196 | Back alignment and structure |
|---|
| >1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Length = 170 | Back alignment and structure |
|---|
| >2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Length = 201 | Back alignment and structure |
|---|
| >2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Length = 200 | Back alignment and structure |
|---|
| >2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Length = 184 | Back alignment and structure |
|---|
| >2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Length = 181 | Back alignment and structure |
|---|
| >2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Length = 208 | Back alignment and structure |
|---|
| >2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Length = 186 | Back alignment and structure |
|---|
| >3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* Length = 194 | Back alignment and structure |
|---|
| >1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Length = 186 | Back alignment and structure |
|---|
| >2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Length = 178 | Back alignment and structure |
|---|
| >2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Length = 214 | Back alignment and structure |
|---|
| >1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Length = 205 | Back alignment and structure |
|---|
| >1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Length = 184 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 193 | |||
| 4dkx_A | 216 | RAS-related protein RAB-6A; GTP binding fold, memb | 99.94 | |
| 2hxs_A | 178 | RAB-26, RAS-related protein RAB-28; GTPase, signal | 99.86 | |
| 2a5j_A | 191 | RAS-related protein RAB-2B; GTPase, signal transdu | 99.86 | |
| 3c5c_A | 187 | RAS-like protein 12; GDP, GTPase, structural genom | 99.86 | |
| 2gf9_A | 189 | RAS-related protein RAB-3D; G-protein, structural | 99.85 | |
| 2hup_A | 201 | RAS-related protein RAB-43; G-protein, GDP, struct | 99.85 | |
| 2ew1_A | 201 | RAS-related protein RAB-30; G-protein, GTP analogu | 99.85 | |
| 2fu5_C | 183 | RAS-related protein RAB-8A; MSS4:RAB8 protein comp | 99.85 | |
| 3q3j_B | 214 | RHO-related GTP-binding protein RHO6; RAS-binding | 99.85 | |
| 1z08_A | 170 | RAS-related protein RAB-21; RAB GTPase, vesicular | 99.85 | |
| 1ek0_A | 170 | Protein (GTP-binding protein YPT51); vesicular tra | 99.84 | |
| 3kkq_A | 183 | RAS-related protein M-RAS; GTP-binding, GTPase, si | 99.84 | |
| 1r2q_A | 170 | RAS-related protein RAB-5A; GTPase, GNP, atomic re | 99.84 | |
| 1z0f_A | 179 | RAB14, member RAS oncogene family; RAB GTPase, ves | 99.84 | |
| 2efe_B | 181 | Small GTP-binding protein-like; GEF, GTPase, VPS9, | 99.84 | |
| 3tw8_B | 181 | RAS-related protein RAB-35; longin domain, RAB GTP | 99.84 | |
| 2q3h_A | 201 | RAS homolog gene family, member U; GTPase, structu | 99.84 | |
| 3cbq_A | 195 | GTP-binding protein REM 2; FLJ38964A, structural g | 99.84 | |
| 3t5g_A | 181 | GTP-binding protein RHEB; immunoglobulin-like beta | 99.84 | |
| 2bcg_Y | 206 | Protein YP2, GTP-binding protein YPT1; RABGTPase, | 99.84 | |
| 3cpj_B | 223 | GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl | 99.84 | |
| 2g6b_A | 180 | RAS-related protein RAB-26; G-protein, GTP analogu | 99.84 | |
| 1z06_A | 189 | RAS-related protein RAB-33B; RAB GTPase, RAB33B GT | 99.84 | |
| 3ihw_A | 184 | Centg3; RAS, centaurin, GTPase, structural genomic | 99.84 | |
| 1gwn_A | 205 | RHO-related GTP-binding protein RHOE; GTPase, inac | 99.84 | |
| 1x3s_A | 195 | RAS-related protein RAB-18; GTPase, GNP, structura | 99.84 | |
| 1z2a_A | 168 | RAS-related protein RAB-23; RAB GTPase, vesicular | 99.84 | |
| 2iwr_A | 178 | Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi | 99.84 | |
| 2oil_A | 193 | CATX-8, RAS-related protein RAB-25; G-protein, GDP | 99.84 | |
| 1wms_A | 177 | RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p | 99.84 | |
| 2y8e_A | 179 | RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti | 99.84 | |
| 3tkl_A | 196 | RAS-related protein RAB-1A; vesicle trafficking, p | 99.83 | |
| 3l0i_B | 199 | RAS-related protein RAB-1A; GEF-GDF-RAB complex, G | 99.83 | |
| 2il1_A | 192 | RAB12; G-protein, GDP, GTPase, predicted, structur | 99.83 | |
| 3reg_A | 194 | RHO-like small GTPase; cytoskeleton, nucleotide-bi | 99.83 | |
| 2j0v_A | 212 | RAC-like GTP-binding protein ARAC7; nucleotide-bin | 99.83 | |
| 2g3y_A | 211 | GTP-binding protein GEM; small GTPase, GDP, inacti | 99.83 | |
| 2bme_A | 186 | RAB4A, RAS-related protein RAB4A; GTP-binding prot | 99.83 | |
| 1m7b_A | 184 | RND3/RHOE small GTP-binding protein; small GTPase, | 99.83 | |
| 2nzj_A | 175 | GTP-binding protein REM 1; GDP/GTP binding, GTP hy | 99.83 | |
| 2atx_A | 194 | Small GTP binding protein TC10; GTPase, P-loop, al | 99.83 | |
| 1z0j_A | 170 | RAB-22, RAS-related protein RAB-22A; RAB GTPase, R | 99.83 | |
| 2fn4_A | 181 | P23, RAS-related protein R-RAS; GDP/GTP binding, G | 99.83 | |
| 2p5s_A | 199 | RAS and EF-hand domain containing; G-protein, RAB, | 99.83 | |
| 3gj0_A | 221 | GTP-binding nuclear protein RAN; G protein, GDP, a | 99.83 | |
| 1g16_A | 170 | RAS-related protein SEC4; G protein RAB, signaling | 99.83 | |
| 1zbd_A | 203 | Rabphilin-3A; G protein, effector, RABCDR, synapti | 99.83 | |
| 2o52_A | 200 | RAS-related protein RAB-4B; G-protein, GDP, struct | 99.83 | |
| 3oes_A | 201 | GTPase rhebl1; small GTPase, structural genomics, | 99.83 | |
| 2cjw_A | 192 | GTP-binding protein GEM; nucleotide-binding, small | 99.82 | |
| 2fg5_A | 192 | RAB-22B, RAS-related protein RAB-31; G-protein, GT | 99.82 | |
| 3dz8_A | 191 | RAS-related protein RAB-3B; GDP, GTPase, structura | 99.82 | |
| 3t1o_A | 198 | Gliding protein MGLA; G domain containing protein, | 99.82 | |
| 4gzl_A | 204 | RAS-related C3 botulinum toxin substrate 1; rossma | 99.82 | |
| 1c1y_A | 167 | RAS-related protein RAP-1A; GTP-binding proteins, | 99.82 | |
| 1vg8_A | 207 | RAS-related protein RAB-7; GTP-binding protein, pr | 99.82 | |
| 1ky3_A | 182 | GTP-binding protein YPT7P; vesicular traffic, GTP | 99.82 | |
| 3clv_A | 208 | RAB5 protein, putative; malaria, GTPase, structura | 99.82 | |
| 3q85_A | 169 | GTP-binding protein REM 2; G-domain, CAV2 beta, si | 99.82 | |
| 1mh1_A | 186 | RAC1; GTP-binding, GTPase, small G-protein, RHO fa | 99.82 | |
| 3bc1_A | 195 | RAS-related protein RAB-27A; RAB27, GTPase, RAB, s | 99.82 | |
| 3q72_A | 166 | GTP-binding protein RAD; G-domain, CAV2 beta, sign | 99.81 | |
| 2f7s_A | 217 | C25KG, RAS-related protein RAB-27B; G-protein, str | 99.81 | |
| 2gco_A | 201 | H9, RHO-related GTP-binding protein RHOC; GTPase,s | 99.81 | |
| 2a9k_A | 187 | RAS-related protein RAL-A; bacterial ADP-ribosyltr | 99.81 | |
| 3cph_A | 213 | RAS-related protein SEC4; RAB GTPase, prenylation, | 99.81 | |
| 2yc2_C | 208 | IFT27, small RAB-related GTPase; transport protein | 99.81 | |
| 4bas_A | 199 | ADP-ribosylation factor, putative (small GTPase, p | 99.81 | |
| 2fv8_A | 207 | H6, RHO-related GTP-binding protein RHOB; GDP/GTP | 99.81 | |
| 2h17_A | 181 | ADP-ribosylation factor-like protein 5A; GDP, GTPa | 99.81 | |
| 1f6b_A | 198 | SAR1; gtpases, N-terminal helix, Mg-containing com | 99.8 | |
| 1kao_A | 167 | RAP2A; GTP-binding protein, small G protein, GDP, | 99.8 | |
| 1u8z_A | 168 | RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH | 99.8 | |
| 3bwd_D | 182 | RAC-like GTP-binding protein ARAC6; G domain, cyto | 99.8 | |
| 2j1l_A | 214 | RHO-related GTP-binding protein RHOD; GTPase, memb | 99.8 | |
| 1oix_A | 191 | RAS-related protein RAB-11A; small G protein, intr | 99.8 | |
| 2bov_A | 206 | RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, | 99.8 | |
| 1r8s_A | 164 | ADP-ribosylation factor 1; protein transport/excha | 99.8 | |
| 1zd9_A | 188 | ADP-ribosylation factor-like 10B; transport protei | 99.8 | |
| 4dsu_A | 189 | GTPase KRAS, isoform 2B; small G-protein, signalin | 99.8 | |
| 2h57_A | 190 | ADP-ribosylation factor-like protein 6; GTP, GTPas | 99.8 | |
| 1fzq_A | 181 | ADP-ribosylation factor-like protein 3; protein-GD | 99.8 | |
| 1m2o_B | 190 | GTP-binding protein SAR1, GTP binding protein; zin | 99.8 | |
| 3con_A | 190 | GTPase NRAS; structural genomics consortium, SGC, | 99.8 | |
| 2f9l_A | 199 | RAB11B, member RAS oncogene family; RAB11B GTPase, | 99.79 | |
| 2atv_A | 196 | RERG, RAS-like estrogen-regulated growth inhibitor | 99.79 | |
| 2zej_A | 184 | Dardarin, leucine-rich repeat kinase 2; parkinson' | 99.79 | |
| 2b6h_A | 192 | ADP-ribosylation factor 5; membrane trafficking, G | 99.79 | |
| 1zj6_A | 187 | ADP-ribosylation factor-like protein 5; ARL, GTP-b | 99.79 | |
| 1upt_A | 171 | ARL1, ADP-ribosylation factor-like protein 1; hydr | 99.79 | |
| 2erx_A | 172 | GTP-binding protein DI-RAS2; GTP hydrolysis, trans | 99.79 | |
| 4djt_A | 218 | GTP-binding nuclear protein GSP1; structural genom | 99.78 | |
| 2ce2_X | 166 | GTPase HRAS; signaling protein, guanine nucleotide | 99.78 | |
| 3llu_A | 196 | RAS-related GTP-binding protein C; structural geno | 99.78 | |
| 2gf0_A | 199 | GTP-binding protein DI-RAS1; GDP/GTP binding, GTP | 99.78 | |
| 2x77_A | 189 | ADP-ribosylation factor; GTP-binding protein, smal | 99.77 | |
| 1ksh_A | 186 | ARF-like protein 2; small GTPase, small GTP-bindin | 99.77 | |
| 1moz_A | 183 | ARL1, ADP-ribosylation factor-like protein 1; GTP- | 99.76 | |
| 3th5_A | 204 | RAS-related C3 botulinum toxin substrate 1; rossma | 99.6 | |
| 3r7w_B | 331 | Gtpase2, GTP-binding protein GTR2; RAG gtpases, GT | 99.73 | |
| 2wkq_A | 332 | NPH1-1, RAS-related C3 botulinum toxin substrate 1 | 99.73 | |
| 3o47_A | 329 | ADP-ribosylation factor GTPase-activating protein | 99.72 | |
| 3lvq_E | 497 | ARF-GAP with SH3 domain, ANK repeat and PH domain | 99.72 | |
| 2lkc_A | 178 | Translation initiation factor IF-2; NMR {Geobacill | 99.72 | |
| 3r7w_A | 307 | Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT | 99.71 | |
| 3c5h_A | 255 | Glucocorticoid receptor DNA-binding factor 1; RAS, | 99.71 | |
| 2fh5_B | 214 | SR-beta, signal recognition particle receptor beta | 99.71 | |
| 2wji_A | 165 | Ferrous iron transport protein B homolog; membrane | 99.64 | |
| 2wjg_A | 188 | FEOB, ferrous iron transport protein B homolog; me | 99.61 | |
| 2gj8_A | 172 | MNME, tRNA modification GTPase TRME; G-domain dime | 99.6 | |
| 2ged_A | 193 | SR-beta, signal recognition particle receptor beta | 99.59 | |
| 1nrj_B | 218 | SR-beta, signal recognition particle receptor beta | 99.59 | |
| 2dyk_A | 161 | GTP-binding protein; GTPase, ribosome-binding prot | 99.55 | |
| 3dpu_A | 535 | RAB family protein; roccor, G-domain, COR, GTP-bin | 99.54 | |
| 1svi_A | 195 | GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro | 99.52 | |
| 2qu8_A | 228 | Putative nucleolar GTP-binding protein 1; GTPase, | 99.52 | |
| 2cxx_A | 190 | Probable GTP-binding protein ENGB; structural geno | 99.52 | |
| 3iby_A | 256 | Ferrous iron transport protein B; G protein, G dom | 99.49 | |
| 3a1s_A | 258 | Iron(II) transport protein B; FEOB, iron transport | 99.47 | |
| 3pqc_A | 195 | Probable GTP-binding protein ENGB; rossmann fold, | 99.42 | |
| 3i8s_A | 274 | Ferrous iron transport protein B; GTPase, GPCR, ir | 99.42 | |
| 3b1v_A | 272 | Ferrous iron uptake transporter protein B; G prote | 99.42 | |
| 3k53_A | 271 | Ferrous iron transport protein B; GTPase fold, hel | 99.41 | |
| 1mky_A | 439 | Probable GTP-binding protein ENGA; GTPase, DER, KH | 99.38 | |
| 3gee_A | 476 | MNME, tRNA modification GTPase MNME; G protein, cy | 99.38 | |
| 3iev_A | 308 | GTP-binding protein ERA; ERA, GTPase, KH domain, a | 99.36 | |
| 2xtp_A | 260 | GTPase IMAP family member 2; immune system, G prot | 99.36 | |
| 3lxx_A | 239 | GTPase IMAP family member 4; structural genomics c | 99.35 | |
| 3def_A | 262 | T7I23.11 protein; chloroplast, TOC33, GTPase, hydr | 99.35 | |
| 1wf3_A | 301 | GTP-binding protein; GTPase, riken structural geno | 99.33 | |
| 2hjg_A | 436 | GTP-binding protein ENGA; GTPase ENGA KH-domain, h | 99.32 | |
| 3qq5_A | 423 | Small GTP-binding protein; hydrogenase, H-cluster, | 99.31 | |
| 4fid_A | 340 | G protein alpha subunit; RAS-like domain, all-heli | 99.29 | |
| 3lxw_A | 247 | GTPase IMAP family member 1; immunity, structural | 99.28 | |
| 1h65_A | 270 | Chloroplast outer envelope protein OEP34; GTPase, | 99.28 | |
| 1xzp_A | 482 | Probable tRNA modification GTPase TRME; GTP-bindin | 99.28 | |
| 3ohm_A | 327 | Guanine nucleotide-binding protein G(Q) subunit A; | 99.26 | |
| 4dhe_A | 223 | Probable GTP-binding protein ENGB; melioidosis, RA | 99.25 | |
| 2hjg_A | 436 | GTP-binding protein ENGA; GTPase ENGA KH-domain, h | 99.24 | |
| 1jny_A | 435 | EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF- | 99.22 | |
| 3geh_A | 462 | MNME, tRNA modification GTPase MNME; G protein, U3 | 99.21 | |
| 4dcu_A | 456 | GTP-binding protein ENGA; GTPase, GDP, protein bin | 99.19 | |
| 4dcu_A | 456 | GTP-binding protein ENGA; GTPase, GDP, protein bin | 99.18 | |
| 2qag_A | 361 | Septin-2, protein NEDD5; cell cycle, cell division | 99.16 | |
| 2e87_A | 357 | Hypothetical protein PH1320; GTP-binding, GTPase, | 99.16 | |
| 3p26_A | 483 | Elongation factor 1 alpha-like protein; GTP/GDP bi | 99.15 | |
| 3izy_P | 537 | Translation initiation factor IF-2, mitochondrial; | 99.14 | |
| 3j2k_7 | 439 | ERF3, eukaryotic polypeptide chain release factor | 99.14 | |
| 1pui_A | 210 | ENGB, probable GTP-binding protein ENGB; structura | 99.13 | |
| 1lnz_A | 342 | SPO0B-associated GTP-binding protein; GTPase, OBG, | 99.13 | |
| 3t5d_A | 274 | Septin-7; GTP-binding protein, cytoskeleton, signa | 99.12 | |
| 3sjy_A | 403 | Translation initiation factor 2 subunit gamma; zin | 99.11 | |
| 1r5b_A | 467 | Eukaryotic peptide chain release factor GTP-bindi | 99.11 | |
| 1mky_A | 439 | Probable GTP-binding protein ENGA; GTPase, DER, KH | 99.11 | |
| 1g7s_A | 594 | Translation initiation factor IF2/EIF5B; translati | 99.11 | |
