Citrus Sinensis ID: 029516
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 192 | 2.2.26 [Sep-21-2011] | |||||||
| O48964 | 235 | Isopentenyl-diphosphate D | N/A | no | 0.994 | 0.812 | 0.905 | 1e-99 | |
| Q42553 | 284 | Isopentenyl-diphosphate D | yes | no | 0.994 | 0.672 | 0.900 | 3e-99 | |
| O48965 | 309 | Isopentenyl-diphosphate D | N/A | no | 1.0 | 0.621 | 0.875 | 6e-99 | |
| Q39471 | 286 | Isopentenyl-diphosphate D | N/A | no | 0.989 | 0.664 | 0.9 | 9e-99 | |
| Q39664 | 290 | Isopentenyl-diphosphate D | N/A | no | 0.989 | 0.655 | 0.884 | 3e-97 | |
| Q38929 | 291 | Isopentenyl-diphosphate D | no | no | 0.994 | 0.656 | 0.869 | 5e-97 | |
| Q39472 | 287 | Isopentenyl-diphosphate D | N/A | no | 0.994 | 0.665 | 0.869 | 2e-96 | |
| O35586 | 227 | Isopentenyl-diphosphate D | N/A | no | 0.932 | 0.788 | 0.562 | 3e-56 | |
| Q1LZ95 | 227 | Isopentenyl-diphosphate D | yes | no | 0.932 | 0.788 | 0.562 | 1e-55 | |
| P58044 | 227 | Isopentenyl-diphosphate D | no | no | 0.932 | 0.788 | 0.551 | 2e-55 |
| >sp|O48964|IDI1_CAMAC Isopentenyl-diphosphate Delta-isomerase I OS=Camptotheca acuminata GN=IPI1 PE=2 SV=1 | Back alignment and function desciption |
|---|
Score = 362 bits (928), Expect = 1e-99, Method: Compositional matrix adjust.
Identities = 173/191 (90%), Positives = 182/191 (95%)
Query: 1 MEKIESLNLLHRAFSVFLFNSKYELLLQQRSGTKVTFPLVWTNTCCSHPLYRESELIEEN 60
MEKIES NLLHRAFSVFLFNSKYELLLQQRS TKVTFPLVWTNTCCSHPLYRESELI+EN
Sbjct: 44 MEKIESENLLHRAFSVFLFNSKYELLLQQRSATKVTFPLVWTNTCCSHPLYRESELIKEN 103
Query: 61 ALGVRNAAQRKLLDELGICAEDVPVDEFTPLGRILYKAPSDGKWGEHELDYLLFIVRDVS 120
ALG RNAAQRKLLDELGI AEDVPVD+F PLGRILYKAPSDGKWGEHELDYLLFIVRDV+
Sbjct: 104 ALGARNAAQRKLLDELGIPAEDVPVDQFIPLGRILYKAPSDGKWGEHELDYLLFIVRDVN 163
Query: 121 VNPNPDEVAEYKYVNREQLKELLRKADAGEEGLKLSPWFRLVVDNFLFKWWDHLEKGTLN 180
VNPNPDEVA+ KYV R+QLKELLRKADAGEEGLKLSPWFRLVVDNFLFKWWDH+EKGT++
Sbjct: 164 VNPNPDEVADIKYVTRDQLKELLRKADAGEEGLKLSPWFRLVVDNFLFKWWDHVEKGTMH 223
Query: 181 EVIDMKTIHKL 191
E DMK+IHKL
Sbjct: 224 EAADMKSIHKL 234
|
Catalyzes the 1,3-allylic rearrangement of the homoallylic substrate isopentenyl (IPP) to its highly electrophilic allylic isomer, dimethylallyl diphosphate (DMAPP). Camptotheca acuminata (taxid: 16922) EC: 5EC: .EC: 3EC: .EC: 3EC: .EC: 2 |
| >sp|Q42553|IDI2_ARATH Isopentenyl-diphosphate Delta-isomerase II, chloroplastic OS=Arabidopsis thaliana GN=IPP2 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|O48965|IDI2_CAMAC Isopentenyl-diphosphate Delta-isomerase II OS=Camptotheca acuminata GN=IPI2 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q39471|IDI2_CLABR Isopentenyl-diphosphate Delta-isomerase II OS=Clarkia breweri GN=IPI2 PE=3 SV=2 | Back alignment and function description |
|---|
| >sp|Q39664|IDI2_CLAXA Isopentenyl-diphosphate Delta-isomerase II OS=Clarkia xantiana GN=IPI2 PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q38929|IDI1_ARATH Isopentenyl-diphosphate Delta-isomerase I, chloroplastic OS=Arabidopsis thaliana GN=IPP1 PE=2 SV=3 | Back alignment and function description |
|---|
| >sp|Q39472|IDI1_CLABR Isopentenyl-diphosphate Delta-isomerase I OS=Clarkia breweri GN=IPI1 PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|O35586|IDI1_MESAU Isopentenyl-diphosphate Delta-isomerase 1 OS=Mesocricetus auratus GN=IDI1 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q1LZ95|IDI1_BOVIN Isopentenyl-diphosphate Delta-isomerase 1 OS=Bos taurus GN=IDI1 PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|P58044|IDI1_MOUSE Isopentenyl-diphosphate Delta-isomerase 1 OS=Mus musculus GN=Idi1 PE=2 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 192 | ||||||
| 35186998 | 301 | isopentenyl pyrophosphate isomerase [Pue | 1.0 | 0.637 | 0.937 | 1e-102 | |
| 363807460 | 301 | uncharacterized protein LOC100789313 [Gl | 1.0 | 0.637 | 0.927 | 1e-101 | |
| 356531894 | 295 | PREDICTED: isopentenyl-diphosphate Delta | 1.0 | 0.650 | 0.927 | 1e-101 | |
| 357507779 | 287 | Isopentenyl-diphosphate Delta-isomerase | 0.994 | 0.665 | 0.926 | 1e-101 | |
| 13603408 | 235 | isopentenyl diphosphate isomerase 2 [Nic | 1.0 | 0.817 | 0.921 | 1e-101 | |
| 255635611 | 238 | unknown [Glycine max] | 1.0 | 0.806 | 0.927 | 1e-100 | |
| 19568937 | 235 | isopentenyl pyrophosphate isomerase IDI2 | 1.0 | 0.817 | 0.932 | 1e-100 | |
| 239924067 | 294 | plastid isopentenyl diphosphate isomeras | 1.0 | 0.653 | 0.916 | 1e-100 | |
| 350538405 | 235 | isopentenyl diphosphate isomerase [Solan | 1.0 | 0.817 | 0.921 | 1e-100 | |
| 258547335 | 319 | isopentenyl diphosphate isomerase [Buple | 1.0 | 0.601 | 0.906 | 1e-100 |
| >gi|35186998|gb|AAQ84167.1| isopentenyl pyrophosphate isomerase [Pueraria montana var. lobata] | Back alignment and taxonomy information |
|---|
Score = 377 bits (968), Expect = e-102, Method: Compositional matrix adjust.
Identities = 180/192 (93%), Positives = 186/192 (96%)
Query: 1 MEKIESLNLLHRAFSVFLFNSKYELLLQQRSGTKVTFPLVWTNTCCSHPLYRESELIEEN 60
MEKIE+ NLLHRAFSVFLFNSKYELLLQQRS TKVTFPLVWTNTCCSHPLYRESELIEEN
Sbjct: 110 MEKIEAENLLHRAFSVFLFNSKYELLLQQRSATKVTFPLVWTNTCCSHPLYRESELIEEN 169
Query: 61 ALGVRNAAQRKLLDELGICAEDVPVDEFTPLGRILYKAPSDGKWGEHELDYLLFIVRDVS 120
ALGVRNAAQRKLLDELGI AEDVPVD+FTPLGRILYKAPSDGKWGEHELDYLLFIVRDV+
Sbjct: 170 ALGVRNAAQRKLLDELGIVAEDVPVDQFTPLGRILYKAPSDGKWGEHELDYLLFIVRDVN 229
Query: 121 VNPNPDEVAEYKYVNREQLKELLRKADAGEEGLKLSPWFRLVVDNFLFKWWDHLEKGTLN 180
VNPNPDEVA+ KYVNR+QLKELLRKADAGEEGLKLSPWFRLVVDNFLFKWWDHLE+GTL
Sbjct: 230 VNPNPDEVADIKYVNRDQLKELLRKADAGEEGLKLSPWFRLVVDNFLFKWWDHLEQGTLG 289
Query: 181 EVIDMKTIHKLT 192
EV DMKTIHKLT
Sbjct: 290 EVTDMKTIHKLT 301
|
Source: Pueraria montana var. lobata Species: Pueraria montana Genus: Pueraria Family: Fabaceae Order: Fabales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|363807460|ref|NP_001242135.1| uncharacterized protein LOC100789313 [Glycine max] gi|255647098|gb|ACU24017.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356531894|ref|XP_003534511.1| PREDICTED: isopentenyl-diphosphate Delta-isomerase II-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357507779|ref|XP_003624178.1| Isopentenyl-diphosphate Delta-isomerase [Medicago truncatula] gi|355499193|gb|AES80396.1| Isopentenyl-diphosphate Delta-isomerase [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|13603408|dbj|BAB40974.1| isopentenyl diphosphate isomerase 2 [Nicotiana tabacum] | Back alignment and taxonomy information |
|---|
| >gi|255635611|gb|ACU18155.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|19568937|gb|AAL91979.1|AF483190_1 isopentenyl pyrophosphate isomerase IDI2 [Melaleuca alternifolia] | Back alignment and taxonomy information |
|---|
| >gi|239924067|gb|ACS34993.1| plastid isopentenyl diphosphate isomerase [Solanum lycopersicum] | Back alignment and taxonomy information |
|---|
| >gi|350538405|ref|NP_001234853.1| isopentenyl diphosphate isomerase [Solanum lycopersicum] gi|160966279|gb|ABX55779.1| isopentenyl diphosphate isomerase [Solanum lycopersicum] | Back alignment and taxonomy information |
|---|
| >gi|258547335|gb|ACV74320.1| isopentenyl diphosphate isomerase [Bupleurum chinense] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 192 | ||||||
| TAIR|locus:2075412 | 284 | IPP2 "isopentenyl pyrophosphat | 0.994 | 0.672 | 0.900 | 3.9e-92 | |
| TAIR|locus:2171382 | 291 | IPP1 "isopentenyl diphosphate | 0.994 | 0.656 | 0.869 | 8.3e-90 | |
| UNIPROTKB|Q13907 | 227 | IDI1 "Isopentenyl-diphosphate | 0.963 | 0.814 | 0.563 | 3.4e-54 | |
| UNIPROTKB|O35586 | 227 | IDI1 "Isopentenyl-diphosphate | 0.963 | 0.814 | 0.552 | 1.1e-53 | |
| UNIPROTKB|Q1LZ95 | 227 | IDI1 "Isopentenyl-diphosphate | 0.963 | 0.814 | 0.557 | 2.4e-53 | |
| MGI|MGI:2442264 | 227 | Idi1 "isopentenyl-diphosphate | 0.963 | 0.814 | 0.542 | 4.9e-53 | |
| UNIPROTKB|I3LDY2 | 287 | LOC100739304 "Uncharacterized | 0.963 | 0.644 | 0.547 | 2.1e-52 | |
| RGD|621835 | 227 | Idi1 "isopentenyl-diphosphate | 0.963 | 0.814 | 0.536 | 2.1e-52 | |
| UNIPROTKB|F1NZX3 | 233 | IDI1 "Uncharacterized protein" | 0.963 | 0.793 | 0.547 | 4.4e-52 | |