| 2c78_A | 405 | Elongation factor TU-A; hydrolase, GTPase, transla | 99.11 | |
| 2ohf_A | 396 | Protein OLA1, GTP-binding protein 9; ATPase, GTPas | 99.1 | |
| 1s0u_A | 408 | EIF-2-gamma, translation initiation factor 2 gamma | 99.1 | |
| 1wb1_A | 482 | Translation elongation factor SELB; selenocysteine | 99.1 | |
| 2qtf_A | 364 | Protein HFLX, GTP-binding protein; beta-alpha-barr | 99.09 | |
| 3tr5_A | 528 | RF-3, peptide chain release factor 3; protein synt | 99.08 | |
| 1jal_A | 363 | YCHF protein; nucleotide-binding fold, structural | 99.08 | |
| 3cb4_D | 599 | GTP-binding protein LEPA; GTPase, OB-fold, membran | 99.07 | |
| 1n0u_A | 842 | EF-2, elongation factor 2; G-protein, CIS-proline, | 99.07 | |
| 1d2e_A | 397 | Elongation factor TU (EF-TU); G-protein, beta-barr | 99.04 | |
| 1kk1_A | 410 | EIF2gamma; initiation of translation; HET: GNP; 1. | 99.04 | |
| 1zo1_I | 501 | IF2, translation initiation factor 2; E. coli, rib | 99.03 | |
| 1zun_B | 434 | Sulfate adenylate transferase, subunit 1/adenylyls | 99.02 | |
| 2h5e_A | 529 | Peptide chain release factor RF-3; beta barrel, tr | 99.01 | |
| 2ywe_A | 600 | GTP-binding protein LEPA; G domain, beta-barrel, f | 99.0 | |
| 3izq_1 | 611 | HBS1P, elongation factor 1 alpha-like protein; NO- | 99.0 | |
| 1f60_A | 458 | Elongation factor EEF1A; protein-protein complex, | 98.99 | |
| 1ega_A | 301 | Protein (GTP-binding protein ERA); GTPase, RNA-bin | 98.99 | |
| 1wxq_A | 397 | GTP-binding protein; structural genomics, riken st | 98.97 | |
| 1azs_C | 402 | GS-alpha; complex (lyase/hydrolase), hydrolase, si | 98.95 | |
| 2aka_B | 299 | Dynamin-1; fusion protein, GTPase domain, myosin, | 98.94 | |
| 1u0l_A | 301 | Probable GTPase ENGC; permutation, OB-fold, zinc-f | 98.91 | |
| 1dar_A | 691 | EF-G, elongation factor G; ribosomal translocase, | 98.9 | |
| 2elf_A | 370 | Protein translation elongation factor 1A; tRNA, py | 98.89 | |
| 2xtz_A | 354 | Guanine nucleotide-binding protein alpha-1 subuni; | 98.88 | |
| 2rdo_7 | 704 | EF-G, elongation factor G; elongation factor G, EF | 98.85 | |
| 3avx_A | 1289 | Elongation factor TS, elongation factor TU, linke | 98.83 | |
| 3mca_A | 592 | HBS1, elongation factor 1 alpha-like protein; prot | 98.83 | |
| 2xex_A | 693 | Elongation factor G; GTPase, translation, biosynth | 98.83 | |
| 2dy1_A | 665 | Elongation factor G; translocation, GTP complex, s | 98.82 | |
| 1cip_A | 353 | Protein (guanine nucleotide-binding protein alpha- | 98.82 | |
| 2j69_A | 695 | Bacterial dynamin-like protein; FZO, FZL, GTPase, | 98.78 | |
| 2qnr_A | 301 | Septin-2, protein NEDD5; structural genomics conso | 98.76 | |
| 1zcb_A | 362 | G alpha I/13; GTP-binding, lipoprotein, membrane, | 98.74 | |
| 2qag_C | 418 | Septin-7; cell cycle, cell division, GTP-binding, | 98.74 | |
| 1jwy_B | 315 | Dynamin A GTPase domain; dynamin, GTPase, GDP, myo | 98.73 | |
| 3t34_A | 360 | Dynamin-related protein 1A, linker, dynamin-relat | 98.72 | |
| 2dby_A | 368 | GTP-binding protein; GDP, structural genomics, NPP | 98.72 | |
| 2qpt_A | 550 | EH domain-containing protein-2; protein-nucleotide | 98.68 | |
| 2hf9_A | 226 | Probable hydrogenase nickel incorporation protein | 98.52 | |
| 2x2e_A | 353 | Dynamin-1; nitration, hydrolase, membrane fission, | 98.52 | |
| 1udx_A | 416 | The GTP-binding protein OBG; TGS domain, riken str | 98.48 | |
| 1ni3_A | 392 | YCHF GTPase, YCHF GTP-binding protein; structural | 98.45 | |
| 4a9a_A | 376 | Ribosome-interacting GTPase 1; DRG-DFRP complex, r | 98.15 | |
| 2wsm_A | 221 | Hydrogenase expression/formation protein (HYPB); m | 98.1 | |
| 3cnl_A | 262 | YLQF, putative uncharacterized protein; circular p | 98.07 | |
| 1bif_A | 469 | 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; | 97.89 | |
| 3p32_A | 355 | Probable GTPase RV1496/MT1543; structural genomics | 97.88 | |
| 1puj_A | 282 | YLQF, conserved hypothetical protein YLQF; structu | 97.73 | |
| 2www_A | 349 | Methylmalonic aciduria type A protein, mitochondri | 97.68 | |
| 3vqt_A | 548 | RF-3, peptide chain release factor 3; translation, | 97.67 | |
| 2p67_A | 341 | LAO/AO transport system kinase; ARGK, structural G | 97.35 | |
| 4fn5_A | 709 | EF-G 1, elongation factor G 1; translation, transl | 97.29 | |
| 3j25_A | 638 | Tetracycline resistance protein TETM; antibiotic r | 97.18 | |
| 1yrb_A | 262 | ATP(GTP)binding protein; GTPase, P-loop, rossman f | 97.15 | |
| 2qm8_A | 337 | GTPase/ATPase; G protein, G3E, metallochaperone, c | 96.97 | |
| 3ec1_A | 369 | YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase | 96.84 | |
| 2yv5_A | 302 | YJEQ protein; hydrolase, GTPase, permutation, stru | 96.68 | |
| 3zvr_A | 772 | Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito | 96.64 | |
| 3h2y_A | 368 | GTPase family protein; GTP-binding protein YQEH, p | 96.41 | |
| 1f5n_A | 592 | Interferon-induced guanylate-binding protein 1; GB | 96.16 | |
| 3l82_B | 227 | F-box only protein 4; TRFH domain, helix, GTPase d | 96.12 | |
| 2j37_W | 504 | Signal recognition particle 54 kDa protein (SRP54) | 96.05 | |
| 2qag_B | 427 | Septin-6, protein NEDD5; cell cycle, cell division | 95.81 | |
| 3sop_A | 270 | Neuronal-specific septin-3; hydrolase; HET: GDP; 2 | 95.69 | |
| 1ye8_A | 178 | Protein THEP1, hypothetical UPF0334 kinase-like pr | 95.64 | |
| 1kgd_A | 180 | CASK, peripheral plasma membrane CASK; maguk, guan | 95.56 | |
| 3l2o_B | 312 | F-box only protein 4; small G protein fold, UBL co | 95.34 | |
| 1lvg_A | 198 | Guanylate kinase, GMP kinase; transferase; HET: AD | 95.34 | |
| 1ex7_A | 186 | Guanylate kinase; substrate-induced FIT, domain mo | 95.31 | |
| 3a00_A | 186 | Guanylate kinase, GMP kinase; domain movement, dim | 95.06 | |
| 4gp7_A | 171 | Metallophosphoesterase; polynucleotide kinase phos | 95.03 | |
| 3tr0_A | 205 | Guanylate kinase, GMP kinase; purines, pyrimidines | 94.98 | |
| 3tau_A | 208 | Guanylate kinase, GMP kinase; structural genomics, | 94.83 | |
| 1zp6_A | 191 | Hypothetical protein ATU3015; alpha-beta protein., | 94.81 | |
| 1s96_A | 219 | Guanylate kinase, GMP kinase; E.coli, dimer, SAD, | 94.8 | |
| 1znw_A | 207 | Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans | 94.7 | |
| 1jbk_A | 195 | CLPB protein; beta barrel, chaperone; 1.80A {Esche | 94.69 | |
| 1z6g_A | 218 | Guanylate kinase; structural genomics, SGC, struct | 94.68 | |
| 3tif_A | 235 | Uncharacterized ABC transporter ATP-binding prote; | 94.67 | |
| 3ney_A | 197 | 55 kDa erythrocyte membrane protein; structural ge | 94.66 | |
| 2qor_A | 204 | Guanylate kinase; phosphotransferase, purine metab | 94.49 | |
| 3kb2_A | 173 | SPBC2 prophage-derived uncharacterized protein YOR | 94.46 | |
| 2pcj_A | 224 | ABC transporter, lipoprotein-releasing system ATP- | 94.41 | |
| 3lw7_A | 179 | Adenylate kinase related protein (ADKA-like); AMP, | 94.41 | |
| 3c8u_A | 208 | Fructokinase; YP_612366.1, putative fructose trans | 94.29 | |
| 2j41_A | 207 | Guanylate kinase; GMP, GMK, transferase, ATP-bindi | 94.27 | |
| 2jaq_A | 205 | Deoxyguanosine kinase; transferase, deoxyribonucle | 94.27 | |
| 1b0u_A | 262 | Histidine permease; ABC transporter, transport pro | 94.26 | |
| 3fb4_A | 216 | Adenylate kinase; psychrophIle, phosphotransferase | 94.26 | |
| 3dl0_A | 216 | Adenylate kinase; phosphotransferase, zinc coordin | 94.23 | |
| 1mv5_A | 243 | LMRA, multidrug resistance ABC transporter ATP-bin | 94.23 | |
| 1htw_A | 158 | HI0065; nucleotide-binding fold, structural genomi | 94.22 | |
| 2cbz_A | 237 | Multidrug resistance-associated protein 1; ABC pro | 94.22 | |
| 2ff7_A | 247 | Alpha-hemolysin translocation ATP-binding protein | 94.19 | |
| 1ly1_A | 181 | Polynucleotide kinase; PNK, phosphatase, transfera | 94.16 | |
| 2i3b_A | 189 | HCR-ntpase, human cancer-related ntpase; AAA, ross | 94.14 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 94.13 | |
| 3gfo_A | 275 | Cobalt import ATP-binding protein CBIO 1; structur | 94.09 | |
| 1g6h_A | 257 | High-affinity branched-chain amino acid transport | 94.07 | |
| 2cdn_A | 201 | Adenylate kinase; phosphoryl transfer, associative | 94.04 | |
| 2olj_A | 263 | Amino acid ABC transporter; ABC domain, ATPase, hy | 94.02 | |
| 1kag_A | 173 | SKI, shikimate kinase I; transferase, structural g | 94.02 | |
| 3vaa_A | 199 | Shikimate kinase, SK; structural genomics, center | 94.02 | |
| 1sgw_A | 214 | Putative ABC transporter; structural genomics, P p | 94.0 | |
| 1nks_A | 194 | Adenylate kinase; thermophilic, transferase; HET: | 93.97 | |
| 2bdt_A | 189 | BH3686; alpha-beta protein, structural genomics, P | 93.94 | |
| 1ji0_A | 240 | ABC transporter; ATP binding protein, structural g | 93.94 | |
| 2ihy_A | 279 | ABC transporter, ATP-binding protein; ATPase, ABC | 93.93 | |
| 2ehv_A | 251 | Hypothetical protein PH0186; KAIC, RECA ATPase, un | 93.93 | |
| 3q5d_A | 447 | Atlastin-1; G protein, GTPase, GDP/GTP binding, hy | 93.91 | |
| 4g1u_C | 266 | Hemin import ATP-binding protein HMUV; membrane tr | 93.86 | |
| 3t61_A | 202 | Gluconokinase; PSI-biology, structural genomics, p | 93.86 | |
| 2ixe_A | 271 | Antigen peptide transporter 1; ABC ATPase, hydrola | 93.86 | |
| 2ghi_A | 260 | Transport protein; multidrug resistance protein, M | 93.85 | |
| 1tq4_A | 413 | IIGP1, interferon-inducible GTPase; interferon gam | 93.83 | |
| 2p65_A | 187 | Hypothetical protein PF08_0063; CLPB, malaria, str | 93.82 | |
| 4a74_A | 231 | DNA repair and recombination protein RADA; hydrola | 93.8 | |
| 2bbw_A | 246 | Adenylate kinase 4, AK4; nucleotide kinase, nucleo | 93.79 | |
| 1vpl_A | 256 | ABC transporter, ATP-binding protein; TM0544, stru | 93.79 | |
| 4eun_A | 200 | Thermoresistant glucokinase; putative sugar kinase | 93.78 | |
| 1qhx_A | 178 | CPT, protein (chloramphenicol phosphotransferase); | 93.75 | |
| 2yz2_A | 266 | Putative ABC transporter ATP-binding protein TM_0; | 93.71 | |
| 1kht_A | 192 | Adenylate kinase; phosphotransferase, signaling pr | 93.7 | |
| 2pjz_A | 263 | Hypothetical protein ST1066; ATP binding protein, | 93.65 | |
| 3bos_A | 242 | Putative DNA replication factor; P-loop containing | 93.57 | |
| 2nq2_C | 253 | Hypothetical ABC transporter ATP-binding protein H | 93.57 | |
| 3trf_A | 185 | Shikimate kinase, SK; amino acid biosynthesis, tra | 93.57 | |
| 2chg_A | 226 | Replication factor C small subunit; DNA-binding pr | 93.54 | |
| 3lnc_A | 231 | Guanylate kinase, GMP kinase; ALS collaborative cr | 93.54 | |
| 1np6_A | 174 | Molybdopterin-guanine dinucleotide biosynthesis pr | 93.52 | |
| 2xtz_A | 354 | Guanine nucleotide-binding protein alpha-1 subuni; | 93.52 | |
| 1njg_A | 250 | DNA polymerase III subunit gamma; rossman-like fol | 93.51 | |
| 2if2_A | 204 | Dephospho-COA kinase; alpha-beta protein, structur | 93.47 | |
| 2w0m_A | 235 | SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus | 93.43 | |
| 1knq_A | 175 | Gluconate kinase; ALFA/beta structure, transferase | 93.41 | |
| 3cm0_A | 186 | Adenylate kinase; ATP-binding, cytoplasm, nucleoti | 93.37 | |
| 3fvq_A | 359 | Fe(3+) IONS import ATP-binding protein FBPC; nucle | 93.35 | |
| 1e4v_A | 214 | Adenylate kinase; transferase(phosphotransferase); | 93.35 | |
| 3sr0_A | 206 | Adenylate kinase; phosphoryl transfer analogue, AL | 93.27 | |
| 2plr_A | 213 | DTMP kinase, probable thymidylate kinase; TMP-bind | 93.26 | |
| 1z47_A | 355 | CYSA, putative ABC-transporter ATP-binding protein | 93.26 | |
| 3uie_A | 200 | Adenylyl-sulfate kinase 1, chloroplastic; rossmann | 93.24 | |
| 2it1_A | 362 | 362AA long hypothetical maltose/maltodextrin trans | 93.23 | |
| 3asz_A | 211 | Uridine kinase; cytidine phosphorylation, transfer | 93.23 | |
| 2yyz_A | 359 | Sugar ABC transporter, ATP-binding protein; sugar | 93.23 | |
| 2rhm_A | 193 | Putative kinase; P-loop containing nucleoside trip | 93.22 | |
| 3rlf_A | 381 | Maltose/maltodextrin import ATP-binding protein M; | 93.18 | |
| 3n70_A | 145 | Transport activator; sigma-54, ntpase, PSI, MCSG, | 93.15 | |
| 1g29_1 | 372 | MALK, maltose transport protein MALK; ATPase, acti | 93.14 | |
| 2pt5_A | 168 | Shikimate kinase, SK; aromatic amino acid biosynth | 93.14 | |
| 2onk_A | 240 | Molybdate/tungstate ABC transporter, ATP-binding p | 93.13 | |
| 1v43_A | 372 | Sugar-binding transport ATP-binding protein; ATPas | 93.12 | |
| 1cke_A | 227 | CK, MSSA, protein (cytidine monophosphate kinase); | 93.07 | |
| 2cvh_A | 220 | DNA repair and recombination protein RADB; filamen | 93.06 | |
| 3co5_A | 143 | Putative two-component system transcriptional RES | 92.99 | |
| 1aky_A | 220 | Adenylate kinase; ATP:AMP phosphotransferase, myok | 92.93 | |
| 1n0w_A | 243 | DNA repair protein RAD51 homolog 1; DNA repair, ho | 92.93 | |
| 3tlx_A | 243 | Adenylate kinase 2; structural genomics, structura | 92.92 | |
| 1lw7_A | 365 | Transcriptional regulator NADR; NMN, NMN adenylyl | 92.92 | |
| 1zcb_A | 362 | G alpha I/13; GTP-binding, lipoprotein, membrane, | 92.91 | |
| 2rcn_A | 358 | Probable GTPase ENGC; YJEQ, circularly permuted, G | 92.9 | |
| 2yvu_A | 186 | Probable adenylyl-sulfate kinase; transferase, str | 92.87 | |
| 1tev_A | 196 | UMP-CMP kinase; ploop, NMP binding region, LID reg | 92.86 | |
| 1rj9_A | 304 | FTSY, signal recognition protein; SRP-GTPase domai | 92.85 | |
| 2pze_A | 229 | Cystic fibrosis transmembrane conductance regulat; | 92.85 | |
| 2v54_A | 204 | DTMP kinase, thymidylate kinase; nucleotide biosyn | 92.82 | |
| 2kjq_A | 149 | DNAA-related protein; solution structure, NESG, st | 92.81 | |
| 3b85_A | 208 | Phosphate starvation-inducible protein; PHOH2, ATP | 92.81 | |
| 1jjv_A | 206 | Dephospho-COA kinase; P-loop nucleotide-binding fo | 92.77 | |
| 1ixz_A | 254 | ATP-dependent metalloprotease FTSH; AAA domain fol | 92.76 | |
| 1ukz_A | 203 | Uridylate kinase; transferase; HET: ADP AMP; 1.90A | 92.75 | |
| 2w58_A | 202 | DNAI, primosome component (helicase loader); ATP-b | 92.74 | |
| 2eyu_A | 261 | Twitching motility protein PILT; pilus retraction | 92.72 | |
| 2vp4_A | 230 | Deoxynucleoside kinase; ATP-binding, DNA synthesis | 92.71 | |
| 3nh6_A | 306 | ATP-binding cassette SUB-family B member 6, mitoc; | 92.69 | |
| 2qi9_C | 249 | Vitamin B12 import ATP-binding protein BTUD; inner | 92.68 | |
| 1u0l_A | 301 | Probable GTPase ENGC; permutation, OB-fold, zinc-f | 92.65 | |
| 1via_A | 175 | Shikimate kinase; structural genomics, transferase | 92.65 | |
| 1gvn_B | 287 | Zeta; postsegregational killing system, plasmid; 1 | 92.63 | |
| 4ido_A | 457 | Atlastin-1; GTPase, GTP/GDP binding, hydrolase; HE | 92.63 | |
| 3b9q_A | 302 | Chloroplast SRP receptor homolog, alpha subunit CP | 92.63 | |
| 1zd8_A | 227 | GTP:AMP phosphotransferase mitochondrial; ATP:AMP | 92.62 | |
| 2f1r_A | 171 | Molybdopterin-guanine dinucleotide biosynthesis pr | 92.62 | |
| 2d2e_A | 250 | SUFC protein; ABC-ATPase, SUF protein, 310-helix, | 92.62 | |
| 3iij_A | 180 | Coilin-interacting nuclear ATPase protein; alpha a | 92.6 | |
| 2zu0_C | 267 | Probable ATP-dependent transporter SUFC; iron-sulf | 92.58 | |
| 3d31_A | 348 | Sulfate/molybdate ABC transporter, ATP-binding pro | 92.57 | |
| 2xb4_A | 223 | Adenylate kinase; ATP-binding, nucleotide-binding, | 92.56 | |
| 2v9p_A | 305 | Replication protein E1; AAA+ molecular motor, DNA | 92.51 | |
| 2pbr_A | 195 | DTMP kinase, thymidylate kinase; transferase, nucl | 92.51 | |
| 1xjc_A | 169 | MOBB protein homolog; structural genomics, midwest | 92.5 | |
| 2z0h_A | 197 | DTMP kinase, thymidylate kinase; ATP-binding, nucl | 92.48 | |
| 1y63_A | 184 | LMAJ004144AAA protein; structural genomics, protei | 92.48 | |
| 3gd7_A | 390 | Fusion complex of cystic fibrosis transmembrane co | 92.47 | |
| 3tui_C | 366 | Methionine import ATP-binding protein METN; ABC-tr | 92.45 | |
| 3e70_C | 328 | DPA, signal recognition particle receptor; FTSY, S | 92.42 | |
| 2dr3_A | 247 | UPF0273 protein PH0284; RECA superfamily ATPase, h | 92.39 | |
| 2qen_A | 350 | Walker-type ATPase; unknown function; HET: ADP; 2. | 92.38 | |
| 2qt1_A | 207 | Nicotinamide riboside kinase 1; non-protein kinase | 92.33 | |
| 2yv5_A | 302 | YJEQ protein; hydrolase, GTPase, permutation, stru | 92.33 | |
| 1gtv_A | 214 | TMK, thymidylate kinase; transferase, transferase | 92.26 | |
| 1cr0_A | 296 | DNA primase/helicase; RECA-type protein fold, tran | 92.23 | |
| 1zak_A | 222 | Adenylate kinase; ATP:AMP-phosphotransferase, tran | 92.18 | |
| 1lv7_A | 257 | FTSH; alpha/beta domain, four helix bundle, hydrol | 92.14 | |
| 1cip_A | 353 | Protein (guanine nucleotide-binding protein alpha- | 92.11 | |
| 1ak2_A | 233 | Adenylate kinase isoenzyme-2; nucleoside monophosp | 92.07 | |
| 2bwj_A | 199 | Adenylate kinase 5; phosphoryl transfer reaction, | 92.04 | |
| 2fna_A | 357 | Conserved hypothetical protein; structural genomic | 92.03 | |
| 2x8a_A | 274 | Nuclear valosin-containing protein-like; nuclear p | 91.97 | |
| 2qz4_A | 262 | Paraplegin; AAA+, SPG7, protease, ADP, structural | 91.95 | |
| 1iy2_A | 278 | ATP-dependent metalloprotease FTSH; AAA domain fol | 91.94 | |
| 3be4_A | 217 | Adenylate kinase; malaria, cryptosporidium parvum | 91.93 | |
| 3h4m_A | 285 | Proteasome-activating nucleotidase; ATPase, PAN, A | 91.91 | |
| 3aez_A | 312 | Pantothenate kinase; transferase, homodimer, COA b | 91.91 | |
| 2c95_A | 196 | Adenylate kinase 1; transferase, AP4A, nucleotide | 91.91 | |
| 2wwf_A | 212 | Thymidilate kinase, putative; transferase, malaria | 91.89 | |
| 1oxx_K | 353 | GLCV, glucose, ABC transporter, ATP binding protei | 91.89 | |
| 1e6c_A | 173 | Shikimate kinase; phosphoryl transfer, ADP, shikim | 91.88 | |
| 1qf9_A | 194 | UMP/CMP kinase, protein (uridylmonophosphate/cytid | 91.83 | |
| 2qby_A | 386 | CDC6 homolog 1, cell division control protein 6 ho | 91.77 | |
| 1nn5_A | 215 | Similar to deoxythymidylate kinase (thymidylate K; | 91.77 | |
| 2ze6_A | 253 | Isopentenyl transferase; crown GALL tumor, cytokin | 91.75 | |
| 2r8r_A | 228 | Sensor protein; KDPD, PFAM02702, MCSG, structural | 91.72 | |
| 1uj2_A | 252 | Uridine-cytidine kinase 2; alpha/beta mononucleoti | 91.71 | |
| 2bbs_A | 290 | Cystic fibrosis transmembrane conductance regulato | 91.69 | |
| 2vli_A | 183 | Antibiotic resistance protein; transferase, tunica | 91.69 | |
| 2og2_A | 359 | Putative signal recognition particle receptor; nuc | 91.63 | |
| 3kta_A | 182 | Chromosome segregation protein SMC; structural mai | 91.59 | |
| 3a4m_A | 260 | L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m | 91.58 | |
| 1in4_A | 334 | RUVB, holliday junction DNA helicase RUVB; AAA+-cl | 91.51 | |
| 1rz3_A | 201 | Hypothetical protein rbstp0775; MCSG, structural g | 91.47 | |
| 1ofh_A | 310 | ATP-dependent HSL protease ATP-binding subunit HSL | 91.46 | |
| 3b9p_A | 297 | CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc | 91.43 | |
| 1uf9_A | 203 | TT1252 protein; P-loop, nucleotide binding domain, | 91.39 | |
| 3syl_A | 309 | Protein CBBX; photosynthesis, rubisco activase, AA | 91.38 | |
| 2zts_A | 251 | Putative uncharacterized protein PH0186; KAIC like | 91.34 | |
| 1nlf_A | 279 | Regulatory protein REPA; replicative DNA helicase | 91.32 | |
| 1odf_A | 290 | YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser | 91.31 | |
| 2jeo_A | 245 | Uridine-cytidine kinase 1; UCK, transferase, ATP-b | 91.27 | |
| 2p5t_B | 253 | PEZT; postsegregational killing system, phosphoryl | 91.24 | |
| 1t9h_A | 307 | YLOQ, probable GTPase ENGC; N-terminal beta-barrel | 91.23 | |
| 2yhs_A | 503 | FTSY, cell division protein FTSY; cell cycle, prot | 91.21 | |
| 2iyv_A | 184 | Shikimate kinase, SK; transferase, aromatic amino | 91.2 | |
| 2pez_A | 179 | Bifunctional 3'-phosphoadenosine 5'- phosphosulfat | 91.12 | |
| 1fnn_A | 389 | CDC6P, cell division control protein 6; ORC1, AAA | 91.08 | |
| 1l8q_A | 324 | Chromosomal replication initiator protein DNAA; AA | 91.04 | |
| 2qmh_A | 205 | HPR kinase/phosphorylase; V267F mutation, ATP-bind | 91.01 | |
| 1d2n_A | 272 | N-ethylmaleimide-sensitive fusion protein; hexamer | 90.94 | |
| 1m7g_A | 211 | Adenylylsulfate kinase; APS kinase, transferase, s | 90.92 | |
| 4eaq_A | 229 | DTMP kinase, thymidylate kinase; structural genomi | 90.74 | |
| 2v1u_A | 387 | Cell division control protein 6 homolog; DNA repli | 90.6 | |
| 3szr_A | 608 | Interferon-induced GTP-binding protein MX1; interf | 90.6 | |
| 2obl_A | 347 | ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O | 90.57 | |
| 1yqt_A | 538 | RNAse L inhibitor; ATP-binding cassette, ribosome | 90.56 | |
| 4a82_A | 578 | Cystic fibrosis transmembrane conductance regulat; | 90.56 | |
| 3t15_A | 293 | Ribulose bisphosphate carboxylase/oxygenase activ | 90.55 | |
| 2px0_A | 296 | Flagellar biosynthesis protein FLHF; SRP GTPase, f | 90.55 | |
| 3zvl_A | 416 | Bifunctional polynucleotide phosphatase/kinase; hy | 90.55 | |
| 1vht_A | 218 | Dephospho-COA kinase; structural genomics, transfe | 90.51 | |
| 1azs_C | 402 | GS-alpha; complex (lyase/hydrolase), hydrolase, si | 90.48 | |
| 2ewv_A | 372 | Twitching motility protein PILT; pilus retraction | 90.47 | |
| 1sq5_A | 308 | Pantothenate kinase; P-loop, transferase; HET: PAU | 90.47 | |
| 1z6t_A | 591 | APAF-1, apoptotic protease activating factor 1; ca | 90.44 | |
| 3jvv_A | 356 | Twitching mobility protein; hexameric P-loop ATPas | 90.44 | |
| 4e22_A | 252 | Cytidylate kinase; P-loop, CMP/ATP binding, transf | 90.43 | |
| 3b60_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 90.42 | |
| 2yl4_A | 595 | ATP-binding cassette SUB-family B member 10, mitoc | 90.42 | |
| 4fcw_A | 311 | Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 | 90.39 | |
| 1sxj_E | 354 | Activator 1 40 kDa subunit; clamp loader, processi | 90.39 | |
| 3b5x_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 90.34 | |
| 3umf_A | 217 | Adenylate kinase; rossmann fold, transferase; 2.05 | 90.33 | |
| 2gza_A | 361 | Type IV secretion system protein VIRB11; ATPase, h | 90.26 | |
| 3cf0_A | 301 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 90.2 | |
| 3uk6_A | 368 | RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding | 90.14 | |
| 2pt7_A | 330 | CAG-ALFA; ATPase, protein-protein complex, type IV | 90.07 | |
| 1sxj_D | 353 | Activator 1 41 kDa subunit; clamp loader, processi | 90.06 | |
| 3qf4_B | 598 | Uncharacterized ABC transporter ATP-binding prote | 90.05 | |
| 1vma_A | 306 | Cell division protein FTSY; TM0570, structural gen | 90.02 | |
| 2qby_B | 384 | CDC6 homolog 3, cell division control protein 6 ho | 90.0 | |
| 3pxg_A | 468 | Negative regulator of genetic competence CLPC/MEC; | 89.97 | |
| 1ltq_A | 301 | Polynucleotide kinase; phosphatase, alpha/beta, P- | 89.96 | |
| 3tqc_A | 321 | Pantothenate kinase; biosynthesis of cofactors, pr | 89.92 | |
| 3pfi_A | 338 | Holliday junction ATP-dependent DNA helicase RUVB; | 89.91 | |
| 1p5z_B | 263 | DCK, deoxycytidine kinase; nucleoside kinase, P-lo | 89.89 | |
| 1zuh_A | 168 | Shikimate kinase; alpha-beta protein, transferase; | 89.85 | |
| 1sxj_C | 340 | Activator 1 40 kDa subunit; clamp loader, processi | 89.83 | |
| 3qf4_A | 587 | ABC transporter, ATP-binding protein; multidrug tr | 89.78 | |
| 3nwj_A | 250 | ATSK2; P loop, shikimate, nucleoside monophosphate | 89.6 | |
| 2dpy_A | 438 | FLII, flagellum-specific ATP synthase; beta barrel | 89.56 | |
| 2bjv_A | 265 | PSP operon transcriptional activator; AAA, transcr | 89.43 | |
| 1xwi_A | 322 | SKD1 protein; VPS4B, AAA ATPase, protein transport | 89.42 | |
| 1nij_A | 318 | Hypothetical protein YJIA; structural genomics, P- | 89.42 | |
| 3eie_A | 322 | Vacuolar protein sorting-associated protein 4; AAA | 89.37 | |
| 2r62_A | 268 | Cell division protease FTSH homolog; ATPase domain | 89.2 | |
| 1hqc_A | 324 | RUVB; extended AAA-ATPase domain, complex with nuc | 89.04 | |
| 3a8t_A | 339 | Adenylate isopentenyltransferase; rossmann fold pr | 88.98 | |
| 2a5y_B | 549 | CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis | 88.95 | |
| 1um8_A | 376 | ATP-dependent CLP protease ATP-binding subunit CL; | 88.91 | |
| 3bk7_A | 607 | ABC transporter ATP-binding protein; ABC ATPase, i | 88.88 | |
| 3tqf_A | 181 | HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co | 88.75 | |
| 2f6r_A | 281 | COA synthase, bifunctional coenzyme A synthase; 18 | 88.68 | |
| 2npi_A | 460 | Protein CLP1; CLP1-PCF11 complex, ATP binding, ter | 88.67 | |
| 3ozx_A | 538 | RNAse L inhibitor; ATP binding cassette protein, h | 88.67 | |
| 1iqp_A | 327 | RFCS; clamp loader, extended AAA-ATPase domain, co | 88.65 | |
| 3j16_B | 608 | RLI1P; ribosome recycling, translation, eukarya, r | 88.6 | |
| 2qgz_A | 308 | Helicase loader, putative primosome component; str | 88.58 | |
| 1jr3_A | 373 | DNA polymerase III subunit gamma; processivity, pr | 88.55 | |
| 1w5s_A | 412 | Origin recognition complex subunit 2 ORC2; replica | 88.49 | |
| 1g8p_A | 350 | Magnesium-chelatase 38 kDa subunit; parallel beta | 88.47 | |
| 1p9r_A | 418 | General secretion pathway protein E; bacterial typ | 88.46 | |
| 3exa_A | 322 | TRNA delta(2)-isopentenylpyrophosphate transferase | 88.42 | |
| 1f2t_A | 149 | RAD50 ABC-ATPase; DNA double-strand break repair, | 88.39 | |
| 1pzn_A | 349 | RAD51, DNA repair and recombination protein RAD51, | 88.34 | |
| 3fwy_A | 314 | Light-independent protochlorophyllide reductase I | 88.29 | |
| 3d8b_A | 357 | Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s | 88.28 | |
| 1sxj_B | 323 | Activator 1 37 kDa subunit; clamp loader, processi | 88.28 | |
| 3r20_A | 233 | Cytidylate kinase; structural genomics, seattle st | 88.24 | |
| 1ojl_A | 304 | Transcriptional regulatory protein ZRAR; response | 88.22 | |
| 3bh0_A | 315 | DNAB-like replicative helicase; ATPase, replicatio | 88.13 | |
| 2qp9_X | 355 | Vacuolar protein sorting-associated protein 4; ATP | 88.12 | |
| 2v3c_C | 432 | SRP54, signal recognition 54 kDa protein; nucleoti | 88.09 | |
| 2chq_A | 319 | Replication factor C small subunit; DNA-binding pr | 88.05 | |
| 1q3t_A | 236 | Cytidylate kinase; nucleotide monophosphate kinase | 88.05 | |
| 2r44_A | 331 | Uncharacterized protein; putative ATPase, structur | 88.04 | |
| 3hws_A | 363 | ATP-dependent CLP protease ATP-binding subunit CL; | 87.89 | |
| 1tue_A | 212 | Replication protein E1; helicase, replication, E1E | 87.88 | |
| 3crm_A | 323 | TRNA delta(2)-isopentenylpyrophosphate transferase | 87.8 | |
| 3lda_A | 400 | DNA repair protein RAD51; DNA binding protein, ATP | 87.75 | |
| 2oap_1 | 511 | GSPE-2, type II secretion system protein; hexameri | 87.63 | |
| 3vfd_A | 389 | Spastin; ATPase, microtubule severing, hydrolase; | 87.52 | |
| 1svm_A | 377 | Large T antigen; AAA+ fold, viral protein; HET: AT | 87.49 | |
| 2orw_A | 184 | Thymidine kinase; TMTK, TP4A, transferase; HET: 4T | 87.44 | |
| 1c9k_A | 180 | COBU, adenosylcobinamide kinase; alpha/beta struct | 87.39 | |
| 3d3q_A | 340 | TRNA delta(2)-isopentenylpyrophosphate transferase | 87.37 | |
| 3foz_A | 316 | TRNA delta(2)-isopentenylpyrophosphate transferas; | 87.36 | |
| 3euj_A | 483 | Chromosome partition protein MUKB, linker; MUKB, M | 87.24 | |
| 4b4t_K | 428 | 26S protease regulatory subunit 6B homolog; hydrol | 87.23 | |
| 1zu4_A | 320 | FTSY; GTPase, signal recognition particle, SRP, re | 87.21 | |
| 1tf7_A | 525 | KAIC; homohexamer, hexamer, circadian clock protei | 87.09 | |
| 3ake_A | 208 | Cytidylate kinase; CMP kinase, CMP complex, open c | 86.97 | |
| 2z4s_A | 440 | Chromosomal replication initiator protein DNAA; AA | 86.97 | |
| 3pvs_A | 447 | Replication-associated recombination protein A; ma | 86.94 | |
| 3kl4_A | 433 | SRP54, signal recognition 54 kDa protein; signal r | 86.89 | |
| 3f9v_A | 595 | Minichromosome maintenance protein MCM; replicativ | 86.73 |
| >4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A* | Back alignment and structure |
|---|
Probab=99.94 E-value=1.5e-27 Score=194.54 Aligned_cols=98 Identities=21% Similarity=0.457 Sum_probs=83.2
Q ss_pred CCceeeEEEEECCCCCChhhHH-hhhcCccc-cccccceeeeEEEEEEECCeEEEEEEEeCCCCCCCCcchhhhccCCcE