| ZFIN|ZDB-GENE-050913-44 | 278 | idi1 "isopentenyl-diphosphate | 0.932 | 0.643 | 0.557 | 4e-51 |
| TAIR|locus:2075412 IPP2 "isopentenyl pyrophosphate:dimethylallyl pyrophosphate isomerase 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 918 (328.2 bits), Expect = 3.9e-92, P = 3.9e-92
Identities = 172/191 (90%), Positives = 181/191 (94%)
Query: 1 MEKIESLNLLHRAFSVFLFNSKYELLLQQRSGTKVTFPLVWTNTCCSHPLYRESELIEEN 60
ME IE+ NLLHRAFSVFLFNSKYELLLQQRS TKVTFPLVWTNTCCSHPLYRESELI++N
Sbjct: 94 MENIEAKNLLHRAFSVFLFNSKYELLLQQRSNTKVTFPLVWTNTCCSHPLYRESELIQDN 153
Query: 61 ALGVRNAAQRKLLDELGICAEDVPVDEFTPLGRILYKAPSDGKWGEHELDYLLFIVRDVS 120
ALGVRNAAQRKLLDELGI AEDVPVDEFTPLGR+LYKAPSDGKWGEHELDYLLFIVRDV
Sbjct: 154 ALGVRNAAQRKLLDELGIVAEDVPVDEFTPLGRMLYKAPSDGKWGEHELDYLLFIVRDVK 213
Query: 121 VNPNPDEVAEYKYVNREQLKELLRKADAGEEGLKLSPWFRLVVDNFLFKWWDHLEKGTLN 180
V PNPDEVAE KYV+RE+LKEL++KADAGEEGLKLSPWFRLVVDNFL KWWDH+EKGTL
Sbjct: 214 VQPNPDEVAEIKYVSREELKELVKKADAGEEGLKLSPWFRLVVDNFLMKWWDHVEKGTLV 273
Query: 181 EVIDMKTIHKL 191
E IDMKTIHKL
Sbjct: 274 EAIDMKTIHKL 284
|
|
| TAIR|locus:2171382 IPP1 "isopentenyl diphosphate isomerase 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q13907 IDI1 "Isopentenyl-diphosphate Delta-isomerase 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O35586 IDI1 "Isopentenyl-diphosphate Delta-isomerase 1" [Mesocricetus auratus (taxid:10036)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q1LZ95 IDI1 "Isopentenyl-diphosphate Delta-isomerase 1" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2442264 Idi1 "isopentenyl-diphosphate delta isomerase" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3LDY2 LOC100739304 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| RGD|621835 Idi1 "isopentenyl-diphosphate delta isomerase 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NZX3 IDI1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-050913-44 idi1 "isopentenyl-diphosphate delta isomerase 1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
| ID | Name | Annotated EC number | Identity | Query coverage | Hit coverage | RBH(Q2H) | RBH(H2Q) |
| Q39471 | IDI2_CLABR | 5, ., 3, ., 3, ., 2 | 0.9 | 0.9895 | 0.6643 | N/A | no |
| Q39472 | IDI1_CLABR | 5, ., 3, ., 3, ., 2 | 0.8691 | 0.9947 | 0.6655 | N/A | no |
| Q5R8R6 | IDI1_PONAB | 5, ., 3, ., 3, ., 2 | 0.5578 | 0.9635 | 0.8149 | yes | no |
| Q42553 | IDI2_ARATH | 5, ., 3, ., 3, ., 2 | 0.9005 | 0.9947 | 0.6725 | yes | no |
| Q4R4W5 | IDI1_MACFA | 5, ., 3, ., 3, ., 2 | 0.5684 | 0.9635 | 0.8149 | N/A | no |
| Q39664 | IDI2_CLAXA | 5, ., 3, ., 3, ., 2 | 0.8842 | 0.9895 | 0.6551 | N/A | no |
| Q10132 | IDI1_SCHPO | 5, ., 3, ., 3, ., 2 | 0.5138 | 0.875 | 0.7336 | yes | no |
| Q1LZ95 | IDI1_BOVIN | 5, ., 3, ., 3, ., 2 | 0.5628 | 0.9322 | 0.7885 | yes | no |
| O48964 | IDI1_CAMAC | 5, ., 3, ., 3, ., 2 | 0.9057 | 0.9947 | 0.8127 | N/A | no |
| O48965 | IDI2_CAMAC | 5, ., 3, ., 3, ., 2 | 0.875 | 1.0 | 0.6213 | N/A | no |
| Q9NH02 | IDI_DICDI | 5, ., 3, ., 3, ., 2 | 0.5176 | 0.8541 | 0.6861 | yes | no |
| O35760 | IDI1_RAT | 5, ., 3, ., 3, ., 2 | 0.5464 | 0.9322 | 0.7885 | yes | no |
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 3rd Layer | 5.3.3.2 | 0.979 |
| 3rd Layer | 5.3.3 | 0.983 |
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
 |
 |
 |
 |
 |
 |
 |
 |
 |
 | ipiOs1 | Os07g0546000 (799 aa) | ||||||
(Oryza sativa Indica) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 192 | |||
| PLN02552 | 247 | PLN02552, PLN02552, isopentenyl-diphosphate delta- | 1e-124 | |
| cd02885 | 165 | cd02885, IPP_Isomerase, Isopentenyl diphosphate (I | 5e-69 | |
| TIGR02150 | 158 | TIGR02150, IPP_isom_1, isopentenyl-diphosphate del | 9e-62 | |
| COG1443 | 185 | COG1443, Idi, Isopentenyldiphosphate isomerase [Li | 5e-50 | |
| PRK03759 | 184 | PRK03759, PRK03759, isopentenyl-diphosphate delta- | 4e-35 | |
| pfam00293 | 133 | pfam00293, NUDIX, NUDIX domain | 3e-15 | |
| cd04692 | 144 | cd04692, Nudix_Hydrolase_33, Members of the Nudix | 1e-11 | |
| cd04693 | 127 | cd04693, Nudix_Hydrolase_34, Members of the Nudix | 3e-11 | |
| cd04697 | 126 | cd04697, Nudix_Hydrolase_38, Members of the Nudix | 9e-11 | |
| PLN02791 | 770 | PLN02791, PLN02791, Nudix hydrolase homolog | 6e-08 |
| >gnl|CDD|215303 PLN02552, PLN02552, isopentenyl-diphosphate delta-isomerase | Back alignment and domain information |
|---|
Score = 349 bits (897), Expect = e-124
Identities = 154/208 (74%), Positives = 165/208 (79%), Gaps = 22/208 (10%)
Query: 1 MEKIESLNLLHRAFSVFLFNSKYELLLQQRSGTKVTFPLVWTNTCCSHPLY--------R 52
EKIE LLHRAFSVFLFNSKYELLLQQR+ TKVTFPLVWTNTCCSHPLY R
Sbjct: 46 FEKIEPRGLLHRAFSVFLFNSKYELLLQQRAATKVTFPLVWTNTCCSHPLYGQDPNEVDR 105
Query: 53 ESELIEENALGVRNAAQRKLLDELGICAEDVPVDEFTPLGRILYKAPSD------GKWGE 106
ESELI+ N LGV+NAAQRKLL ELGI AEDVPVD+FT L R+ YKA D GKWGE
Sbjct: 106 ESELIDGNVLGVKNAAQRKLLHELGIPAEDVPVDQFTFLTRLHYKAADDVTHGPDGKWGE 165
Query: 107 HELDYLLFI--VRDVSVNPNPDEVAEYKYVNREQLKELLRKADAGEEGLKLSPWFRLVVD 164
HELDYLLFI VRDV VNPNPDEVA+ KYVNRE+LKE++RK E GLKLSPWFRL+VD
Sbjct: 166 HELDYLLFIRPVRDVKVNPNPDEVADVKYVNREELKEMMRK----ESGLKLSPWFRLIVD 221
Query: 165 NFLFKWWDHLEKGTLNEVIDMKTIHKLT 192
NFL KWWD LEKGT E +DMKTIHKL
Sbjct: 222 NFLMKWWDDLEKGT--EAVDMKTIHKLM 247
|
Length = 247 |
| >gnl|CDD|239218 cd02885, IPP_Isomerase, Isopentenyl diphosphate (IPP) isomerase, a member of the Nudix hydrolase superfamily, is a key enzyme in the isoprenoid biosynthetic pathway | Back alignment and domain information |
|---|
| >gnl|CDD|233749 TIGR02150, IPP_isom_1, isopentenyl-diphosphate delta-isomerase, type 1 | Back alignment and domain information |
|---|
| >gnl|CDD|224360 COG1443, Idi, Isopentenyldiphosphate isomerase [Lipid metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|235156 PRK03759, PRK03759, isopentenyl-diphosphate delta-isomerase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215841 pfam00293, NUDIX, NUDIX domain | Back alignment and domain information |
|---|
| >gnl|CDD|240048 cd04692, Nudix_Hydrolase_33, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|240049 cd04693, Nudix_Hydrolase_34, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|240053 cd04697, Nudix_Hydrolase_38, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|215425 PLN02791, PLN02791, Nudix hydrolase homolog | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 192 | |||
| PLN02552 | 247 | isopentenyl-diphosphate delta-isomerase | 100.0 | |
| KOG0142 | 225 | consensus Isopentenyl pyrophosphate:dimethylallyl | 100.0 | |
| COG1443 | 185 | Idi Isopentenyldiphosphate isomerase [Lipid metabo | 99.97 | |
| cd02885 | 165 | IPP_Isomerase Isopentenyl diphosphate (IPP) isomer | 99.96 | |
| PRK03759 | 184 | isopentenyl-diphosphate delta-isomerase; Provision | 99.95 | |
| TIGR02150 | 158 | IPP_isom_1 isopentenyl-diphosphate delta-isomerase | 99.95 | |
| cd03676 | 180 | Nudix_hydrolase_3 Members of the Nudix hydrolase s | 99.95 | |
| cd04692 | 144 | Nudix_Hydrolase_33 Members of the Nudix hydrolase | 99.94 | |
| PLN02791 | 770 | Nudix hydrolase homolog | 99.92 | |
| cd04697 | 126 | Nudix_Hydrolase_38 Members of the Nudix hydrolase | 99.91 | |
| PRK15393 | 180 | NUDIX hydrolase YfcD; Provisional | 99.91 | |
| cd04693 | 127 | Nudix_Hydrolase_34 Members of the Nudix hydrolase | 99.91 | |
| PRK15472 | 141 | nucleoside triphosphatase NudI; Provisional | 99.88 | |
| PRK09438 | 148 | nudB dihydroneopterin triphosphate pyrophosphatase | 99.85 | |
| PF00293 | 134 | NUDIX: NUDIX domain; InterPro: IPR000086 The gener | 99.85 | |
| PRK15434 | 159 | GDP-mannose mannosyl hydrolase NudD; Provisional | 99.84 | |
| cd04682 | 122 | Nudix_Hydrolase_23 Members of the Nudix hydrolase | 99.83 | |
| cd04681 | 130 | Nudix_Hydrolase_22 Members of the Nudix hydrolase | 99.83 | |
| cd04694 | 143 | Nudix_Hydrolase_35 Members of the Nudix hydrolase | 99.83 | |
| cd04679 | 125 | Nudix_Hydrolase_20 Members of the Nudix hydrolase | 99.83 | |
| cd04696 | 125 | Nudix_Hydrolase_37 Members of the Nudix hydrolase | 99.83 | |
| cd03426 | 157 | CoAse Coenzyme A pyrophosphatase (CoAse), a member | 99.82 | |
| cd03673 | 131 | Ap6A_hydrolase Diadenosine hexaphosphate (Ap6A) hy | 99.82 | |
| cd03430 | 144 | GDPMH GDP-mannose glycosyl hydrolase (AKA GDP-mann | 99.82 | |
| cd04684 | 128 | Nudix_Hydrolase_25 Contains a crystal structure of | 99.82 | |
| cd03424 | 137 | ADPRase_NUDT5 ADP-ribose pyrophosphatase (ADPRase) | 99.81 | |
| cd03674 | 138 | Nudix_Hydrolase_1 Members of the Nudix hydrolase s | 99.81 | |
| cd04664 | 129 | Nudix_Hydrolase_7 Members of the Nudix hydrolase s | 99.81 | |
| cd04700 | 142 | DR1025_like DR1025 from Deinococcus radiodurans, a | 99.81 | |
| cd04683 | 120 | Nudix_Hydrolase_24 Members of the Nudix hydrolase | 99.8 | |
| cd03427 | 137 | MTH1 MutT homolog-1 (MTH1) is a member of the Nudi | 99.8 | |
| cd04678 | 129 | Nudix_Hydrolase_19 Members of the Nudix hydrolase | 99.8 | |
| cd03671 | 147 | Ap4A_hydrolase_plant_like Diadenosine tetraphospha | 99.8 | |
| cd04691 | 117 | Nudix_Hydrolase_32 Members of the Nudix hydrolase | 99.8 | |
| cd04673 | 122 | Nudix_Hydrolase_15 Members of the Nudix hydrolase | 99.79 | |
| cd03675 | 134 | Nudix_Hydrolase_2 Contains a crystal structure of | 99.79 | |
| cd03429 | 131 | NADH_pyrophosphatase NADH pyrophosphatase, a membe | 99.79 | |
| cd04680 | 120 | Nudix_Hydrolase_21 Members of the Nudix hydrolase | 99.79 | |
| cd04677 | 132 | Nudix_Hydrolase_18 Members of the Nudix hydrolase | 99.78 | |
| cd04699 | 129 | Nudix_Hydrolase_39 Members of the Nudix hydrolase | 99.78 | |
| PRK00714 | 156 | RNA pyrophosphohydrolase; Reviewed | 99.78 | |
| cd04670 | 127 | Nudix_Hydrolase_12 Members of the Nudix hydrolase | 99.77 | |
| cd04676 | 129 | Nudix_Hydrolase_17 Members of the Nudix hydrolase | 99.76 | |
| cd04689 | 125 | Nudix_Hydrolase_30 Members of the Nudix hydrolase | 99.76 | |
| cd04688 | 126 | Nudix_Hydrolase_29 Members of the Nudix hydrolase | 99.75 | |
| cd03672 | 145 | Dcp2p mRNA decapping enzyme 2 (Dcp2p), the catalyt | 99.75 | |
| PRK10546 | 135 | pyrimidine (deoxy)nucleoside triphosphate pyrophos | 99.74 | |
| cd04690 | 118 | Nudix_Hydrolase_31 Members of the Nudix hydrolase | 99.74 | |
| cd03428 | 130 | Ap4A_hydrolase_human_like Diadenosine tetraphospha | 99.74 | |
| PRK10776 | 129 | nucleoside triphosphate pyrophosphohydrolase; Prov | 99.74 | |
| PLN02325 | 144 | nudix hydrolase | 99.74 | |
| PLN02839 | 372 | nudix hydrolase | 99.74 | |
| cd04687 | 128 | Nudix_Hydrolase_28 Members of the Nudix hydrolase | 99.74 | |
| cd04695 | 131 | Nudix_Hydrolase_36 Members of the Nudix hydrolase | 99.73 | |
| cd04671 | 123 | Nudix_Hydrolase_13 Members of the Nudix hydrolase | 99.73 | |
| cd03425 | 124 | MutT_pyrophosphohydrolase The MutT pyrophosphohydr | 99.72 | |
| cd04666 | 122 | Nudix_Hydrolase_9 Members of the Nudix hydrolase s | 99.71 | |
| cd04672 | 123 | Nudix_Hydrolase_14 Members of the Nudix hydrolase | 99.71 | |
| PRK00241 | 256 | nudC NADH pyrophosphatase; Reviewed | 99.71 | |
| cd04669 | 121 | Nudix_Hydrolase_11 Members of the Nudix hydrolase | 99.71 | |
| cd04685 | 133 | Nudix_Hydrolase_26 Members of the Nudix hydrolase | 99.7 | |
| cd04667 | 112 | Nudix_Hydrolase_10 Members of the Nudix hydrolase | 99.69 | |
| cd02883 | 123 | Nudix_Hydrolase Nudix hydrolase is a superfamily o | 99.69 | |
| PRK10707 | 190 | putative NUDIX hydrolase; Provisional | 99.68 | |
| TIGR00586 | 128 | mutt mutator mutT protein. All proteins in this fa | 99.67 | |
| cd04511 | 130 | Nudix_Hydrolase_4 Members of the Nudix hydrolase s | 99.66 | |
| COG1051 | 145 | ADP-ribose pyrophosphatase [Nucleotide transport a | 99.65 | |
| PRK11762 | 185 | nudE adenosine nucleotide hydrolase NudE; Provisio | 99.65 | |
| cd04661 | 132 | MRP_L46 Mitochondrial ribosomal protein L46 (MRP L | 99.65 | |
| PRK05379 | 340 | bifunctional nicotinamide mononucleotide adenylylt | 99.64 | |
| cd04686 | 131 | Nudix_Hydrolase_27 Members of the Nudix hydrolase | 99.64 | |
| PLN02709 | 222 | nudix hydrolase | 99.63 | |
| TIGR00052 | 185 | nudix-type nucleoside diphosphatase, YffH/AdpP fam | 99.55 | |
| PRK10729 | 202 | nudF ADP-ribose pyrophosphatase NudF; Provisional | 99.55 | |
| PRK08999 | 312 | hypothetical protein; Provisional | 99.55 | |
| COG2816 | 279 | NPY1 NTP pyrophosphohydrolases containing a Zn-fin | 99.52 | |
| cd04662 | 126 | Nudix_Hydrolase_5 Members of the Nudix hydrolase s | 99.46 | |
| KOG3084 | 345 | consensus NADH pyrophosphatase I of the Nudix fami | 99.46 | |
| PRK15009 | 191 | GDP-mannose pyrophosphatase NudK; Provisional | 99.45 | |
| TIGR02705 | 156 | nudix_YtkD nucleoside triphosphatase YtkD. The fun | 99.44 | |
| cd04665 | 118 | Nudix_Hydrolase_8 Members of the Nudix hydrolase s | 99.44 | |
| cd04674 | 118 | Nudix_Hydrolase_16 Members of the Nudix hydrolase | 99.35 | |
| cd03670 | 186 | ADPRase_NUDT9 ADP-ribose pyrophosphatase (ADPRase) | 99.32 | |
| cd04663 | 126 | Nudix_Hydrolase_6 Members of the Nudix hydrolase s | 99.29 | |
| COG0494 | 161 | MutT NTP pyrophosphohydrolases including oxidative | 99.25 | |
| KOG4313 | 306 | consensus Thiamine pyrophosphokinase [Nucleotide t | 99.24 | |
| KOG3069 | 246 | consensus Peroxisomal NUDIX hydrolase [Replication | 99.22 | |
| KOG2839 | 145 | consensus Diadenosine and diphosphoinositol polyph | 99.18 | |
| PLN03143 | 291 | nudix hydrolase; Provisional | 99.17 | |
| cd03431 | 118 | DNA_Glycosylase_C DNA glycosylase (MutY in bacteri | 99.11 | |
| KOG0648 | 295 | consensus Predicted NUDIX hydrolase FGF-2 and rela | 98.82 | |
| KOG3041 | 225 | consensus Nucleoside diphosphate-sugar hydrolase o | 98.48 | |
| PF14815 | 114 | NUDIX_4: NUDIX domain; PDB: 1VRL_A 1RRQ_A 3G0Q_A 3 | 98.23 | |
| COG4119 | 161 | Predicted NTP pyrophosphohydrolase [DNA replicatio | 98.08 | |
| COG4112 | 203 | Predicted phosphoesterase (MutT family) [General f | 97.7 | |
| KOG4195 | 275 | consensus Transient receptor potential-related cha | 96.75 | |
| PRK10880 | 350 | adenine DNA glycosylase; Provisional | 96.73 | |
| PF13869 | 188 | NUDIX_2: Nucleotide hydrolase; PDB: 3MDG_B 2J8Q_B | 95.69 | |
| PF14443 | 126 | DBC1: DBC1 | 94.28 | |
| KOG4432 | 405 | consensus Uncharacterized NUDIX family hydrolase [ | 93.38 | |
| KOG2937 | 348 | consensus Decapping enzyme complex, predicted pyro | 91.98 | |
| KOG4548 | 263 | consensus Mitochondrial ribosomal protein L17 [Tra | 91.1 | |
| KOG1689 | 221 | consensus mRNA cleavage factor I subunit [RNA proc | 90.26 | |
| PRK13910 | 289 | DNA glycosylase MutY; Provisional | 86.62 | |
| KOG4432 | 405 | consensus Uncharacterized NUDIX family hydrolase [ | 84.83 |
| >PLN02552 isopentenyl-diphosphate delta-isomerase | Back alignment and domain information |
|---|
Probab=100.00 E-value=6e-37 Score=255.99 Aligned_cols=182 Identities=79% Similarity=1.282 Sum_probs=156.6
Q ss_pred ccCCcceEEEEEEEEeCCceEEEeeecCCCCCCCCCccccccccCCCCCCh--------hhhhhhhcHHHHHHHHHHHHh
Q 029516 5 ESLNLLHRAFSVFLFNSKYELLLQQRSGTKVTFPLVWTNTCCSHPLYRESE--------LIEENALGVRNAAQRKLLDEL 76 (192)
Q Consensus 5 ~~~~~~h~av~v~i~~~~~~lLL~~R~~~k~~~pg~W~~p~gG~ve~gEs~--------~~~~~~~~~~eaa~REl~EEt 76 (192)
..+|++||+|+|+|+|++|+||||||+..|..|||+|++++|||+..||++ ++.+++.|+.+||+|||.|||
T Consensus 50 ~~~gl~Hra~~v~i~n~~g~lLLQkRs~~K~~~Pg~Wd~s~~GHp~~ge~~~e~~~e~~~~~~~~~~~~eAA~REL~EEl 129 (247)
T PLN02552 50 EPRGLLHRAFSVFLFNSKYELLLQQRAATKVTFPLVWTNTCCSHPLYGQDPNEVDRESELIDGNVLGVKNAAQRKLLHEL 129 (247)
T ss_pred cCCCceEEEEEEEEEcCCCeEEEEEecCCCCCCCcceecccCCccccccccccccccccccccchhhHHHHHHhHHHHHh
Confidence 358999999999999999999999999999999999999999999998553 224555668899999999999
Q ss_pred CCCCCCCCCCceeeeeEEEEEccCC------CCcceeEEEEEEEEee--CCccCCCccccccEEEecHHHHHHHHHhhcC
Q 029516 77 GICAEDVPVDEFTPLGRILYKAPSD------GKWGEHELDYLLFIVR--DVSVNPNPDEVAEYKYVNREQLKELLRKADA 148 (192)
Q Consensus 77 Gl~~~~~~~~~l~~~~~~~~~~~~~------~~~~~~~~~~~f~~~~--~~~~~~~~~Ev~~~~Wv~~~el~~~~~~~~~ 148 (192)
||.+..++++++.+++++.|..+.. +++.+++++++|+... ...+.++++|+.+++|++++++.+++...