Q 029430 96 SDLVSLKISLLGDCQIGKTSFV-KYVGNEQE-RSLQMAGLNLINKTLMVQGARIAFSIWDVGGDSRSFDHVPIACKDAVA 173 (193)
Q Consensus 96 ~~~~~~KivllGd~gvGKTSLl-r~~~~~f~-~~~~t~g~~~~~~~i~v~~~~v~l~iwD~~G~e~~~~~~~~~~~~a~~ 173 (193)
.+..+|||+|||++|||||||+ ||++++|. .+.||+|.++..+.+.+++..+.++||||+|||+|..+++.|++++++
T Consensus 9 ~P~k~~KivlvGd~~VGKTsLi~r~~~~~f~~~~~~Tig~d~~~k~~~~~~~~v~l~iwDtaGqe~~~~l~~~~~~~a~~ 88 (216)
T 4dkx_A 9 NPLRKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTIRLQLWDTAGLERFRSLIPSYIRDSAA 88 (216)
T ss_dssp ----CEEEEEECSTTSSHHHHHHHHHHSCCC----------CEEEEEECSSCEEEEEEECCSCTTTCGGGHHHHHTTCSE
T ss_pred CCCCcEEEEEECcCCcCHHHHHHHHHhCCCCCCcCCccceEEEEEEEEecceEEEEEEEECCCchhhhhHHHHHhccccE
Confidence 3456899999999999999999 99999999 889999999999999999999999999999999999999999999999
Q ss_pred EEEEEECCChhhHHHHHhcC
Q 029430 174 ILFMFDLTSRCTLNRFDHNQ 193 (193)
Q Consensus 174 illvyDit~~~Sf~~l~~W~ 193 (193)
+|+|||+++++||+++.+|+
T Consensus 89 ~ilv~di~~~~Sf~~i~~~~ 108 (216)
T 4dkx_A 89 AVVVYDITNVNSFQQTTKWI 108 (216)
T ss_dssp EEEEEETTCHHHHHTHHHHH
T ss_pred EEEEeecchhHHHHHHHHHH
Confidence 99999999999999999994
|
| >2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* | Back alignment and structure |
|---|
| >2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* | Back alignment and structure |
|---|
| >3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* | Back alignment and structure |
|---|
| >2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} | Back alignment and structure |
|---|
| >2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* | Back alignment and structure |
|---|
| >3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* | Back alignment and structure |
|---|
| >1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* | Back alignment and structure |
|---|
| >1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* | Back alignment and structure |
|---|
| >1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* | Back alignment and structure |
|---|
| >1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* | Back alignment and structure |
|---|
| >2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* | Back alignment and structure |
|---|
| >3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} | Back alignment and structure |
|---|
| >3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} | Back alignment and structure |
|---|
| >3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* | Back alignment and structure |
|---|
| >2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* | Back alignment and structure |
|---|
| >3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* | Back alignment and structure |
|---|
| >3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* | Back alignment and structure |
|---|
| >2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A | Back alignment and structure |
|---|
| >2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* | Back alignment and structure |
|---|
| >2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* | Back alignment and structure |
|---|
| >3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} | Back alignment and structure |
|---|
| >3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} | Back alignment and structure |
|---|
| >2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* | Back alignment and structure |
|---|
| >2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* | Back alignment and structure |
|---|
| >1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* | Back alignment and structure |
|---|
| >2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* | Back alignment and structure |
|---|
| >2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* | Back alignment and structure |
|---|
| >2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} SCOP: c.37.1.8 PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 4gmx_A* 4gpt_A* 4hat_A* 4hau_A* 4hav_A* 4haw_A* ... | Back alignment and structure |
|---|
| >1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A | Back alignment and structure |
|---|
| >1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* | Back alignment and structure |
|---|
| >2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* | Back alignment and structure |
|---|
| >4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* | Back alignment and structure |
|---|
| >1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* | Back alignment and structure |
|---|
| >1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* | Back alignment and structure |
|---|
| >1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* | Back alignment and structure |
|---|
| >3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* | Back alignment and structure |
|---|
| >1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... | Back alignment and structure |
|---|
| >3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* | Back alignment and structure |
|---|
| >3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* | Back alignment and structure |
|---|
| >2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* | Back alignment and structure |
|---|
| >2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... | Back alignment and structure |
|---|
| >2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* | Back alignment and structure |
|---|
| >3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C | Back alignment and structure |
|---|
| >4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} | Back alignment and structure |
|---|
| >2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* | Back alignment and structure |
|---|
| >1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* | Back alignment and structure |
|---|
| >1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* | Back alignment and structure |
|---|
| >1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* | Back alignment and structure |
|---|
| >3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C | Back alignment and structure |
|---|
| >2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} | Back alignment and structure |
|---|
| >1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* | Back alignment and structure |
|---|
| >2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} | Back alignment and structure |
|---|
| >1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... | Back alignment and structure |
|---|
| >1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* | Back alignment and structure |
|---|
| >4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* | Back alignment and structure |
|---|
| >2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* | Back alignment and structure |
|---|
| >1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* | Back alignment and structure |
|---|
| >3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* | Back alignment and structure |
|---|
| >2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* | Back alignment and structure |
|---|
| >2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* | Back alignment and structure |
|---|
| >2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* | Back alignment and structure |
|---|
| >1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* | Back alignment and structure |
|---|
| >2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} | Back alignment and structure |
|---|
| >2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... | Back alignment and structure |
|---|
| >3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* | Back alignment and structure |
|---|
| >2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} | Back alignment and structure |
|---|
| >1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* | Back alignment and structure |
|---|
| >1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3r7w_B Gtpase2, GTP-binding protein GTR2; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_B* | Back alignment and structure |
|---|
| >2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* | Back alignment and structure |
|---|
| >3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* | Back alignment and structure |
|---|
| >3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_A* | Back alignment and structure |
|---|
| >3c5h_A Glucocorticoid receptor DNA-binding factor 1; RAS, GTPase, glucorticoid receptor, structural genomics consortium, SGC, alternative splicing; HET: GNP; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 | Back alignment and structure |
|---|
| >2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* | Back alignment and structure |
|---|
| >2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A | Back alignment and structure |
|---|
| >2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} | Back alignment and structure |
|---|
| >1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* | Back alignment and structure |
|---|
| >2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} | Back alignment and structure |
|---|
| >3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A | Back alignment and structure |
|---|
| >3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A | Back alignment and structure |
|---|
| >3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* | Back alignment and structure |
|---|
| >3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* | Back alignment and structure |
|---|
| >3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 | Back alignment and structure |
|---|
| >3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* | Back alignment and structure |
|---|
| >3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* | Back alignment and structure |
|---|
| >2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A | Back alignment and structure |
|---|
| >3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* | Back alignment and structure |
|---|
| >1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 | Back alignment and structure |
|---|
| >2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} | Back alignment and structure |
|---|
| >4fid_A G protein alpha subunit; RAS-like domain, all-helical domain, GTP binding, nucleotide signaling protein, transducer, lipoprotein; HET: MLY MSE GDP; 2.62A {Entamoeba histolytica} | Back alignment and structure |
|---|
| >1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* | Back alignment and structure |
|---|
| >1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* | Back alignment and structure |
|---|
| >3ohm_A Guanine nucleotide-binding protein G(Q) subunit A; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Mus musculus} PDB: 2bcj_Q* 2rgn_A* 3ah8_A* | Back alignment and structure |
|---|
| >4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1jny_A EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF-1; GTPase, alpha/beta structure, protein biosynthesis, translation; HET: GDP; 1.80A {Sulfolobus solfataricus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1skq_A* 3agj_A* | Back alignment and structure |
|---|
| >3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} | Back alignment and structure |
|---|
| >4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* | Back alignment and structure |
|---|
| >4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* | Back alignment and structure |
|---|
| >2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A* | Back alignment and structure |
|---|
| >3izy_P Translation initiation factor IF-2, mitochondrial; E coli, RNA, ribosomal; 10.80A {Bos taurus} | Back alignment and structure |
|---|
| >3j2k_7 ERF3, eukaryotic polypeptide chain release factor 3; rabbit 80S ribosome, ribosome-translation complex; 17.00A {Oryctolagus cuniculus} | Back alignment and structure |
|---|
| >1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1lnz_A SPO0B-associated GTP-binding protein; GTPase, OBG, stringent factor, stress response, sporulation, large G-protein, structural genomics, PSI; HET: G4P; 2.60A {Bacillus subtilis} SCOP: b.117.1.1 c.37.1.8 | Back alignment and structure |
|---|
| >3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A* | Back alignment and structure |
|---|
| >3sjy_A Translation initiation factor 2 subunit gamma; zinc finger, initiate translation, tRNA binding, mRNA bindin binding; HET: GCP GDP; 2.00A {Sulfolobus solfataricus P2} PDB: 3pen_A* 3sjz_A* 2qn6_A* 2aho_A 2qmu_A* 2plf_A* 3v11_A* 3i1f_A* 3cw2_A 2pmd_A* 3p3m_A* 3qsy_A* | Back alignment and structure |
|---|
| >1r5b_A Eukaryotic peptide chain release factor GTP-bindi subunit; translation termination, peptide release, GTPase, translatio; 2.35A {Schizosaccharomyces pombe} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1r5n_A* 1r5o_A* 3e20_A | Back alignment and structure |
|---|
| >1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 | Back alignment and structure |
|---|
| >1g7s_A Translation initiation factor IF2/EIF5B; translational GTPase; HET: GDP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: b.43.3.1 b.43.3.1 c.20.1.1 c.37.1.8 PDB: 1g7r_A* 1g7t_A* | Back alignment and structure |
|---|
| >2c78_A Elongation factor TU-A; hydrolase, GTPase, translation elongation factor, protein synthesis, antibiotic, GTP-binding, nucleotide-binding; HET: GNP PUL; 1.4A {Thermus thermophilus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 2y0u_Z* 2y0w_Z* 2y0y_Z* 2y10_Z* 2y12_Z* 2y14_Z* 2y16_Z* 2y18_Z* 2wrn_Z* 2wrq_Z* 2c77_A* 1aip_A 1exm_A* 1ha3_A* 2xqd_Z* 3fic_Z* 4abr_Z* 1b23_P* 1ob5_A* 1ttt_A* ... | Back alignment and structure |
|---|
| >2ohf_A Protein OLA1, GTP-binding protein 9; ATPase, GTPase, P-loop, OBG-like, hydrolase; HET: ACP; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1s0u_A EIF-2-gamma, translation initiation factor 2 gamma subunit; GTPase, EF-1A, tRNA; 2.40A {Methanocaldococcus jannaschii} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 | Back alignment and structure |