T Consensus 130 GI~~~~~~~~~l~~~~~~~y~~~~~~~~~~~~~~~E~e~~~v~~~~~~~~~~l~lq~eEV~~~~wvs~~el~~~~~~~-- 207 (247)
T PLN02552 130 GIPAEDVPVDQFTFLTRLHYKAADDVTHGPDGKWGEHELDYLLFIRPVRDVKVNPNPDEVADVKYVNREELKEMMRKE-- 207 (247)
T ss_pred CCCccccccccceeeeEEEEecccccccccCCCccceEEEEEEEEEecCCCcccCCHHHhheEEEEeHHHHHHHHhhc--
Confidence 9998766666788888888877654 5666788888776532 34778899999999999999999998753
Q ss_pred CCCCcccChhHHHHHHHHHHHHHHHhcccccccccCCCceeecC
Q 029516 149 GEEGLKLSPWFRLVVDNFLFKWWDHLEKGTLNEVIDMKTIHKLT 192 (192)
Q Consensus 149 ~~~~~~~~p~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~ 192 (192)
.+..|+||++.++++|+..||+.++++ .+++||+.||||.
T Consensus 208 --~~~~~tpw~~~~~~~~l~~w~~~~~~~--~~~~~~~~i~~~~ 247 (247)
T PLN02552 208 --SGLKLSPWFRLIVDNFLMKWWDDLEKG--TEAVDMKTIHKLM 247 (247)
T ss_pred --CCcccCHHHHHHHHHHHHHHHhhhcch--hhccChhhheecC
Confidence 367899999999999999999999999 9999999999983
|
|
| >KOG0142 consensus Isopentenyl pyrophosphate:dimethylallyl pyrophosphate isomerase [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >COG1443 Idi Isopentenyldiphosphate isomerase [Lipid metabolism] | Back alignment and domain information |
|---|
| >cd02885 IPP_Isomerase Isopentenyl diphosphate (IPP) isomerase, a member of the Nudix hydrolase superfamily, is a key enzyme in the isoprenoid biosynthetic pathway | Back alignment and domain information |
|---|
| >PRK03759 isopentenyl-diphosphate delta-isomerase; Provisional | Back alignment and domain information |
|---|
| >TIGR02150 IPP_isom_1 isopentenyl-diphosphate delta-isomerase, type 1 | Back alignment and domain information |
|---|
| >cd03676 Nudix_hydrolase_3 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04692 Nudix_Hydrolase_33 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >PLN02791 Nudix hydrolase homolog | Back alignment and domain information |
|---|
| >cd04697 Nudix_Hydrolase_38 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >PRK15393 NUDIX hydrolase YfcD; Provisional | Back alignment and domain information |
|---|
| >cd04693 Nudix_Hydrolase_34 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >PRK15472 nucleoside triphosphatase NudI; Provisional | Back alignment and domain information |
|---|
| >PRK09438 nudB dihydroneopterin triphosphate pyrophosphatase; Provisional | Back alignment and domain information |
|---|
| >PF00293 NUDIX: NUDIX domain; InterPro: IPR000086 The generic name 'NUDIX hydrolases' (NUcleoside DIphosphate linked to some other moiety X) has been coined for this domain family [] | Back alignment and domain information |
|---|
| >PRK15434 GDP-mannose mannosyl hydrolase NudD; Provisional | Back alignment and domain information |
|---|
| >cd04682 Nudix_Hydrolase_23 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04681 Nudix_Hydrolase_22 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04694 Nudix_Hydrolase_35 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04679 Nudix_Hydrolase_20 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04696 Nudix_Hydrolase_37 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd03426 CoAse Coenzyme A pyrophosphatase (CoAse), a member of the Nudix hydrolase superfamily, functions to catalyze the elimination of oxidized inactive CoA, which can inhibit CoA-utilizing enzymes | Back alignment and domain information |
|---|
| >cd03673 Ap6A_hydrolase Diadenosine hexaphosphate (Ap6A) hydrolase is a member of the Nudix hydrolase superfamily | Back alignment and domain information |
|---|
| >cd03430 GDPMH GDP-mannose glycosyl hydrolase (AKA GDP-mannose mannosyl hydrolase (GDPMH)) is a member of the Nudix hydrolase superfamily | Back alignment and domain information |
|---|
| >cd04684 Nudix_Hydrolase_25 Contains a crystal structure of the Nudix hydrolase from Enterococcus faecalis, which has an unknown function | Back alignment and domain information |
|---|
| >cd03424 ADPRase_NUDT5 ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose and a variety of additional ADP-sugar conjugates to AMP and ribose-5-phosphate | Back alignment and domain information |
|---|
| >cd03674 Nudix_Hydrolase_1 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04664 Nudix_Hydrolase_7 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04700 DR1025_like DR1025 from Deinococcus radiodurans, a member of the Nudix hydrolase superfamily, show nucleoside triphosphatase and dinucleoside polyphosphate pyrophosphatase activities | Back alignment and domain information |
|---|
| >cd04683 Nudix_Hydrolase_24 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd03427 MTH1 MutT homolog-1 (MTH1) is a member of the Nudix hydrolase superfamily | Back alignment and domain information |
|---|
| >cd04678 Nudix_Hydrolase_19 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd03671 Ap4A_hydrolase_plant_like Diadenosine tetraphosphate (Ap4A) hydrolase is a member of the Nudix hydrolase superfamily | Back alignment and domain information |
|---|
| >cd04691 Nudix_Hydrolase_32 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04673 Nudix_Hydrolase_15 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd03675 Nudix_Hydrolase_2 Contains a crystal structure of the Nudix hydrolase from Nitrosomonas europaea, which has an unknown function | Back alignment and domain information |
|---|
| >cd03429 NADH_pyrophosphatase NADH pyrophosphatase, a member of the Nudix hydrolase superfamily, catalyzes the cleavage of NADH into reduced nicotinamide mononucleotide (NMNH) and AMP | Back alignment and domain information |
|---|
| >cd04680 Nudix_Hydrolase_21 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04677 Nudix_Hydrolase_18 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04699 Nudix_Hydrolase_39 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >PRK00714 RNA pyrophosphohydrolase; Reviewed | Back alignment and domain information |
|---|
| >cd04670 Nudix_Hydrolase_12 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04676 Nudix_Hydrolase_17 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04689 Nudix_Hydrolase_30 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04688 Nudix_Hydrolase_29 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd03672 Dcp2p mRNA decapping enzyme 2 (Dcp2p), the catalytic subunit, and Dcp1p are the two components of the decapping enzyme complex | Back alignment and domain information |
|---|
| >PRK10546 pyrimidine (deoxy)nucleoside triphosphate pyrophosphohydrolase; Provisional | Back alignment and domain information |
|---|
| >cd04690 Nudix_Hydrolase_31 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd03428 Ap4A_hydrolase_human_like Diadenosine tetraphosphate (Ap4A) hydrolase is a member of the Nudix hydrolase superfamily | Back alignment and domain information |
|---|
| >PRK10776 nucleoside triphosphate pyrophosphohydrolase; Provisional | Back alignment and domain information |
|---|
| >PLN02325 nudix hydrolase | Back alignment and domain information |
|---|
| >PLN02839 nudix hydrolase | Back alignment and domain information |
|---|
| >cd04687 Nudix_Hydrolase_28 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04695 Nudix_Hydrolase_36 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04671 Nudix_Hydrolase_13 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd03425 MutT_pyrophosphohydrolase The MutT pyrophosphohydrolase is a prototypical Nudix hydrolase that catalyzes the hydrolysis of nucleoside and deoxynucleoside triphosphates (NTPs and dNTPs) by substitution at a beta-phosphorus to yield a nucleotide monophosphate (NMP) and inorganic pyrophosphate (PPi) | Back alignment and domain information |
|---|
| >cd04666 Nudix_Hydrolase_9 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04672 Nudix_Hydrolase_14 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >PRK00241 nudC NADH pyrophosphatase; Reviewed | Back alignment and domain information |
|---|
| >cd04669 Nudix_Hydrolase_11 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04685 Nudix_Hydrolase_26 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04667 Nudix_Hydrolase_10 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd02883 Nudix_Hydrolase Nudix hydrolase is a superfamily of enzymes found in all three kingdoms of life, and it catalyzes the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >PRK10707 putative NUDIX hydrolase; Provisional | Back alignment and domain information |
|---|
| >TIGR00586 mutt mutator mutT protein | Back alignment and domain information |
|---|
| >cd04511 Nudix_Hydrolase_4 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >COG1051 ADP-ribose pyrophosphatase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK11762 nudE adenosine nucleotide hydrolase NudE; Provisional | Back alignment and domain information |
|---|
| >cd04661 MRP_L46 Mitochondrial ribosomal protein L46 (MRP L46) is a component of the large subunit (39S) of the mammalian mitochondrial ribosome and a member of the Nudix hydrolase superfamily | Back alignment and domain information |
|---|
| >PRK05379 bifunctional nicotinamide mononucleotide adenylyltransferase/ADP-ribose pyrophosphatase; Provisional | Back alignment and domain information |
|---|
| >cd04686 Nudix_Hydrolase_27 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >PLN02709 nudix hydrolase | Back alignment and domain information |
|---|
| >TIGR00052 nudix-type nucleoside diphosphatase, YffH/AdpP family | Back alignment and domain information |
|---|
| >PRK10729 nudF ADP-ribose pyrophosphatase NudF; Provisional | Back alignment and domain information |
|---|
| >PRK08999 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG2816 NPY1 NTP pyrophosphohydrolases containing a Zn-finger, probably nucleic-acid-binding [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >cd04662 Nudix_Hydrolase_5 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >KOG3084 consensus NADH pyrophosphatase I of the Nudix family of hydrolases [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK15009 GDP-mannose pyrophosphatase NudK; Provisional | Back alignment and domain information |
|---|
| >TIGR02705 nudix_YtkD nucleoside triphosphatase YtkD | Back alignment and domain information |
|---|
| >cd04665 Nudix_Hydrolase_8 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04674 Nudix_Hydrolase_16 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd03670 ADPRase_NUDT9 ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose to AMP and ribose-5-P | Back alignment and domain information |
|---|
| >cd04663 Nudix_Hydrolase_6 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >COG0494 MutT NTP pyrophosphohydrolases including oxidative damage repair enzymes [DNA replication, recombination, and repair / General function prediction only] | Back alignment and domain information |
|---|
| >KOG4313 consensus Thiamine pyrophosphokinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >KOG3069 consensus Peroxisomal NUDIX hydrolase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG2839 consensus Diadenosine and diphosphoinositol polyphosphate phosphohydrolase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN03143 nudix hydrolase; Provisional | Back alignment and domain information |
|---|
| >cd03431 DNA_Glycosylase_C DNA glycosylase (MutY in bacteria and hMYH in humans) is responsible for repairing misread A*oxoG residues to C*G by removing the inappropriately paired adenine base from the DNA backbone | Back alignment and domain information |
|---|
| >KOG0648 consensus Predicted NUDIX hydrolase FGF-2 and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3041 consensus Nucleoside diphosphate-sugar hydrolase of the MutT (NUDIX) family [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF14815 NUDIX_4: NUDIX domain; PDB: 1VRL_A 1RRQ_A 3G0Q_A 3FSQ_A 1RRS_A 3FSP_A | Back alignment and domain information |
|---|
| >COG4119 Predicted NTP pyrophosphohydrolase [DNA replication, recombination, and repair / General function prediction only] | Back alignment and domain information |
|---|
| >COG4112 Predicted phosphoesterase (MutT family) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4195 consensus Transient receptor potential-related channel 7 [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10880 adenine DNA glycosylase; Provisional | Back alignment and domain information |
|---|
| >PF13869 NUDIX_2: Nucleotide hydrolase; PDB: 3MDG_B 2J8Q_B 3Q2S_A 3P5T_D 3BAP_A 2CL3_A 3P6Y_A 3Q2T_B 3BHO_A 3N9U_A | Back alignment and domain information |
|---|
| >PF14443 DBC1: DBC1 | Back alignment and domain information |
|---|
| >KOG4432 consensus Uncharacterized NUDIX family hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2937 consensus Decapping enzyme complex, predicted pyrophosphatase DCP2 [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG4548 consensus Mitochondrial ribosomal protein L17 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG1689 consensus mRNA cleavage factor I subunit [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK13910 DNA glycosylase MutY; Provisional | Back alignment and domain information |
|---|
| >KOG4432 consensus Uncharacterized NUDIX family hydrolase [General function prediction only] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 192 | ||||
| 2icj_A | 233 | The Crystal Structure Of Human Isopentenyl Diphopha | 1e-52 | ||
| 2dho_A | 235 | Crystal Structure Of Human Ipp Isomerase I In Space | 3e-52 | ||
| 2i6k_A | 235 | Crystal Structure Of Human Type I Ipp Isomerase Com | 8e-52 | ||
| 2pny_A | 246 | Structure Of Human Isopentenyl-Diphosphate Delta-Is | 6e-41 | ||
| 1hzt_A | 190 | Crystal Structure Of Metal-Free Isopentenyl Diphosp | 8e-11 | ||
| 1x84_A | 189 | Ipp Isomerase (Wt) Reacted With (S)-Bromohydrine Of | 8e-11 | ||
| 1nfs_A | 183 | Structure And Mechanism Of Action Of Isopentenylpyr | 8e-11 | ||
| 1x83_A | 189 | Y104f Ipp Isomerase Reacted With (S)-Bromohydrine O | 2e-10 | ||
| 2g73_A | 183 | Y104f Mutant Type 1 Ipp Isomerase Complex With Eipp | 2e-10 | ||
| 1r67_A | 190 | Y104a Mutant Of E.coli Ipp Isomerase Length = 190 | 2e-10 | ||
| 1i9a_A | 182 | Structural Studies Of Cholesterol Biosynthesis: Mev | 2e-10 | ||
| 1q54_A | 183 | Structure And Mechanism Of Action Of Isopentenylpyr | 1e-09 | ||
| 1hx3_A | 190 | Crystal Structure Of E.Coli Isopentenyl Diphosphate | 1e-09 | ||
| 3hyq_A | 184 | Crystal Structure Of Isopentenyl-Diphosphate Delta- | 3e-08 |
| >pdb|2ICJ|A Chain A, The Crystal Structure Of Human Isopentenyl Diphophate Isomerase Length = 233 | Back alignment and structure |
|
| >pdb|2DHO|A Chain A, Crystal Structure Of Human Ipp Isomerase I In Space Group P212121 Length = 235 | Back alignment and structure |
| >pdb|2I6K|A Chain A, Crystal Structure Of Human Type I Ipp Isomerase Complexed With A Substrate Analog Length = 235 | Back alignment and structure |
| >pdb|2PNY|A Chain A, Structure Of Human Isopentenyl-Diphosphate Delta-Isomerase 2 Length = 246 | Back alignment and structure |
| >pdb|1HZT|A Chain A, Crystal Structure Of Metal-Free Isopentenyl Diphosphate:dimethylallyl Diphosphate Isomerase Length = 190 | Back alignment and structure |
| >pdb|1X84|A Chain A, Ipp Isomerase (Wt) Reacted With (S)-Bromohydrine Of Ipp Length = 189 | Back alignment and structure |
| >pdb|1NFS|A Chain A, Structure And Mechanism Of Action Of Isopentenylpyrophosphate-dimethylallylpyrophosphate Isomerase: Complex With Nipp Length = 183 | Back alignment and structure |
| >pdb|1X83|A Chain A, Y104f Ipp Isomerase Reacted With (S)-Bromohydrine Of Ipp Length = 189 | Back alignment and structure |
| >pdb|2G73|A Chain A, Y104f Mutant Type 1 Ipp Isomerase Complex With Eipp Length = 183 | Back alignment and structure |
| >pdb|1R67|A Chain A, Y104a Mutant Of E.coli Ipp Isomerase Length = 190 | Back alignment and structure |
| >pdb|1I9A|A Chain A, Structural Studies Of Cholesterol Biosynthesis: Mevalonate 5-Diphosphate Decarboxylase And Isopentenyl Diphosphate Isomerase Length = 182 | Back alignment and structure |
| >pdb|1Q54|A Chain A, Structure And Mechanism Of Action Of Isopentenylpyrophosphate-Dimethylallylpyrophosphate Isomerase: Complex With The Bromohydrine Of Ipp Length = 183 | Back alignment and structure |
| >pdb|1HX3|A Chain A, Crystal Structure Of E.Coli Isopentenyl Diphosphate:dimethylallyl Diphosphate Isomerase Length = 190 | Back alignment and structure |
| >pdb|3HYQ|A Chain A, Crystal Structure Of Isopentenyl-Diphosphate Delta-Isomerase From Salmonella Entericase Length = 184 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >2dho_A Isopentenyl-diphosphate delta-isomerase 1; alpha/beta protein; 1.60A {Homo sapiens} PDB: 2i6k_A* 2icj_A 2ick_A* Length = 235 | Back alignment and structure |
|---|
Score = 208 bits (530), Expect = 1e-68
Identities = 104/184 (56%), Positives = 140/184 (76%), Gaps = 4/184 (2%)
Query: 8 NLLHRAFSVFLFNSKYELLLQQRSGTKVTFPLVWTNTCCSHPLYRESELIEENALGVRNA 67
LLHRAFSVFLFN++ +LLLQQRS K+TFP +TNTCCSHPL +EL E +ALGVR A
Sbjct: 56 GLLHRAFSVFLFNTENKLLLQQRSDAKITFPGCFTNTCCSHPLSNPAELEESDALGVRRA 115
Query: 68 AQRKLLDELGICAEDVPVDEFTPLGRILYKAPSDGKWGEHELDYLLFIVRDVSVNPNPDE 127
AQR+L ELGI E+VP +E L RI YKA SDG WGEHE+DY+L + +V++NP+P+E
Sbjct: 116 AQRRLKAELGIPLEEVPPEEINYLTRIHYKAQSDGIWGEHEIDYILLVRMNVTLNPDPNE 175
Query: 128 VAEYKYVNREQLKELLRKADAGEEGLKLSPWFRLVVDNFLFKWWDHLEKGTLNEVIDMKT 187
+ Y YV++E+LKELL+KA +GE K++PWF+++ FLFKWWD+L LN+ +D +
Sbjct: 176 IKSYCYVSKEELKELLKKAASGEI--KITPWFKIIAATFLFKWWDNLN--HLNQFVDHEK 231
Query: 188 IHKL 191
I+++
Sbjct: 232 IYRM 235
|
| >2pny_A Isopentenyl-diphosphate delta-isomerase 2; carotenoid biosynthesis, cholesterol biosynthesis, isomerase isoprene biosynthesis, lipid synthesis; HET: GOL; 1.81A {Homo sapiens} Length = 246 | Back alignment and structure |
|---|
| >1hzt_A Isopentenyl diphosphate delta-isomerase; dimethylallyl, isoprenoids; 1.45A {Escherichia coli} SCOP: d.113.1.2 PDB: 1hx3_A 1r67_A 1x84_A* 1x83_A* 1ppv_A* 1nfz_A* 1nfs_A* 1ppw_A* 1pvf_A 2veh_A* 2vej_A 2vnp_A* 2vnq_A 2g74_A 2g73_A* 2b2k_A 1i9a_A 1q54_A* 1ow2_A* 3hyq_A* Length = 190 | Back alignment and structure |
|---|
| >1q27_A Putative nudix hydrolase DR0079; radiation resistance; NMR {Deinococcus radiodurans} SCOP: d.113.1.2 PDB: 2o5f_A Length = 171 | Back alignment and structure |
|---|
| >2fkb_A Putative nudix hydrolase YFCD; putative protein, MAD, structural genomics, escherichia coli putative nudix hydrolase, PSI; HET: MSE; 2.00A {Escherichia coli K12} SCOP: d.113.1.2 Length = 180 | Back alignment and structure |
|---|
| >3oga_A Nucleoside triphosphatase NUDI; salmonella enterica subsp. enterica serovar typhimurium STR. unknown function; HET: PO4; 1.75A {Salmonella enterica subsp} PDB: 3n77_A Length = 165 | Back alignment and structure |
|---|