|---|
| >1wb1_A Translation elongation factor SELB; selenocysteine, protein synthesis, selenium, ribosome; HET: GDP DXC; 3.0A {Methanococcus maripaludis} SCOP: b.43.3.1 b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1wb2_A* 1wb3_A* | Back alignment and structure |
|---|
| >2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A | Back alignment and structure |
|---|
| >3tr5_A RF-3, peptide chain release factor 3; protein synthesis, translation; HET: GDP; 2.11A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1jal_A YCHF protein; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; 2.40A {Haemophilus influenzae} SCOP: c.37.1.8 d.15.10.2 | Back alignment and structure |
|---|
| >3cb4_D GTP-binding protein LEPA; GTPase, OB-fold, membrane, nucleotide-binding, translation; 2.80A {Escherichia coli} PDB: 3deg_C* | Back alignment and structure |
|---|
| >1n0u_A EF-2, elongation factor 2; G-protein, CIS-proline, translation; HET: SO1; 2.12A {Saccharomyces cerevisiae} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1n0v_C 1s1h_T 2e1r_A* 2npf_A* 2p8w_T* 3dny_T 3b82_A* 1zm2_A* 1zm3_A* 1zm4_A* 1zm9_A* 2p8x_T* 2p8y_T* 2p8z_T* 2zit_A* 1u2r_A* 3b78_A* 3b8h_A* | Back alignment and structure |
|---|
| >1d2e_A Elongation factor TU (EF-TU); G-protein, beta-barrel, RNA binding protein; HET: GDP; 1.94A {Bos taurus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1xb2_A* 2hcj_A* 2hdn_A* | Back alignment and structure |
|---|
| >1kk1_A EIF2gamma; initiation of translation; HET: GNP; 1.80A {Pyrococcus abyssi} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1kjz_A* 1kk2_A* 1kk3_A* 1kk0_A* 2d74_A 2dcu_A* | Back alignment and structure |
|---|
| >1zo1_I IF2, translation initiation factor 2; E. coli, ribosome, initiation of protein synthesis, cryo-eletron microscopy, translation/RNA complex; 13.80A {Escherichia coli} | Back alignment and structure |
|---|
| >1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 | Back alignment and structure |
|---|
| >2h5e_A Peptide chain release factor RF-3; beta barrel, translation; HET: GDP; 2.80A {Escherichia coli} PDB: 2o0f_A 3sfs_W* 3zvo_Y* 3uoq_W* | Back alignment and structure |
|---|
| >2ywe_A GTP-binding protein LEPA; G domain, beta-barrel, ferredoxin-like domain, structural GE NPPSFA; 2.05A {Aquifex aeolicus} PDB: 2ywf_A* 2ywg_A* 2ywh_A* | Back alignment and structure |
|---|
| >3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1f60_A Elongation factor EEF1A; protein-protein complex, translation; 1.67A {Saccharomyces cerevisiae} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1g7c_A* 1ije_A* 1ijf_A* 2b7b_A* 2b7c_A | Back alignment and structure |
|---|
| >1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X | Back alignment and structure |
|---|
| >1wxq_A GTP-binding protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.60A {Pyrococcus horikoshii} SCOP: c.37.1.8 d.15.10.2 | Back alignment and structure |
|---|
| >1azs_C GS-alpha; complex (lyase/hydrolase), hydrolase, signal transducing protein, cyclase, effector enzyme; HET: GSP FKP; 2.30A {Bos taurus} SCOP: a.66.1.1 c.37.1.8 PDB: 1azt_A* 3c14_C* 3c15_C* 3c16_C* 1cjt_C* 1cjk_C* 1cju_C* 1cjv_C* 1tl7_C* 1cs4_C* 1u0h_C* 2gvd_C* 2gvz_C* 3e8a_C* 3g82_C* 3maa_C* 1cul_C* 3sn6_A* | Back alignment and structure |
|---|
| >2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* | Back alignment and structure |
|---|
| >1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 | Back alignment and structure |
|---|
| >1dar_A EF-G, elongation factor G; ribosomal translocase, translational GTPase; HET: GDP; 2.40A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 PDB: 1elo_A 1ktv_A 2om7_L* 2wri_Y* 2wrk_Y* 2xsy_Y* 2xuy_Y* 2j7k_A* 2efg_A* 1jqm_B 1efg_A* 1fnm_A* 1pn6_A 2bm1_A* 2bm0_A* 2bv3_A* 3izp_E 1zn0_B 1jqs_C 2bcw_C ... | Back alignment and structure |
|---|
| >2elf_A Protein translation elongation factor 1A; tRNA, pyrrolysine, structural genomics, NPPSFA; HET: CIT; 1.70A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >2xtz_A Guanine nucleotide-binding protein alpha-1 subuni; hydrolase, G-protein signaling, SELF-activation, RAS-like DO; HET: GSP; 2.34A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2rdo_7 EF-G, elongation factor G; elongation factor G, EF-G, RRF, GDPNP, 50S subunit, cryo-EM, REAL-space refinement, ribonucleoprotein; 9.10A {Escherichia coli} PDB: 3j0e_H | Back alignment and structure |
|---|
| >3avx_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase-RNA complex; HET: GH3; 2.41A {Escherichia coli O157} PDB: 3agq_A 3agp_A* 3avu_A 3avv_A 3avt_A* 3avw_A* 3avy_A* 3mmp_A* 3mmp_G* 1efu_B | Back alignment and structure |
|---|
| >3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2xex_A Elongation factor G; GTPase, translation, biosynthetic protein; 1.90A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* | Back alignment and structure |
|---|
| >1cip_A Protein (guanine nucleotide-binding protein alpha-1 subunit); GTPase, hydrolase; HET: GNP; 1.50A {Rattus norvegicus} SCOP: a.66.1.1 c.37.1.8 PDB: 1agr_A* 1bof_A* 1gdd_A* 1gfi_A* 1gia_A* 1gp2_A* 3ffa_A* 3ffb_A* 1gg2_A* 1git_A* 1svs_A* 1svk_A* 2zjz_A* 2zjy_A* 3ums_A* 2pz2_A* 2pz3_A* 1as0_A* 1as2_A* 1as3_A* ... | Back alignment and structure |
|---|
| >2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A* | Back alignment and structure |
|---|
| >2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* | Back alignment and structure |
|---|
| >1zcb_A G alpha I/13; GTP-binding, lipoprotein, membrane, transducer, signaling PR; HET: GDP; 2.00A {Mus musculus} SCOP: a.66.1.1 c.37.1.8 PDB: 3ab3_A* 3cx8_A* 3cx7_A* 3cx6_A* 1zca_A* | Back alignment and structure |
|---|
| >2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* | Back alignment and structure |
|---|
| >3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* | Back alignment and structure |
|---|
| >2dby_A GTP-binding protein; GDP, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: GDP; 1.76A {Thermus thermophilus} PDB: 2dwq_A | Back alignment and structure |
|---|
| >2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} | Back alignment and structure |
|---|
| >2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* | Back alignment and structure |
|---|
| >2x2e_A Dynamin-1; nitration, hydrolase, membrane fission, nucleotide-binding, endocytosis, motor protein; HET: GDP; 2.00A {Homo sapiens} PDB: 2x2f_A* 3zyc_A* 3zys_A | Back alignment and structure |
|---|
| >1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 | Back alignment and structure |
|---|
| >1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 | Back alignment and structure |
|---|
| >4a9a_A Ribosome-interacting GTPase 1; DRG-DFRP complex, ribosome binding GTPase; 2.67A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* | Back alignment and structure |
|---|
| >1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A | Back alignment and structure |
|---|
| >3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* | Back alignment and structure |
|---|
| >1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} | Back alignment and structure |
|---|
| >3vqt_A RF-3, peptide chain release factor 3; translation, GTPase; HET: GDP; 1.80A {Desulfovibrio vulgaris} PDB: 3vr1_A* | Back alignment and structure |
|---|
| >2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >4fn5_A EF-G 1, elongation factor G 1; translation, translation-antibiotic compl; HET: 0UO; 2.90A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3j25_A Tetracycline resistance protein TETM; antibiotic resistance, translation; HET: GCP; 7.20A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* | Back alignment and structure |
|---|
| >2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* | Back alignment and structure |
|---|
| >3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} | Back alignment and structure |
|---|
| >2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A | Back alignment and structure |
|---|
| >3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* | Back alignment and structure |
|---|
| >3l82_B F-box only protein 4; TRFH domain, helix, GTPase domain, acetylation, ADP- ribosylation, alternative splicing, cell cycle, cell division; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A | Back alignment and structure |
|---|
| >2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} | Back alignment and structure |
|---|
| >1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A | Back alignment and structure |
|---|
| >4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* | Back alignment and structure |
|---|
| >3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* | Back alignment and structure |
|---|
| >1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A | Back alignment and structure |
|---|
| >1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* | Back alignment and structure |
|---|
| >3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} | Back alignment and structure |
|---|
| >3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* | Back alignment and structure |
|---|
| >2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A | Back alignment and structure |
|---|
| >3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A | Back alignment and structure |
|---|
| >3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} | Back alignment and structure |
|---|
| >2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* | Back alignment and structure |
|---|
| >1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} | Back alignment and structure |
|---|
| >3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* | Back alignment and structure |
|---|
| >1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A | Back alignment and structure |
|---|
| >2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} | Back alignment and structure |
|---|
| >2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* | Back alignment and structure |
|---|
| >1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} | Back alignment and structure |
|---|
| >1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* | Back alignment and structure |
|---|
| >2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A | Back alignment and structure |
|---|
| >2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* | Back alignment and structure |
|---|
| >1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3q5d_A Atlastin-1; G protein, GTPase, GDP/GTP binding, hydrolase; HET: GDP; 2.70A {Homo sapiens} PDB: 3q5e_A* 3qnu_A* 3qof_A* | Back alignment and structure |
|---|
| >4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} | Back alignment and structure |
|---|
| >3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* | Back alignment and structure |
|---|
| >2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} | Back alignment and structure |
|---|
| >1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* | Back alignment and structure |
|---|
| >2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* | Back alignment and structure |
|---|
| >2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A | Back alignment and structure |
|---|
| >1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} | Back alignment and structure |
|---|
| >1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* | Back alignment and structure |
|---|
| >2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A | Back alignment and structure |
|---|
| >2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A | Back alignment and structure |
|---|
| >2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} | Back alignment and structure |
|---|
| >1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A | Back alignment and structure |
|---|
| >2xtz_A Guanine nucleotide-binding protein alpha-1 subuni; hydrolase, G-protein signaling, SELF-activation, RAS-like DO; HET: GSP; 2.34A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* | Back alignment and structure |
|---|
| >2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* | Back alignment and structure |
|---|
| >3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* | Back alignment and structure |
|---|
| >3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* | Back alignment and structure |
|---|
| >2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} | Back alignment and structure |
|---|
| >3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* | Back alignment and structure |
|---|
| >2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* | Back alignment and structure |
|---|
| >2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} | Back alignment and structure |
|---|
| >3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A | Back alignment and structure |
|---|
| >3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A | Back alignment and structure |
|---|
| >2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* | Back alignment and structure |
|---|
| >1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* | Back alignment and structure |
|---|
| >2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* | Back alignment and structure |
|---|
| >3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* | Back alignment and structure |
|---|
| >1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 | Back alignment and structure |
|---|
| >1zcb_A G alpha I/13; GTP-binding, lipoprotein, membrane, transducer, signaling PR; HET: GDP; 2.00A {Mus musculus} SCOP: a.66.1.1 c.37.1.8 PDB: 3ab3_A* 3cx8_A* 3cx7_A* 3cx6_A* 1zca_A* | Back alignment and structure |
|---|
| >2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V | Back alignment and structure |
|---|
| >2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* | Back alignment and structure |
|---|
| >2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A | Back alignment and structure |
|---|
| >2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* | Back alignment and structure |