| >3dup_A MUTT/nudix family protein; nudix superfamily hydrolase, hydrolase 3 family, structural protein structure initiative, PSI; HET: MSE; 1.80A {Rhodospirillum rubrum atcc 11170} Length = 300 | Back alignment and structure |
|---|
| >1xsa_A BIS(5'-nucleosyl)-tetraphosphatase; nudix enzyme, human AP4A hydrolase, alpha-beta; NMR {Homo sapiens} SCOP: d.113.1.1 PDB: 1xsb_A 1xsc_A* Length = 153 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 192 | |||
| 2pny_A | 246 | Isopentenyl-diphosphate delta-isomerase 2; caroten | 100.0 | |
| 2dho_A | 235 | Isopentenyl-diphosphate delta-isomerase 1; alpha/b | 100.0 | |
| 1hzt_A | 190 | Isopentenyl diphosphate delta-isomerase; dimethyla | 99.94 | |
| 3dup_A | 300 | MUTT/nudix family protein; nudix superfamily hydro | 99.94 | |
| 2fkb_A | 180 | Putative nudix hydrolase YFCD; putative protein, M | 99.91 | |
| 3grn_A | 153 | MUTT related protein; structural genomics, hydrola | 99.89 | |
| 1q27_A | 171 | Putative nudix hydrolase DR0079; radiation resista | 99.87 | |
| 1sjy_A | 159 | MUTT/nudix family protein; nudix fold, alpha-beta- | 99.87 | |
| 3i7u_A | 134 | AP4A hydrolase; nudix protein, diadenosine polypho | 99.86 | |
| 3oga_A | 165 | Nucleoside triphosphatase NUDI; salmonella enteric | 99.85 | |
| 3r03_A | 144 | Nudix hydrolase; structural genomics, PSI2, protei | 99.85 | |
| 2o1c_A | 150 | DATP pyrophosphohydrolase; nudix NTP hydrolase NTP | 99.85 | |
| 3exq_A | 161 | Nudix family hydrolase; protein structure initiati | 99.85 | |
| 3hhj_A | 158 | Mutator MUTT protein; niaid, ssgcid, decode, UW, S | 99.84 | |
| 1ktg_A | 138 | Diadenosine tetraphosphate hydrolase; nudix, AMP, | 99.84 | |
| 2pbt_A | 134 | AP4A hydrolase; nudix protein, diadenosine polypho | 99.84 | |
| 3gwy_A | 140 | Putative CTP pyrophosphohydrolase; structural geno | 99.84 | |
| 1rya_A | 160 | GDP-mannose mannosyl hydrolase; GDP-glucose, nudix | 99.83 | |
| 1vcd_A | 126 | NDX1; nudix protein, diadenosine polyphosphate, AP | 99.83 | |
| 3shd_A | 153 | Phosphatase NUDJ; nudix fold, nudix motif, hydrola | 99.82 | |
| 4dyw_A | 157 | MUTT/nudix family protein; structural genomics, ni | 99.82 | |
| 3eds_A | 153 | MUTT/nudix family protein; MUT/nudix protein, prot | 99.82 | |
| 2rrk_A | 140 | ORF135, CTP pyrophosphohydrolase; NMR {Escherichia | 99.82 | |
| 2azw_A | 148 | MUTT/nudix family protein; MUTT/nudix ,enterococcu | 99.82 | |
| 2b0v_A | 153 | Nudix hydrolase; structural genomics, PSI, protein | 99.82 | |
| 3u53_A | 155 | BIS(5'-nucleosyl)-tetraphosphatase [asymmetrical]; | 99.82 | |
| 2b06_A | 155 | MUTT/nudix family protein; structural genomics, P | 99.81 | |
| 3fcm_A | 197 | Hydrolase, nudix family; protein structure initiat | 99.81 | |
| 3ees_A | 153 | Probable pyrophosphohydrolase; nudix, RNA pyrophos | 99.8 | |
| 3son_A | 149 | Hypothetical nudix hydrolase; structural genomics, | 99.8 | |
| 1f3y_A | 165 | Diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase | 99.79 | |
| 2w4e_A | 145 | MUTT/nudix family protein; ADP-ribose pyrophosphat | 99.79 | |
| 2yvp_A | 182 | NDX2, MUTT/nudix family protein; nudix protein, AD | 99.79 | |
| 1v8y_A | 170 | ADP-ribose pyrophosphatase; nudix motif, loop-heli | 99.79 | |
| 3f6a_A | 159 | Hydrolase, nudix family; protein structure initiat | 99.79 | |
| 3e57_A | 211 | Uncharacterized protein TM1382; structural genomic | 99.78 | |
| 2kdv_A | 164 | RNA pyrophosphohydrolase; nudix family, magnesium, | 99.78 | |
| 3i9x_A | 187 | MUTT/nudix family protein; structural genomics, hy | 99.78 | |
| 3q93_A | 176 | 7,8-dihydro-8-oxoguanine triphosphatase; structura | 99.77 | |
| 3gg6_A | 156 | Nudix motif 18, nucleoside diphosphate-linked moie | 99.77 | |
| 1nqz_A | 194 | COA pyrophosphatase (MUTT/nudix family protein); D | 99.77 | |
| 2jvb_A | 146 | Protein PSU1, mRNA-decapping enzyme subunit 2; DCP | 99.77 | |
| 3h95_A | 199 | Nucleoside diphosphate-linked moiety X motif 6; NU | 99.76 | |
| 1mut_A | 129 | MUTT, nucleoside triphosphate pyrophosphohydrolase | 99.76 | |
| 3id9_A | 171 | MUTT/nudix family protein; hydrolase, protein stru | 99.76 | |
| 2yyh_A | 139 | MUTT domain, 8-OXO-DGTPase domain; nudix family pr | 99.76 | |
| 1x51_A | 155 | A/G-specific adenine DNA glycosylase; nudix domain | 99.75 | |
| 3fk9_A | 188 | Mutator MUTT protein; structural genomics, hydrola | 99.75 | |
| 2pqv_A | 154 | MUTT/nudix family protein; structu genomics, PSI-2 | 99.74 | |
| 1g0s_A | 209 | Hypothetical 23.7 kDa protein in ICC-TOLC intergen | 99.74 | |
| 3q1p_A | 205 | Phosphohydrolase (MUTT/nudix family protein); asym | 99.74 | |
| 1k2e_A | 156 | Nudix homolog; nudix/MUTT-like fold, mixed alpha/b | 99.73 | |
| 1vk6_A | 269 | NADH pyrophosphatase; 1790429, structural genomics | 99.73 | |
| 3cng_A | 189 | Nudix hydrolase; structural genomics, APC7497, PSI | 99.72 | |
| 3o8s_A | 206 | Nudix hydrolase, ADP-ribose pyrophosphatase; struc | 99.72 | |
| 2fb1_A | 226 | Conserved hypothetical protein; structural genomic | 99.71 | |
| 3gz5_A | 240 | MUTT/nudix family protein; DNA binding protein, nu | 99.71 | |
| 3f13_A | 163 | Putative nudix hydrolase family member; structural | 99.71 | |
| 2qjt_B | 352 | Nicotinamide-nucleotide adenylyltransferase; two i | 99.71 | |
| 1mk1_A | 207 | ADPR pyrophosphatase; nudix hydrolase, adprase, ad | 99.71 | |
| 2qjo_A | 341 | Bifunctional NMN adenylyltransferase/nudix hydrol; | 99.71 | |
| 1vhz_A | 198 | ADP compounds hydrolase NUDE; structural genomics; | 99.71 | |
| 3q91_A | 218 | Uridine diphosphate glucose pyrophosphatase; struc | 99.7 | |
| 2fvv_A | 194 | Diphosphoinositol polyphosphate phosphohydrolase 1 | 99.7 | |
| 3o6z_A | 191 | GDP-mannose pyrophosphatase NUDK; nudix, hydrolase | 99.7 | |
| 3fjy_A | 364 | Probable MUTT1 protein; dimer, protein structure i | 99.66 | |
| 3fsp_A | 369 | A/G-specific adenine glycosylase; protein-DNA comp | 99.65 | |
| 2a6t_A | 271 | SPAC19A8.12; alpha/beta/alpha, RNA binding protein | 99.63 | |
| 2fml_A | 273 | MUTT/nudix family protein; structural genomics, PS | 99.63 | |
| 2dsc_A | 212 | ADP-sugar pyrophosphatase; nudix domain, ADPR, ADP | 99.62 | |
| 3qsj_A | 232 | Nudix hydrolase; structural genomics, PSI-biology, | 99.61 | |
| 1u20_A | 212 | U8 snoRNA-binding protein X29; modified nudix hydr | 99.59 | |
| 1q33_A | 292 | Pyrophosphatase, ADP-ribose pyrophosphatase; nudix | 99.36 | |
| 2xsq_A | 217 | U8 snoRNA-decapping enzyme; hydrolase, mRNA decapp | 99.34 | |
| 3kvh_A | 214 | Protein syndesmos; NUDT16-like, NUDT16L1, nudix, R | 98.89 | |
| 3rh7_A | 321 | Hypothetical oxidoreductase; FMN-binding split bar | 98.88 | |
| 3bho_A | 208 | Cleavage and polyadenylation specificity factor su | 98.75 |
| >2pny_A Isopentenyl-diphosphate delta-isomerase 2; carotenoid biosynthesis, cholesterol biosynthesis, isomerase isoprene biosynthesis, lipid synthesis; HET: GOL; 1.81A {Homo sapiens} | Back alignment and structure |
|---|
Probab=100.00 E-value=8.2e-37 Score=254.44 Aligned_cols=176 Identities=44% Similarity=0.853 Sum_probs=153.0
Q ss_pred cCCcceEEEEEEEEeCCceEEEeeecCCCCCCCCCccccccccCCCC------CChhhhhhhhcHHHHHHHHHHHHhCCC
Q 029516 6 SLNLLHRAFSVFLFNSKYELLLQQRSGTKVTFPLVWTNTCCSHPLYR------ESELIEENALGVRNAAQRKLLDELGIC 79 (192)
Q Consensus 6 ~~~~~h~av~v~i~~~~~~lLL~~R~~~k~~~pg~W~~p~gG~ve~g------Es~~~~~~~~~~~eaa~REl~EEtGl~ 79 (192)
+.+++|++|+++|+|++|+|||+||+..|..+||.|++|+|||+++| |++ +|+.+||+||+.|||||.
T Consensus 65 ~~g~~h~av~v~v~~~~g~lLLqrRs~~K~~~pG~W~~p~gG~v~~G~~E~~~Et~------~~~~eAA~REl~EElGi~ 138 (246)
T 2pny_A 65 EKGLLHRAFSVVLFNTKNRILIQQRSDTKVTFPGYFTDSCSSHPLYNPAELEEKDA------IGVRRAAQRRLQAELGIP 138 (246)
T ss_dssp TTTCCEEEEEEEEECTTCCEEEEEECTTCSSSTTCBCCSEEECCBSSHHHHCCGGG------HHHHHHHHHHHHHHHCCC
T ss_pred CCCcEEEEEEEEEEeCCCEEEEEEecCCCCCCCCceEeccCceeccCCcccccccc------hhHHHHHHHHHHHHHCCC
Confidence 67899999999999999999999999999899999999988999999 772 223899999999999999
Q ss_pred CCCCCCCceeeeeEEEEEccCCCCcceeEEEEEEEEeeCCccCCCccccccEEEecHHHHHHHHHhhcCCCCCcccChhH
Q 029516 80 AEDVPVDEFTPLGRILYKAPSDGKWGEHELDYLLFIVRDVSVNPNPDEVAEYKYVNREQLKELLRKADAGEEGLKLSPWF 159 (192)
Q Consensus 80 ~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~f~~~~~~~~~~~~~Ev~~~~Wv~~~el~~~~~~~~~~~~~~~~~p~~ 159 (192)
+..+.++++.+++.+.|..+..+++.+++++++|++..+..+.++++|+.+++|++++++.+++...+. .+..|+||+
T Consensus 139 ~~~v~~~~l~~l~~~~y~~~~~~~~~~~e~~~vf~~~~~~~~~~~~~Ev~~~~wv~~eel~~~l~~~~~--~~~~ftp~~ 216 (246)
T 2pny_A 139 GEQISPEDIVFMTIYHHKAKSDRIWGEHEICYLLLVRKNVTLNPDPSETKSILYLSQEELWELLEREAR--GEVKVTPWL 216 (246)
T ss_dssp TTTCCGGGSEEEEEEEEEEESSSSBEEEEEEEEEEEECCCCCCCCTTTEEEEEEECHHHHHHHHHHHHH--TSSCBCHHH
T ss_pred ccccCccccEEEEEEEEEecCCCceeeeEEEEEEEEEECCCCCCChHHeeEEEEEeHHHHHHHHHhccC--CCceECHhH
Confidence 875555567888988888776667777888899988777677788899999999999999999887310 135899999
Q ss_pred HHHHHHHHHHHHHHhcccccccccCCCceeec
Q 029516 160 RLVVDNFLFKWWDHLEKGTLNEVIDMKTIHKL 191 (192)
Q Consensus 160 ~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~ 191 (192)
+.++++|+..||+.+.+ |+++.|+++||++
T Consensus 217 ~~i~~~~l~~ww~~~~~--~~~~~~~~~~~~~ 246 (246)
T 2pny_A 217 RTIAERFLYRWWPHLDD--VTPFVELHKIHRV 246 (246)
T ss_dssp HHHHHHTHHHHGGGTTC--CGGGCCSSCCEEC
T ss_pred HHHHHHHHHHHHHhhhh--hhhccCccceeeC
Confidence 99999999999999998 9999999999986
|
| >2dho_A Isopentenyl-diphosphate delta-isomerase 1; alpha/beta protein; 1.60A {Homo sapiens} PDB: 2i6k_A* 2icj_A 2ick_A* | Back alignment and structure |
|---|
| >1hzt_A Isopentenyl diphosphate delta-isomerase; dimethylallyl, isoprenoids; 1.45A {Escherichia coli} SCOP: d.113.1.2 PDB: 1hx3_A 1r67_A 1x84_A* 1x83_A* 1ppv_A* 1nfz_A* 1nfs_A* 1ppw_A* 1pvf_A 2veh_A* 2vej_A 2vnp_A* 2vnq_A 2g74_A 2g73_A* 2b2k_A 1i9a_A 1q54_A* 1ow2_A* 3hyq_A* | Back alignment and structure |
|---|
| >3dup_A MUTT/nudix family protein; nudix superfamily hydrolase, hydrolase 3 family, structural protein structure initiative, PSI; HET: MSE; 1.80A {Rhodospirillum rubrum atcc 11170} | Back alignment and structure |
|---|
| >2fkb_A Putative nudix hydrolase YFCD; putative protein, MAD, structural genomics, escherichia coli putative nudix hydrolase, PSI; HET: MSE; 2.00A {Escherichia coli K12} SCOP: d.113.1.2 | Back alignment and structure |
|---|
| >3grn_A MUTT related protein; structural genomics, hydrolase, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 1.70A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >1q27_A Putative nudix hydrolase DR0079; radiation resistance; NMR {Deinococcus radiodurans} SCOP: d.113.1.2 PDB: 2o5f_A | Back alignment and structure |
|---|
| >1sjy_A MUTT/nudix family protein; nudix fold, alpha-beta-alpha sandwich, structural genomics, BSGC structure funded by NIH; 1.39A {Deinococcus radiodurans} SCOP: d.113.1.1 PDB: 1soi_A 1su2_A* 1sz3_A* | Back alignment and structure |
|---|
| >3i7u_A AP4A hydrolase; nudix protein, diadenosine polyphosphate, S genomics, NPPSFA, national project on protein structural AN functional analyses; HET: PGE PG4; 1.80A {Aquifex aeolicus} PDB: 3i7v_A* | Back alignment and structure |
|---|
| >3oga_A Nucleoside triphosphatase NUDI; salmonella enterica subsp. enterica serovar typhimurium STR. unknown function; HET: PO4; 1.75A {Salmonella enterica subsp} PDB: 3n77_A | Back alignment and structure |
|---|
| >3r03_A Nudix hydrolase; structural genomics, PSI2, protein structure INIT NEW YORK SGX research center for structural genomics, nysgx; HET: ADP; 2.49A {Rhodospirillum rubrum} SCOP: d.113.1.0 | Back alignment and structure |
|---|
| >2o1c_A DATP pyrophosphohydrolase; nudix NTP hydrolase NTP pyrophosphohydrolase MUTT dihydroneo triphosphate pyrophosphohydrolase folate biosynthesis; 1.80A {Escherichia coli} PDB: 2o5w_A | Back alignment and structure |
|---|
| >3exq_A Nudix family hydrolase; protein structure initiative II(PSI II), NYSGXRC, 11180K, structural genomics; 2.00A {Lactobacillus brevis atcc 367} | Back alignment and structure |
|---|
| >3hhj_A Mutator MUTT protein; niaid, ssgcid, decode, UW, SBRI, infectious diseases, hydrol structural genomics; 2.10A {Bartonella henselae} | Back alignment and structure |
|---|
| >1ktg_A Diadenosine tetraphosphate hydrolase; nudix, AMP, magnesium cluster; HET: AMP; 1.80A {Caenorhabditis elegans} SCOP: d.113.1.1 PDB: 1kt9_A* | Back alignment and structure |
|---|
| >3gwy_A Putative CTP pyrophosphohydrolase; structural genomics, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Bacteroides fragilis} SCOP: d.113.1.0 | Back alignment and structure |
|---|
| >1rya_A GDP-mannose mannosyl hydrolase; GDP-glucose, nudix, nudix Mg-complex; HET: GDP; 1.30A {Escherichia coli} SCOP: d.113.1.5 PDB: 2gt2_A 2gt4_A* 2i8t_A* 2i8u_A* | Back alignment and structure |
|---|
| >1vcd_A NDX1; nudix protein, diadenosine polyphosphate, AP6A, thermus THER HB8, hydrolase, riken structural genomics/proteomics initia RSGI; 1.70A {Thermus thermophilus} SCOP: d.113.1.1 PDB: 1vc8_A 1vc9_A* | Back alignment and structure |
|---|
| >3shd_A Phosphatase NUDJ; nudix fold, nudix motif, hydrolase, (D)NDP/(D)NTP binding, dephosphorylation; 2.50A {Escherichia coli} PDB: 3dku_A | Back alignment and structure |
|---|
| >4dyw_A MUTT/nudix family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >2rrk_A ORF135, CTP pyrophosphohydrolase; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >2azw_A MUTT/nudix family protein; MUTT/nudix ,enterococcus faecalis, structural genomics, PSI, structure initiative; HET: 1PE; 1.90A {Enterococcus faecalis} SCOP: d.113.1.1 | Back alignment and structure |
|---|
| >2b0v_A Nudix hydrolase; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG, U function; 1.55A {Nitrosomonas europaea} SCOP: d.113.1.1 | Back alignment and structure |
|---|
| >3u53_A BIS(5'-nucleosyl)-tetraphosphatase [asymmetrical]; hydrolase; 2.71A {Homo sapiens} PDB: 1xsa_A 1xsb_A 1xsc_A* | Back alignment and structure |
|---|
| >2b06_A MUTT/nudix family protein; structural genomics, P protein structure initiative, midwest center for structural genomics, MCSG; 1.40A {Streptococcus pneumoniae} SCOP: d.113.1.1 | Back alignment and structure |
|---|
| >3fcm_A Hydrolase, nudix family; protein structure initiative II(PSI II), NYSGXRC, 11180J, structural genomics; 2.20A {Clostridium perfringens atcc 13124} | Back alignment and structure |
|---|
| >3ees_A Probable pyrophosphohydrolase; nudix, RNA pyrophosphohydrolase; 1.90A {Bdellovibrio bacteriovorus} PDB: 3eeu_A 3ef5_A* 3ffu_A* | Back alignment and structure |
|---|
| >3son_A Hypothetical nudix hydrolase; structural genomics, joint center for structural GENO JCSG, protein structure initiative, PSI-biology; HET: MSE; 1.71A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1f3y_A Diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase; enzyme,mixed 4-stranded beta sheet, 2-stranded antiparallel sheet; NMR {Lupinus angustifolius} SCOP: d.113.1.1 PDB: 1jkn_A* | Back alignment and structure |
|---|
| >2w4e_A MUTT/nudix family protein; ADP-ribose pyrophosphatase, hydrolase; 2.00A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >2yvp_A NDX2, MUTT/nudix family protein; nudix protein, ADP-ribose, FAD, hydrol structural genomics, NPPSFA; HET: RBY; 1.66A {Thermus thermophilus} PDB: 2yvn_A 2yvm_A* 2yvo_A* | Back alignment and structure |
|---|
| >1v8y_A ADP-ribose pyrophosphatase; nudix motif, loop-helix-loop, MUTT family, riken structural genomics/proteomics initiative, RSGI; HET: APR; 1.65A {Thermus thermophilus} SCOP: d.113.1.1 PDB: 1v8v_A* 1v8n_A 1v8l_A* 1v8m_A* 1v8i_A 1v8r_A* 1v8s_A* 1v8t_A* 1v8w_A 1v8u_A | Back alignment and structure |
|---|
| >3f6a_A Hydrolase, nudix family; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.02A {Clostridium perfringens atcc 13124} | Back alignment and structure |
|---|
| >3e57_A Uncharacterized protein TM1382; structural genomics, nudix hydrolase, PSI-2, protein structure initiative; 1.89A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2kdv_A RNA pyrophosphohydrolase; nudix family, magnesium, manganese, zinc; NMR {Escherichia coli} PDB: 2kdw_A | Back alignment and structure |
|---|
| >3i9x_A MUTT/nudix family protein; structural genomics, hydrolase, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 2.20A {Listeria innocua} | Back alignment and structure |
|---|
| >3q93_A 7,8-dihydro-8-oxoguanine triphosphatase; structural genomics, structural genomics consortium, SGC, NU MUTT-like, hydrolase, magnesium binding; 1.80A {Homo sapiens} PDB: 1iry_A 3zr0_A* 3zr1_A | Back alignment and structure |
|---|
| >3gg6_A Nudix motif 18, nucleoside diphosphate-linked moiety X motif 18; NUDT18, NXR1, nucleotide hydrolase, hydrolase, structural genomics; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1nqz_A COA pyrophosphatase (MUTT/nudix family protein); D.radiodurans, hydrolase; 1.70A {Deinococcus radiodurans} SCOP: d.113.1.1 PDB: 1nqy_A | Back alignment and structure |
|---|
| >2jvb_A Protein PSU1, mRNA-decapping enzyme subunit 2; DCP2, mRNA decay, cytoplasm, hydrolase, manganese, metal-binding, mRNA processing; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3h95_A Nucleoside diphosphate-linked moiety X motif 6; NUDT6, nudix, hydrolase, GFG, GFG-1, FGF2AS, structural GENO structural genomics consortium, SGC; HET: FLC; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1mut_A MUTT, nucleoside triphosphate pyrophosphohydrolase; DNA repair; NMR {Escherichia coli} SCOP: d.113.1.1 PDB: 1ppx_A* 1pun_A* 1puq_A* 1pus_A* 1tum_A* 3a6s_A* 3a6t_A* 3a6u_A* 3a6v_A* | Back alignment and structure |
|---|
| >3id9_A MUTT/nudix family protein; hydrolase, protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.55A {Bacillus thuringiensis str} | Back alignment and structure |
|---|
| >2yyh_A MUTT domain, 8-OXO-DGTPase domain; nudix family protein, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.80A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1x51_A A/G-specific adenine DNA glycosylase; nudix domain, DNA repair, alpha-3 isoform, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.113.1.3 | Back alignment and structure |
|---|
| >3fk9_A Mutator MUTT protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.50A {Bacillus halodurans} | Back alignment and structure |
|---|
| >2pqv_A MUTT/nudix family protein; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 1.63A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >1g0s_A Hypothetical 23.7 kDa protein in ICC-TOLC intergenic region; nudix fold, hydrolase; 1.90A {Escherichia coli} SCOP: d.113.1.1 PDB: 1g9q_A* 1ga7_A 1khz_A* 1viq_A | Back alignment and structure |
|---|
| >3q1p_A Phosphohydrolase (MUTT/nudix family protein); asymmetric dimer, RNA exonuclease, CDP-CHO pyrophosphatase; 1.80A {Bacillus cereus} PDB: 3q4i_A | Back alignment and structure |
|---|
| >1k2e_A Nudix homolog; nudix/MUTT-like fold, mixed alpha/beta, dimer, putative NUDI hydrolase, structural genomics, unknown function; 1.80A {Pyrobaculum aerophilum} SCOP: d.113.1.1 PDB: 1jrk_A 1k26_A | Back alignment and structure |