|---|
| >2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* | Back alignment and structure |
|---|
| >1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* | Back alignment and structure |
|---|
| >2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* | Back alignment and structure |
|---|
| >3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* | Back alignment and structure |
|---|
| >2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C | Back alignment and structure |
|---|
| >1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 | Back alignment and structure |
|---|
| >1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* | Back alignment and structure |
|---|
| >4ido_A Atlastin-1; GTPase, GTP/GDP binding, hydrolase; HET: GDP; 2.09A {Homo sapiens} PDB: 4idn_A* 3q5d_A* 3q5e_A* 4idq_A* 4idp_A* 3qnu_A* 3qof_A* | Back alignment and structure |
|---|
| >3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* | Back alignment and structure |
|---|
| >2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* | Back alignment and structure |
|---|
| >3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A | Back alignment and structure |
|---|
| >2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A | Back alignment and structure |
|---|
| >3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 | Back alignment and structure |
|---|
| >2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* | Back alignment and structure |
|---|
| >2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* | Back alignment and structure |
|---|
| >2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C | Back alignment and structure |
|---|
| >3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* | Back alignment and structure |
|---|
| >2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} | Back alignment and structure |
|---|
| >2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* | Back alignment and structure |
|---|
| >2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* | Back alignment and structure |
|---|
| >1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* | Back alignment and structure |
|---|
| >1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 | Back alignment and structure |
|---|
| >1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >1cip_A Protein (guanine nucleotide-binding protein alpha-1 subunit); GTPase, hydrolase; HET: GNP; 1.50A {Rattus norvegicus} SCOP: a.66.1.1 c.37.1.8 PDB: 1agr_A* 1bof_A* 1gdd_A* 1gfi_A* 1gia_A* 1gp2_A* 3ffa_A* 3ffb_A* 1gg2_A* 1git_A* 1svs_A* 1svk_A* 2zjz_A* 2zjy_A* 3ums_A* 2pz2_A* 2pz3_A* 1as0_A* 1as2_A* 1as3_A* ... | Back alignment and structure |
|---|
| >1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* | Back alignment and structure |
|---|
| >2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} | Back alignment and structure |
|---|
| >2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} | Back alignment and structure |
|---|
| >1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* | Back alignment and structure |
|---|
| >2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A | Back alignment and structure |
|---|
| >2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* | Back alignment and structure |
|---|
| >1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* | Back alignment and structure |
|---|
| >1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* | Back alignment and structure |
|---|
| >1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* | Back alignment and structure |
|---|
| >2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* | Back alignment and structure |
|---|
| >2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A | Back alignment and structure |
|---|
| >2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* | Back alignment and structure |
|---|
| >2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* | Back alignment and structure |
|---|
| >2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* | Back alignment and structure |
|---|
| >3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* | Back alignment and structure |
|---|
| >1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* | Back alignment and structure |
|---|
| >1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* | Back alignment and structure |
|---|
| >3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* | Back alignment and structure |
|---|
| >2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A | Back alignment and structure |
|---|
| >1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* | Back alignment and structure |
|---|
| >2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 | Back alignment and structure |
|---|
| >2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A | Back alignment and structure |
|---|
| >2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* | Back alignment and structure |
|---|
| >2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* | Back alignment and structure |
|---|
| >1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* | Back alignment and structure |
|---|
| >2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* | Back alignment and structure |
|---|
| >1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* | Back alignment and structure |
|---|
| >1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* | Back alignment and structure |
|---|
| >4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A | Back alignment and structure |
|---|
| >2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B | Back alignment and structure |
|---|
| >2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* | Back alignment and structure |
|---|
| >1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A | Back alignment and structure |
|---|
| >3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A | Back alignment and structure |
|---|
| >2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* | Back alignment and structure |
|---|
| >3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* | Back alignment and structure |
|---|
| >1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A | Back alignment and structure |
|---|
| >1azs_C GS-alpha; complex (lyase/hydrolase), hydrolase, signal transducing protein, cyclase, effector enzyme; HET: GSP FKP; 2.30A {Bos taurus} SCOP: a.66.1.1 c.37.1.8 PDB: 1azt_A* 3c14_C* 3c15_C* 3c16_C* 1cjt_C* 1cjk_C* 1cju_C* 1cjv_C* 1tl7_C* 1cs4_C* 1u0h_C* 2gvd_C* 2gvz_C* 3e8a_C* 3g82_C* 3maa_C* 1cul_C* 3sn6_A* | Back alignment and structure |
|---|
| >2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* | Back alignment and structure |
|---|
| >1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* | Back alignment and structure |
|---|
| >1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} | Back alignment and structure |
|---|
| >3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* | Back alignment and structure |
|---|
| >4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} | Back alignment and structure |
|---|
| >3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A | Back alignment and structure |
|---|
| >4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* | Back alignment and structure |
|---|
| >1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} | Back alignment and structure |
|---|
| >3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} | Back alignment and structure |
|---|
| >2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} | Back alignment and structure |
|---|
| >3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* | Back alignment and structure |
|---|
| >2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A | Back alignment and structure |
|---|
| >1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 | Back alignment and structure |
|---|
| >2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A | Back alignment and structure |
|---|
| >3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... | Back alignment and structure |
|---|
| >1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* | Back alignment and structure |
|---|
| >1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* | Back alignment and structure |
|---|
| >1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 | Back alignment and structure |
|---|
| >3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C | Back alignment and structure |
|---|
| >2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* | Back alignment and structure |
|---|
| >1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* | Back alignment and structure |
|---|
| >3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} | Back alignment and structure |
|---|
| >2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* | Back alignment and structure |
|---|
| >1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* | Back alignment and structure |
|---|
| >3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} | Back alignment and structure |
|---|
| >1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* | Back alignment and structure |
|---|
| >1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* | Back alignment and structure |
|---|
| >1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G | Back alignment and structure |
|---|
| >1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* | Back alignment and structure |
|---|
| >3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A | Back alignment and structure |
|---|
| >1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* | Back alignment and structure |
|---|
| >1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 | Back alignment and structure |
|---|
| >3fwy_A Light-independent protochlorophyllide reductase I ATP-binding protein; BCHL, electron donor, DPOR, Fe protein, nitrogenase; HET: ADP; 1.63A {Rhodobacter sphaeroides 2} | Back alignment and structure |
|---|
| >3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* | Back alignment and structure |
|---|
| >1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* | Back alignment and structure |
|---|
| >2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B | Back alignment and structure |
|---|
| >2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A | Back alignment and structure |
|---|
| >1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} | Back alignment and structure |
|---|
| >3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A | Back alignment and structure |
|---|
| >1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A | Back alignment and structure |
|---|
| >3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* | Back alignment and structure |
|---|
| >2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 | Back alignment and structure |
|---|
| >3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A | Back alignment and structure |
|---|
| >2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* | Back alignment and structure |
|---|
| >1c9k_A COBU, adenosylcobinamide kinase; alpha/beta structure rossmann fold P-loop, transferase; HET: 5GP; 2.20A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1cbu_A | Back alignment and structure |
|---|
| >3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} | Back alignment and structure |
|---|
| >3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A | Back alignment and structure |
|---|
| >3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* | Back alignment and structure |
|---|
| >4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A | Back alignment and structure |
|---|
| >1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* | Back alignment and structure |
|---|
| >3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* | Back alignment and structure |
|---|
| >2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* | Back alignment and structure |
|---|
| >3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} | Back alignment and structure |
|---|
| >3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A | Back alignment and structure |
|---|
| >3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 193 | ||||
| d2fu5c1 | 173 | c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [Ta | 6e-13 | |
| d1g16a_ | 166 | c.37.1.8 (A:) Rab-related protein Sec4 {Baker's ye | 6e-11 | |
| d1x3sa1 | 177 | c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [Ta | 5e-10 | |
| d2bcgy1 | 194 | c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Sac | 6e-10 | |
| d2ew1a1 | 171 | c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [Ta | 7e-10 | |
| d2g6ba1 | 170 | c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [T | 1e-09 | |
| d3raba_ | 169 | c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxI | 3e-09 | |
| d2bmea1 | 174 | c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [Ta | 2e-07 | |
| d1z0fa1 | 166 | c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [Ta | 3e-07 | |
| d1z08a1 | 167 | c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [T | 4e-07 | |
| d2f9la1 | 175 | c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [T | 3e-06 | |
| d1vg8a_ | 184 | c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId | 6e-06 | |
| d1r2qa_ | 170 | c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: | 1e-05 | |
| d2fn4a1 | 173 | c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [T | 1e-05 | |
| d1ek0a_ | 170 | c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces | 4e-05 | |
| d1z2aa1 | 164 | c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [Ta | 4e-05 | |
| d2f7sa1 | 186 | c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [T | 1e-04 | |
| d1x1ra1 | 169 | c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRa | 1e-04 | |
| d1e0sa_ | 173 | c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo | 1e-04 | |
| d2a5ja1 | 173 | c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [Ta | 2e-04 | |
| d1r8sa_ | 160 | c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo | 2e-04 | |
| d1moza_ | 182 | c.37.1.8 (A:) ADP-ribosylation factor {Baker's yea | 4e-04 | |
| d1ky3a_ | 175 | c.37.1.8 (A:) Rab-related protein ypt7p {Baker's y | 4e-04 | |
| d1yzqa1 | 164 | c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [Ta | 7e-04 | |
| d1wmsa_ | 174 | c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: | 8e-04 | |
| d2erya1 | 171 | c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [ | 0.001 | |
| d1xtqa1 | 167 | c.37.1.8 (A:3-169) GTP-binding protein RheB {Human | 0.002 | |
| d1zj6a1 | 177 | c.37.1.8 (A:2-178) ADP-ribosylation factor {Human | 0.003 | |
| d1ctqa_ | 166 | c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapi | 0.003 | |
| d1m7ba_ | 179 | c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [T | 0.003 | |
| d1kaoa_ | 167 | c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: | 0.004 |
| >d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Length = 173 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: G proteins domain: Rab8a species: Mouse (Mus musculus) [TaxId: 10090]
Score = 61.7 bits (149), Expect = 6e-13
Identities = 21/94 (22%), Positives = 44/94 (46%), Gaps = 2/94 (2%)
Query: 101 LKISLLGDCQIGKTSFV-KYVGNE-QERSLQMAGLNLINKTLMVQGARIAFSIWDVGGDS 158
K+ L+GD +GKT + ++ + + G++ +T+ + G RI IWD G
Sbjct: 7 FKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQE 66
Query: 159 RSFDHVPIACKDAVAILFMFDLTSRCTLNRFDHN 192
R + A+ I+ ++D+T+ + + +
Sbjct: 67 RFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNW 100
|
| >d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 166 | Back information, alignment and structure |
|---|
| >d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Length = 177 | Back information, alignment and structure |
|---|
| >d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 194 | Back information, alignment and structure |
|---|
| >d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Length = 171 | Back information, alignment and structure |
|---|
| >d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Length = 170 | Back information, alignment and structure |
|---|
| >d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 169 | Back information, alignment and structure |
|---|
| >d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Length = 174 | Back information, alignment and structure |
|---|
| >d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Length = 166 | Back information, alignment and structure |
|---|
| >d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Length = 167 | Back information, alignment and structure |
|---|
| >d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Length = 175 | Back information, alignment and structure |
|---|
| >d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 184 | Back information, alignment and structure |
|---|
| >d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Length = 170 | Back information, alignment and structure |
|---|
| >d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Length = 173 | Back information, alignment and structure |
|---|
| >d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 170 | Back information, alignment and structure |
|---|
| >d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Length = 164 | Back information, alignment and structure |
|---|
| >d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Length = 186 | Back information, alignment and structure |
|---|
| >d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Length = 169 | Back information, alignment and structure |
|---|
| >d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Length = 173 | Back information, alignment and structure |
|---|
| >d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Length = 173 | Back information, alignment and structure |
|---|
| >d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Length = 160 | Back information, alignment and structure |
|---|
| >d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Length = 182 | Back information, alignment and structure |
|---|
| >d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 175 | Back information, alignment and structure |
|---|
| >d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Length = 164 | Back information, alignment and structure |
|---|
| >d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Length = 174 | Back information, alignment and structure |
|---|
| >d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Length = 171 | Back information, alignment and structure |
|---|
| >d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Length = 167 | Back information, alignment and structure |
|---|
| >d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Length = 177 | Back information, alignment and structure |
|---|
| >d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Length = 166 | Back information, alignment and structure |
|---|
| >d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Length = 179 | Back information, alignment and structure |
|---|
| >d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Length = 167 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 193 | |||
| d1z08a1 | 167 | Rab21 {Human (Homo sapiens) [TaxId: 9606]} | 99.9 | |
| d1i2ma_ | 170 | Ran {Human (Homo sapiens) [TaxId: 9606]} | 99.9 | |
| d2ngra_ | 191 | CDC42 {Human (Homo sapiens) [TaxId: 9606]} | 99.9 | |
| d1ek0a_ | 170 | Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T | 99.9 | |
| d2fn4a1 | 173 | r-Ras {Human (Homo sapiens) [TaxId: 9606]} | 99.9 | |
| d2atxa1 | 185 | RhoQ {Human (Homo sapiens) [TaxId: 9606]} | 99.9 | |
| d1kmqa_ | 177 | RhoA {Human (Homo sapiens) [TaxId: 9606]} | 99.9 | |
| d1g16a_ | 166 | Rab-related protein Sec4 {Baker's yeast (Saccharom | 99.89 | |
| d1c1ya_ | 167 | Rap1A {Human (Homo sapiens) [TaxId: 9606]} | 99.89 | |
| d1xtqa1 | 167 | GTP-binding protein RheB {Human (Homo sapiens) [Ta | 99.89 | |
| d2gjsa1 | 168 | Rad {Human (Homo sapiens) [TaxId: 9606]} | 99.89 | |
| d1x1ra1 | 169 | Ras-related protein M-Ras (XRas) {Mouse (Mus muscu | 99.89 | |
| d1mh1a_ | 183 | Rac {Human (Homo sapiens) [TaxId: 9606]} | 99.89 | |
| d2ew1a1 | 171 | Rab30 {Human (Homo sapiens) [TaxId: 9606]} | 99.89 | |
| d1z0fa1 | 166 | Rab14 {Human (Homo sapiens) [TaxId: 9606]} | 99.89 | |
| d2fu5c1 | 173 | Rab8a {Mouse (Mus musculus) [TaxId: 10090]} | 99.89 | |
| d2g6ba1 | 170 | Rab26 {Human (Homo sapiens) [TaxId: 9606]} | 99.88 | |
| d1z2aa1 | 164 | Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | 99.88 | |
| d3raba_ | 169 | Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | 99.88 | |
| d1yzqa1 | 164 | Rab6 {Human (Homo sapiens) [TaxId: 9606]} | 99.88 | |
| d1z0ja1 | 167 | Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | 99.88 | |
| d2erxa1 | 171 | di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 99.88 | |
| d2bcgy1 | 194 | GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi | 99.88 | |
| d1m7ba_ | 179 | RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} | 99.88 | |
| d1r2qa_ | 170 | Rab5a {Human (Homo sapiens) [TaxId: 9606]} | 99.88 | |
| d1u8za_ | 168 | Ras-related protein RalA {Cotton-top tamarin (Sagu | 99.88 | |
| d1kaoa_ | 167 | Rap2a {Human (Homo sapiens) [TaxId: 9606]} | 99.87 | |
| d2atva1 | 168 | Ras-like estrogen-regulated growth inhibitor, RERG | 99.87 | |
| d2erya1 | 171 | r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 99.87 | |
| d1x3sa1 | 177 | Rab18 {Human (Homo sapiens) [TaxId: 9606]} | 99.87 | |
| d2bmja1 | 175 | Centaurin gamma 1, G domain {Human (Homo sapiens) | 99.87 | |
| d2f9la1 | 175 | Rab11b {Human (Homo sapiens) [TaxId: 9606]} | 99.86 | |
| d2a5ja1 | 173 | Rab2b {Human (Homo sapiens) [TaxId: 9606]} | 99.86 | |
| d2bmea1 | 174 | Rab4a {Human (Homo sapiens) [TaxId: 9606]} | 99.86 | |
| d1ctqa_ | 166 | cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 | 99.84 | |
| d2f7sa1 | 186 | Rab27b {Human (Homo sapiens) [TaxId: 9606]} | 99.84 | |
| d2g3ya1 | 172 | GTP-binding protein GEM {Human (Homo sapiens) [Tax | 99.83 | |
| d1z06a1 | 165 | Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | 99.83 | |
| d1vg8a_ | 184 | Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | 99.82 | |
| d1wmsa_ | 174 | Rab9a {Human (Homo sapiens) [TaxId: 9606]} | 99.82 | |
| d1ky3a_ | 175 | Rab-related protein ypt7p {Baker's yeast (Saccharo | 99.81 | |
| d1zd9a1 | 164 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 99.81 | |
| d1fzqa_ | 176 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 99.79 | |
| d1svsa1 | 195 | Transducin (alpha subunit) {Rat (Rattus norvegicus | 99.78 | |
| d1moza_ | 182 | ADP-ribosylation factor {Baker's yeast (Saccharomy | 99.77 | |
| d1ksha_ | 165 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 99.77 | |
| d1e0sa_ | 173 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 99.76 | |
| d2bcjq2 | 200 | Transducin (alpha subunit) {Mouse (Mus musculus) [ | 99.75 | |
| d1zcba2 | 200 | Transducin (alpha subunit) {Mouse (Mus musculus) [ | 99.67 | |
| d1r8sa_ | 160 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 99.66 | |
| d1azta2 | 221 | Transducin (alpha subunit) {Cow (Bos taurus) [TaxI | 99.61 | |
| d2qtvb1 | 166 | SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 99.55 | |
| d1zj6a1 | 177 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 99.54 | |
| d1upta_ | 169 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 99.5 | |
| d2fh5b1 | 207 | Signal recognition particle receptor beta-subunit | 99.48 | |
| d1f6ba_ | 186 | SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: | 99.47 | |
| d2gj8a1 | 161 | Probable tRNA modification GTPase TrmE (MnmE), G d | 99.25 | |
| d1wf3a1 | 178 | GTPase Era, N-terminal domain {Thermus thermophilu | 99.2 | |
| d1xzpa2 | 160 | TrmE GTPase domain {Thermotoga maritima [TaxId: 23 | 99.15 | |
| d1nrjb_ | 209 | Signal recognition particle receptor beta-subunit | 99.11 | |
| d1udxa2 | 180 | Obg GTP-binding protein middle domain {Thermus the | 98.82 | |
| d1mkya2 | 186 | Probable GTPase Der, N-terminal and middle domains | 98.78 | |
| d1mkya1 | 171 | Probable GTPase Der, N-terminal and middle domains | 98.71 | |
| d2cxxa1 | 184 | GTP-binding protein engB {Pyrococcus horikoshii [T | 98.64 | |
| d1wb1a4 | 179 | Elongation factor SelB, N-terminal domain {Methano | 98.56 | |
| d2c78a3 | 204 | Elongation factor Tu (EF-Tu), N-terminal (G) domai | 98.55 | |
| d1g7sa4 | 227 | Initiation factor IF2/eIF5b, N-terminal (G) domain | 98.49 | |
| d1lnza2 | 185 | Obg GTP-binding protein middle domain {Bacillus su | 98.39 | |
| d1h65a_ | 257 | Chloroplast protein translocon GTPase Toc34 {Garde | 98.31 | |
| d1d2ea3 | 196 | Elongation factor Tu (EF-Tu), N-terminal (G) domai | 98.3 | |
| d1egaa1 | 179 | GTPase Era, N-terminal domain {Escherichia coli [T | 98.28 | |
| d2dy1a2 | 267 | Elongation factor G (EF-G), N-terminal (G) domain | 98.12 | |
| d1n0ua2 | 341 | Elongation factor 2 (eEF-2), N-terminal (G) domain | 98.06 | |
| d2bv3a2 | 276 | Elongation factor G (EF-G), N-terminal (G) domain | 98.05 | |
| d1tq4a_ | 400 | Interferon-inducible GTPase {Mouse (Mus musculus) | 98.04 | |
| d1jnya3 | 224 | Elongation factor eEF-1alpha, N-terminal (G) domai | 98.04 | |
| d1svia_ | 195 | Probable GTPase EngB {Bacillus subtilis [TaxId: 14 | 98.03 | |
| d1zunb3 | 222 | Sulfate adenylate transferase subunit cysN/C, EF-T | 98.0 | |
| d1kk1a3 | 195 | Initiation factor eIF2 gamma subunit, N-terminal ( | 97.93 | |
| d1wxqa1 | 319 | GTP-binding protein PH0525 {Pyrococcus horikoshii | 97.93 | |
| d1f60a3 | 239 | Elongation factor eEF-1alpha, N-terminal (G) domai | 97.91 | |
| d1puia_ | 188 | Probable GTPase EngB {Escherichia coli [TaxId: 562 | 97.79 | |
| d2qn6a3 | 205 | Initiation factor eIF2 gamma subunit, N-terminal ( | 97.69 | |
| d1r5ba3 | 245 | Eukaryotic peptide chain release factor ERF2, G do | 97.62 | |
| d1jala1 | 278 | YchF GTP-binding protein N-terminal domain {Haemop | 97.59 | |
| d1ni3a1 | 296 | YchF GTP-binding protein N-terminal domain {Fissio | 97.54 | |
| d1puja_ | 273 | Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 | 97.43 | |
| d1ye8a1 | 178 | Hypothetical kinase-like protein Aq_1292 {Aquifex | 96.87 | |
| d1u0la2 | 225 | Probable GTPase EngC (YjeQ), C-terminal domain {Th | 96.62 | |
| d1lw7a2 | 192 | Transcriptional regulator NadR, ribosylnicotinamid | 96.56 | |
| d2akab1 | 299 | Dynamin G domain {Rat (Rattus norvegicus) [TaxId: | 96.52 | |
| d1y63a_ | 174 | Probable kinase LmjF30.1890 {Leishmania major [Tax | 96.26 | |
| d1rkba_ | 173 | Adenylate kinase {Human (Homo sapiens), isoenzyme | 96.22 | |
| d1np6a_ | 170 | Molybdopterin-guanine dinucleotide biosynthesis pr | 96.02 | |
| d2i3ba1 | 189 | Cancer-related NTPase, C1orf57 {Human (Homo sapien | 95.84 | |
| d2pmka1 | 241 | Haemolysin B ATP-binding protein {Escherichia coli | 95.82 | |
| d1ly1a_ | 152 | Polynucleotide kinase, kinase domain {Bacteriophag | 95.78 | |
| d1t9ha2 | 231 | Probable GTPase EngC (YjeQ), C-terminal domain {Ba | 95.77 | |
| d1kaga_ | 169 | Shikimate kinase (AroK) {Escherichia coli [TaxId: | 95.76 | |
| d1zina1 | 182 | Adenylate kinase {Bacillus stearothermophilus [Tax | 95.73 | |
| d1xjca_ | 165 | Molybdopterin-guanine dinucleotide biosynthesis pr | 95.69 | |
| d2ak3a1 | 189 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 95.66 | |
| d1akya1 | 180 | Adenylate kinase {Baker's yeast (Saccharomyces cer | 95.65 | |
| d1ak2a1 | 190 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 95.61 | |
| d2cdna1 | 181 | Adenylate kinase {Mycobacterium tuberculosis [TaxI | 95.61 | |
| d1jj7a_ | 251 | Peptide transporter Tap1, C-terminal ABC domain {H | 95.6 | |
| d1s3ga1 | 182 | Adenylate kinase {Bacillus globisporus [TaxId: 145 | 95.6 | |
| d2bdta1 | 176 | Hypothetical protein BH3686 {Bacillus halodurans [ | 95.55 | |
| d1jbka_ | 195 | ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | 95.54 | |
| d1gkya_ | 186 | Guanylate kinase {Baker's yeast (Saccharomyces cer | 95.39 | |
| d1r6bx2 | 268 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 95.39 | |
| d1e4va1 | 179 | Adenylate kinase {Escherichia coli [TaxId: 562]} | 95.37 | |
| d1yj5a2 | 172 | 5' polynucleotide kinase-3' phosphatase, C-termina | 95.23 | |
| d3dhwc1 | 240 | Methionine import ATP-binding protein MetN {Escher | 95.21 | |
| d2iyva1 | 165 | Shikimate kinase (AroK) {Mycobacterium tuberculosi | 95.13 | |
| d1zaka1 | 189 | Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | 95.11 | |
| d1v43a3 | 239 | Hypothetical protein PH0022, N-terminal domain {Py | 95.09 | |
| d1g2912 | 240 | Maltose transport protein MalK, N-terminal domain | 95.06 | |
| d1kgda_ | 178 | Guanylate kinase-like domain of Cask {Human (Homo | 95.04 | |
| d1nksa_ | 194 | Adenylate kinase {Archaeon Sulfolobus acidocaldari | 95.0 | |
| d2fnaa2 | 283 | Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ | 95.0 | |
| d1lvga_ | 190 | Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 | 94.99 | |
| d1znwa1 | 182 | Guanylate kinase {Mycobacterium tuberculosis [TaxI | 94.98 | |
| d1bifa1 | 213 | 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata | 94.92 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 94.8 | |
| d1khta_ | 190 | Adenylate kinase {Archaeon Methanococcus voltae [T | 94.78 | |
| d1yrba1 | 244 | ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss | 94.7 | |
| d1knqa_ | 171 | Gluconate kinase {Escherichia coli [TaxId: 562]} | 94.65 | |
| d1s96a_ | 205 | Guanylate kinase {Escherichia coli [TaxId: 562]} | 94.6 | |
| d1f5na2 | 277 | Interferon-induced guanylate-binding protein 1 (GB | 94.49 | |
| d2hyda1 | 255 | Putative multidrug export ATP-binding/permease pro | 94.46 | |
| d1m8pa3 | 183 | ATP sulfurylase C-terminal domain {Fungus (Penicil | 94.37 | |
| d1teva_ | 194 | UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] | 94.35 | |
| d1l2ta_ | 230 | MJ0796 {Archaeon Methanococcus jannaschii [TaxId: | 94.35 | |
| d1zp6a1 | 176 | Hypothetical protein Atu3015 {Agrobacterium tumefa | 94.33 | |
| d1jwyb_ | 306 | Dynamin G domain {Dictyostelium discoideum [TaxId: | 94.32 | |
| d1mv5a_ | 242 | Multidrug resistance ABC transporter LmrA, C-termi | 94.31 | |
| d1qf9a_ | 194 | UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 | 94.27 | |
| d2awna2 | 232 | Maltose transport protein MalK, N-terminal domain | 94.27 | |
| d1viaa_ | 161 | Shikimate kinase (AroK) {Campylobacter jejuni [Tax | 94.24 | |
| d1qhxa_ | 178 | Chloramphenicol phosphotransferase {Streptomyces v | 94.18 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 94.11 | |
| d1oxxk2 | 242 | Glucose transport protein GlcV, N-terminal domain | 94.05 | |
| d1vmaa2 | 213 | GTPase domain of the signal recognition particle r | 94.0 | |
| d1qvra2 | 387 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 93.97 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 93.92 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 93.91 | |
| d1q3ta_ | 223 | CMP kinase {Streptococcus pneumoniae [TaxId: 1313] | 93.9 | |
| d1ukza_ | 196 | Uridylate kinase {Baker's yeast (Saccharomyces cer | 93.88 | |
| d1j8yf2 | 211 | GTPase domain of the signal sequence recognition p | 93.77 | |
| d1okkd2 | 207 | GTPase domain of the signal recognition particle r | 93.76 | |
| d1sgwa_ | 200 | Putative ABC transporter PF0895 {Pyrococcus furios | 93.64 | |
| d1g6ha_ | 254 | MJ1267 {Archaeon Methanococcus jannaschii [TaxId: | 93.61 | |
| d2qy9a2 | 211 | GTPase domain of the signal recognition particle r | 93.6 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 93.55 | |
| d1e6ca_ | 170 | Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax | 93.52 | |
| d1ls1a2 | 207 | GTPase domain of the signal sequence recognition p | 93.51 | |
| d3b60a1 | 253 | Multidrug resistance ABC transporter MsbA, C-termi | 93.47 | |
| d2onka1 | 240 | Molybdate/tungstate import ATP-binding protein Wtp | 93.28 | |
| d1sxje2 | 252 | Replication factor C5 {Baker's yeast (Saccharomyce | 93.26 | |
| d1r0wa_ | 281 | Cystic fibrosis transmembrane conductance regulato | 93.23 | |
| d1n0wa_ | 242 | DNA repair protein Rad51, catalytic domain {Human | 93.23 | |
| d1pzna2 | 254 | DNA repair protein Rad51, catalytic domain {Archae | 93.14 | |
| d1ofha_ | 309 | HslU {Haemophilus influenzae [TaxId: 727]} | 93.14 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 93.09 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 93.01 | |
| d2p67a1 | 327 | LAO/AO transport system kinase ArgK {Escherichia c | 93.01 | |
| d1szpa2 | 251 | DNA repair protein Rad51, catalytic domain {Baker' | 93.0 | |
| d3adka_ | 194 | Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | 92.98 | |
| d1ckea_ | 225 | CMP kinase {Escherichia coli [TaxId: 562]} | 92.83 | |
| d1x6va3 | 195 | Adenosine-5'phosphosulfate kinase (APS kinase) {Hu | 92.81 | |
| d2a5yb3 | 277 | CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI | 92.56 | |
| d2qm8a1 | 323 | Metallochaperone MeaB {Methylobacterium extorquens | 92.49 | |
| d1sxjb2 | 224 | Replication factor C4 {Baker's yeast (Saccharomyce | 92.47 | |
| d1d2na_ | 246 | Hexamerization domain of N-ethylmalemide-sensitive | 92.47 | |
| d1sxjd2 | 237 | Replication factor C2 {Baker's yeast (Saccharomyce | 92.3 | |
| d1sxjc2 | 227 | Replication factor C3 {Baker's yeast (Saccharomyce | 92.26 | |
| d1b0ua_ | 258 | ATP-binding subunit of the histidine permease {Sal | 92.11 | |
| d2vp4a1 | 197 | Deoxyribonucleoside kinase {Fruit fly (Drosophila | 92.08 | |
| d2i1qa2 | 258 | DNA repair protein Rad51, catalytic domain {Archae | 92.0 | |
| d1kkma_ | 176 | HPr kinase HprK C-terminal domain {Lactobacillus c | 91.93 | |
| d1rz3a_ | 198 | Hypothetical protein rbstp0775 {Bacillus stearothe | 91.86 | |
| d1v5wa_ | 258 | Meiotic recombination protein DMC1/LIM15 homolog { | 91.82 | |
| d1gsia_ | 208 | Thymidylate kinase {Mycobacterium tuberculosis [Ta | 91.8 | |
| d1ixza_ | 247 | AAA domain of cell division protein FtsH {Thermus | 91.59 | |
| d3d31a2 | 229 | Sulfate/molybdate ABC transporter, ATP-binding pro | 91.58 | |
| d1tf7a2 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 91.48 | |
| d1l7vc_ | 231 | ABC transporter involved in vitamin B12 uptake, Bt | 91.16 | |
| d1knxa2 | 177 | HPr kinase HprK C-terminal domain {Mycoplasma pneu | 90.97 | |
| g1f2t.1 | 292 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 90.91 | |
| d1ji0a_ | 240 | Branched chain aminoacid ABC transporter {Thermoto | 90.88 | |
| d1tf7a1 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 90.76 | |
| d1p5zb_ | 241 | Deoxycytidine kinase {Human (Homo sapiens) [TaxId: | 90.69 | |
| d1e32a2 | 258 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 90.6 | |
| d1ko7a2 | 169 | HPr kinase HprK C-terminal domain {Staphylococcus | 90.58 | |
| d1g8pa_ | 333 | ATPase subunit of magnesium chelatase, BchI {Rhodo | 90.41 | |
| d1lv7a_ | 256 | AAA domain of cell division protein FtsH {Escheric | 90.29 | |
| d1vpla_ | 238 | Putative ABC transporter TM0544 {Thermotoga mariti | 90.24 | |
| d1htwa_ | 158 | Hypothetical protein HI0065 {Haemophilus influenza | 90.11 | |
| d1g41a_ | 443 | HslU {Haemophilus influenzae [TaxId: 727]} | 90.1 | |
| d1cp2a_ | 269 | Nitrogenase iron protein {Clostridium pasteurianum | 90.07 | |
| d1g6oa_ | 323 | Hexameric traffic ATPase, HP0525 {Helicobacter pyl | 89.96 | |
| d4tmka_ | 210 | Thymidylate kinase {Escherichia coli [TaxId: 562]} | 89.34 | |
| g1ii8.1 | 369 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 89.23 | |
| d1r6bx3 | 315 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 89.18 | |
| d2afhe1 | 289 | Nitrogenase iron protein {Azotobacter vinelandii [ | 88.99 | |
| d1r7ra3 | 265 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 88.97 | |
| d1uj2a_ | 213 | Uridine-cytidine kinase 2 {Human (Homo sapiens) [T | 88.84 | |
| d1nlfa_ | 274 | Hexameric replicative helicase repA {Escherichia c | 88.29 | |
| d1cr2a_ | 277 | Gene 4 protein (g4p, DNA primase), helicase domain | 88.18 | |
| d1qhla_ | 222 | Cell division protein MukB {Escherichia coli [TaxI | 88.04 | |
| d1m7ga_ | 208 | Adenosine-5'phosphosulfate kinase (APS kinase) {Fu | 87.98 | |
| d1nn5a_ | 209 | Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 | 87.97 | |
| d1ihua2 | 279 | Arsenite-translocating ATPase ArsA {Escherichia co | 87.67 | |
| d1um8a_ | 364 | ClpX {Helicobacter pylori [TaxId: 210]} | 87.67 | |
| d1e69a_ | 308 | Smc head domain {Thermotoga maritima [TaxId: 2336] | 87.37 | |
| g1xew.1 | 329 | Smc head domain {Pyrococcus furiosus [TaxId: 2261] | 87.09 | |
| d1njfa_ | 239 | delta prime subunit of DNA polymerase III, N-domai | 86.99 | |
| d1ihua1 | 296 | Arsenite-translocating ATPase ArsA {Escherichia co | 86.93 | |
| d1a5ta2 | 207 | delta prime subunit of DNA polymerase III, N-domai | 86.7 | |
| d1svma_ | 362 | Papillomavirus large T antigen helicase domain {Si | 86.56 | |
| d1w44a_ | 321 | NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | 86.28 | |
| d2ocpa1 | 241 | Deoxyguanosine kinase {Human (Homo sapiens) [TaxId | 85.84 | |
| d1uf9a_ | 191 | Dephospho-CoA kinase {Thermus thermophilus [TaxId: | 85.29 | |
| d1byia_ | 224 | Dethiobiotin synthetase {Escherichia coli [TaxId: | 85.01 | |
| d1nija1 | 222 | Hypothetical protein YjiA, N-terminal domain {Esch | 84.51 | |
| d1tmka_ | 214 | Thymidylate kinase {Baker's yeast (Saccharomyces c | 84.36 | |
| d1p6xa_ | 333 | Thymidine kinase {Equine herpesvirus type 4 [TaxId | 84.24 | |
| d1xpua3 | 289 | Transcription termination factor Rho, ATPase domai | 84.16 | |
| d1w1wa_ | 427 | Smc head domain {Baker's yeast (Saccharomyces cere | 83.44 | |
| d1uaaa1 | 306 | DEXX box DNA helicase {Escherichia coli, RepD [Tax | 82.87 | |
| d1e2ka_ | 329 | Thymidine kinase {Herpes simplex virus type 1, dif | 82.86 | |
| d1sq5a_ | 308 | Pantothenate kinase PanK {Escherichia coli [TaxId: | 82.12 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 82.02 | |
| d1pjra1 | 318 | DEXX box DNA helicase {Bacillus stearothermophilus | 81.6 | |
| d1osna_ | 331 | Thymidine kinase {Varicella-zoster virus [TaxId: 1 | 81.39 | |
| d2jdid3 | 276 | Central domain of beta subunit of F1 ATP synthase | 81.3 | |
| d1a7ja_ | 288 | Phosphoribulokinase {Rhodobacter sphaeroides [TaxI | 81.19 | |
| d1qvra3 | 315 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 80.37 |
| >d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: G proteins domain: Rab21 species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.90 E-value=2.2e-24 Score=165.51 Aligned_cols=95 Identities=28% Similarity=0.567 Sum_probs=84.2
Q ss_pred eeeEEEEECCCCCChhhHH-hhhcCccc-cccccceeeeEEEEEEECCeEEEEEEEeCCCCCCCCcchhhhccCCcEEEE
Q 029430 99 VSLKISLLGDCQIGKTSFV-KYVGNEQE-RSLQMAGLNLINKTLMVQGARIAFSIWDVGGDSRSFDHVPIACKDAVAILF 176 (193)
Q Consensus 99 ~~~KivllGd~gvGKTSLl-r~~~~~f~-~~~~t~g~~~~~~~i~v~~~~v~l~iwD~~G~e~~~~~~~~~~~~a~~ill 176 (193)
..|||+|+|++|||||||+ ||++++|. ++.+|.+.++..+.+..++..+.+++||++|++++..+++.++++++++|+
T Consensus 2 y~fKivlvG~~~vGKTsLi~r~~~~~f~~~~~~t~~~~~~~~~~~~~~~~~~~~~~d~~g~~~~~~~~~~~~~~~~~~i~ 81 (167)
T d1z08a1 2 YSFKVVLLGEGCVGKTSLVLRYCENKFNDKHITTLGASFLTKKLNIGGKRVNLAIWDTAGQERFHALGPIYYRDSNGAIL 81 (167)
T ss_dssp EEEEEEEECCTTSCHHHHHHHHHHCCCCSSCCCCCSCEEEEEEEESSSCEEEEEEEECCCC-------CCSSTTCSEEEE
T ss_pred ceEEEEEECCCCcCHHHHHHHHHhCCCCcccccccccchheeeeccCCccceeeeeccCCcceecccchhhccCCceeEE
Confidence 4799999999999999999 99999999 788899999999999999999999999999999999999999999999999
Q ss_pred EEECCChhhHHHHHhcC
Q 029430 177 MFDLTSRCTLNRFDHNQ 193 (193)
Q Consensus 177 vyDit~~~Sf~~l~~W~ 193 (193)
|||+++++||+++..|+
T Consensus 82 v~d~~~~~Sf~~~~~~~ 98 (167)
T d1z08a1 82 VYDITDEDSFQKVKNWV 98 (167)
T ss_dssp EEETTCHHHHHHHHHHH
T ss_pred EEeCCchhHHHhhhhhh
Confidence 99999999999999884
|
| >d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} | Back information, alignment and structure |
|---|
| >d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} | Back information, alignment and structure |
|---|
| >d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} | Back information, alignment and structure |
|---|
| >d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} | Back information, alignment and structure |
|---|
| >d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} | Back information, alignment and structure |
|---|
| >d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} | Back information, alignment and structure |
|---|
| >d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} | Back information, alignment and structure |
|---|
| >d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} | Back information, alignment and structure |
|---|
| >d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} | Back information, alignment and structure |
|---|
| >d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} | Back information, alignment and structure |
|---|
| >d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} | Back information, alignment and structure |
|---|
| >d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} | Back information, alignment and structure |
|---|
| >d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} | Back information, alignment and structure |
|---|
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} | Back information, alignment and structure |
|---|
| >d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} | Back information, alignment and structure |
|---|
| >d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} | Back information, alignment and structure |
|---|
| >d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | Back information, alignment and structure |
|---|
| >d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} | Back information, alignment and structure |
|---|
| >d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} | Back information, alignment and structure |
|---|
| >d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} | Back information, alignment and structure |
|---|
| >d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|