|---|
| >1vk6_A NADH pyrophosphatase; 1790429, structural genomics, JCSG, PS protein structure initiative, joint center for structural G hydrolase; HET: MSE; 2.20A {Escherichia coli} SCOP: d.113.1.4 d.113.1.4 g.41.14.1 PDB: 2gb5_A | Back alignment and structure |
|---|
| >3cng_A Nudix hydrolase; structural genomics, APC7497, PSI-2, protei structure initiative; 2.00A {Nitrosomonas europaea atcc 19718} | Back alignment and structure |
|---|
| >3o8s_A Nudix hydrolase, ADP-ribose pyrophosphatase; structural genomics, joint center for structural genomics, J protein structure initiative; 2.27A {Streptococcus suis} | Back alignment and structure |
|---|
| >2fb1_A Conserved hypothetical protein; structural genomics, PSI, protein STRU initiative, midwest center for structural genomics, MCSG; 2.50A {Bacteroides thetaiotaomicron} SCOP: a.4.5.68 d.113.1.6 | Back alignment and structure |
|---|
| >3gz5_A MUTT/nudix family protein; DNA binding protein, nudix domain, WHTH domain; 2.20A {Shewanella oneidensis} PDB: 3gz6_A* 3gz8_A* | Back alignment and structure |
|---|
| >3f13_A Putative nudix hydrolase family member; structural genomics, PSI-2, protein structure initiative; 1.70A {Chromobacterium violaceum} | Back alignment and structure |
|---|
| >2qjt_B Nicotinamide-nucleotide adenylyltransferase; two individual domains, hydrolase; HET: AMP; 2.30A {Francisella tularensis} PDB: 2r5w_B | Back alignment and structure |
|---|
| >1mk1_A ADPR pyrophosphatase; nudix hydrolase, adprase, adenosine DI ribose, RV1700, hydrolase; HET: APR; 2.00A {Mycobacterium tuberculosis} SCOP: d.113.1.1 PDB: 1mp2_A 1mqe_A* 1mqw_A* 1mr2_A* | Back alignment and structure |
|---|
| >2qjo_A Bifunctional NMN adenylyltransferase/nudix hydrol; two individual domains, hydrolase; HET: APR NAD; 2.60A {Synechocystis SP} | Back alignment and structure |
|---|
| >1vhz_A ADP compounds hydrolase NUDE; structural genomics; HET: APR; 2.32A {Escherichia coli} SCOP: d.113.1.1 PDB: 1vhg_A* | Back alignment and structure |
|---|
| >3q91_A Uridine diphosphate glucose pyrophosphatase; structural genomics, structural genomics consortium, SGC, NU MUTT-like, hydrolase, magnesium binding; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2fvv_A Diphosphoinositol polyphosphate phosphohydrolase 1; nudix, inositol polyphosphate metabolism, structural genomics, structural genomics consortium; HET: IHP; 1.25A {Homo sapiens} SCOP: d.113.1.1 PDB: 2q9p_A* 2duk_A 3mcf_A* | Back alignment and structure |
|---|
| >3o6z_A GDP-mannose pyrophosphatase NUDK; nudix, hydrolase, biofilm; 2.05A {Escherichia coli} SCOP: d.113.1.1 PDB: 3o52_A* 1viu_A 3o69_A 3o61_A | Back alignment and structure |
|---|
| >3fjy_A Probable MUTT1 protein; dimer, protein structure initiative II), NYSGXRC, 11181H, structural genomics; 2.15A {Bifidobacterium adolescentis atcc 1570ORGANISM_TAXID} | Back alignment and structure |
|---|
| >3fsp_A A/G-specific adenine glycosylase; protein-DNA complex, DNA glycosylase, transition state analog, DNA repair; HET: NRI; 2.20A {Geobacillus stearothermophilus} PDB: 3fsq_A* 1rrs_A* 1vrl_A* 1rrq_A* 3g0q_A* | Back alignment and structure |
|---|
| >2a6t_A SPAC19A8.12; alpha/beta/alpha, RNA binding protein,hydrolase; 2.50A {Schizosaccharomyces pombe} SCOP: a.242.1.1 d.113.1.7 PDB: 2qkm_B* | Back alignment and structure |
|---|
| >2fml_A MUTT/nudix family protein; structural genomics, PSI, protein structure initiative, midwest center structural genomics, MCSG; 2.26A {Enterococcus faecalis} SCOP: a.4.5.68 d.113.1.6 | Back alignment and structure |
|---|
| >2dsc_A ADP-sugar pyrophosphatase; nudix domain, ADPR, ADP-ribose pyrophosphatase, NUDT5, hydrolase; HET: APR; 2.00A {Homo sapiens} PDB: 2dsd_A* 3bm4_A* 2dsb_A 3aca_A* 3ac9_A* 3l85_A* | Back alignment and structure |
|---|
| >3qsj_A Nudix hydrolase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 1.70A {Alicyclobacillus acidocaldarius subsp} | Back alignment and structure |
|---|
| >1u20_A U8 snoRNA-binding protein X29; modified nudix hydrolase fold, hydrolase; 2.10A {Xenopus laevis} SCOP: d.113.1.1 PDB: 2a8t_A* 2a8q_A* 2a8p_A* 2a8r_A* 2a8s_A* | Back alignment and structure |
|---|
| >1q33_A Pyrophosphatase, ADP-ribose pyrophosphatase; nudix fold, hydrolase; HET: BGC; 1.81A {Homo sapiens} SCOP: d.113.1.1 PDB: 1qvj_A* | Back alignment and structure |
|---|
| >2xsq_A U8 snoRNA-decapping enzyme; hydrolase, mRNA decapping, mRNA turnover, structural genomic consortium, SGC; HET: IMP; 1.72A {Homo sapiens} PDB: 3cou_A 3mgm_A | Back alignment and structure |
|---|
| >3kvh_A Protein syndesmos; NUDT16-like, NUDT16L1, nudix, RNA regulation, RNA structural genomics consortium, SGC, RNA degradation, RNA B protein; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3rh7_A Hypothetical oxidoreductase; FMN-binding split barrel, nudix, structural genomics, joint for structural genomics, JCSG; HET: FMN; 3.00A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3bho_A Cleavage and polyadenylation specificity factor subunit 5; CPSF5, RNA processing, cleavage factor, diadenosine tetraphosphate, mRNA processing; HET: B4P; 1.80A {Homo sapiens} PDB: 3bap_A 3mdg_A 3mdi_A 2cl3_A 3n9u_A 3q2s_A 3q2t_A 2j8q_A 3p5t_A 3p6y_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 192 | ||||
| d1hzta_ | 153 | d.113.1.2 (A:) Isopentenyl diphosphate isomerase { | 4e-25 | |
| d2fkba1 | 161 | d.113.1.2 (A:8-168) Hypothetical protein YfcD {Esc | 2e-16 | |
| d2o5fa1 | 162 | d.113.1.2 (A:7-168) Hypothetical protein DR0079 {D | 1e-13 | |
| d1sjya_ | 158 | d.113.1.1 (A:) Hypothetical protein DR1025 {Deinoc | 4e-07 | |
| d1ryaa_ | 160 | d.113.1.5 (A:) GDP-mannose mannosyl hydrolase NudD | 3e-05 |
| >d1hzta_ d.113.1.2 (A:) Isopentenyl diphosphate isomerase {Escherichia coli [TaxId: 562]} Length = 153 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Nudix superfamily: Nudix family: IPP isomerase-like domain: Isopentenyl diphosphate isomerase species: Escherichia coli [TaxId: 562]
Score = 93.4 bits (231), Expect = 4e-25
Identities = 42/167 (25%), Positives = 67/167 (40%), Gaps = 19/167 (11%)
Query: 10 LHRAFSVFLFNSKYELLLQQRSGTKVTFPLVWTNTCCSHPLYRESELIEENALGVRNAAQ 69
LH AFS +LFN+K +LL+ +R+ +K +P VWTN+ C HP ES +A
Sbjct: 1 LHLAFSSWLFNAKGQLLVTRRALSKKAWPGVWTNSVCGHPQLGES---------NEDAVI 51
Query: 70 RKLLDELGICAEDVPVDEFTPLGRILYKAPSDGKWGEHELDYLLFIVRDVSVNPNPDEVA 129
R+ ELG+ Y+A E+E+ + ++ N DEV
Sbjct: 52 RRCRYELGVEITPPESIYP----DFRYRATDPSGIVENEVCPVFAARTTSALQINDDEVM 107
Query: 130 EYKYVNREQLKELLRKADAGEEGLKLSPWFRLVVDNF-LFKWWDHLE 175
+Y++ + + + SPW + N K
Sbjct: 108 DYQWCDLADVLHGID-----ATPWAFSPWMVMQATNREARKRLSAFT 149
|
| >d2fkba1 d.113.1.2 (A:8-168) Hypothetical protein YfcD {Escherichia coli [TaxId: 562]} Length = 161 | Back information, alignment and structure |
|---|
| >d2o5fa1 d.113.1.2 (A:7-168) Hypothetical protein DR0079 {Deinococcus radiodurans str. R1 (Deinococcus radiodurans R1) [TaxId: 243230]} Length = 162 | Back information, alignment and structure |
|---|
| >d1sjya_ d.113.1.1 (A:) Hypothetical protein DR1025 {Deinococcus radiodurans [TaxId: 1299]} Length = 158 | Back information, alignment and structure |
|---|
| >d1ryaa_ d.113.1.5 (A:) GDP-mannose mannosyl hydrolase NudD {Escherichia coli [TaxId: 562]} Length = 160 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 192 | |||
| d1hzta_ | 153 | Isopentenyl diphosphate isomerase {Escherichia col | 99.97 | |
| d2fkba1 | 161 | Hypothetical protein YfcD {Escherichia coli [TaxId | 99.96 | |
| d2o5fa1 | 162 | Hypothetical protein DR0079 {Deinococcus radiodura | 99.95 | |
| d1sjya_ | 158 | Hypothetical protein DR1025 {Deinococcus radiodura | 99.88 | |
| d1vcda1 | 126 | AP6A hydrolase Ndx1 {Thermus thermophilus [TaxId: | 99.87 | |
| d2b0va1 | 146 | Hypothetical protein NE0184 {Nitrosomonas europaea | 99.85 | |
| d1ryaa_ | 160 | GDP-mannose mannosyl hydrolase NudD {Escherichia c | 99.85 | |
| d1puna_ | 129 | Nucleoside triphosphate pyrophosphorylase (MutT) { | 99.85 | |
| d1jkna_ | 165 | Diadenosine tetraphosphate hydrolase (Ap4A hydrola | 99.83 | |
| d1vk6a2 | 131 | NADH pyrophosphatase {Escherichia coli [TaxId: 562 | 99.83 | |
| d2b06a1 | 155 | Hypothetical protein SP1235 (spr1115) {Streptococc | 99.82 | |
| d1ktga_ | 137 | Diadenosine tetraphosphate hydrolase (Ap4A hydrola | 99.8 | |
| d1irya_ | 156 | 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Hum | 99.8 | |
| d2azwa1 | 147 | Hypothetical protein EF1141 {Enterococcus faecalis | 99.78 | |
| d1nqza_ | 187 | Coenzyme A pyrophosphatase {Deinococcus radioduran | 99.77 | |
| d2fvva1 | 135 | Diphosphoinositol polyphosphate phosphohydrolase { | 99.76 | |
| d2a6ta2 | 151 | mRNA decapping enzyme Dcp2p catalytic domain {Schi | 99.75 | |
| d1xsba_ | 153 | Diadenosine tetraphosphate hydrolase (Ap4A hydrola | 99.75 | |
| d2fb1a2 | 147 | Hypothetical protein BT0354, N-terminal domain {Ba | 99.74 | |
| d1k2ea_ | 152 | Hypothetical protein PAE3301 {Archaeon Pyrobaculum | 99.72 | |
| d1v8ya_ | 158 | ADP-ribose pyrophosphatase {Thermus thermophilus [ | 99.72 | |
| d2fmla2 | 202 | Hypothetical protein EF2700, N-terminal domain {En | 99.66 | |
| d1vhza_ | 186 | ADP compounds hydrolase NudE {Escherichia coli [Ta | 99.66 | |
| d1mqea_ | 202 | ADP-ribose pyrophosphatase {Mycobacterium tubercul | 99.62 | |
| d1rrqa2 | 127 | Adenine glycosylase MutY, C-terminal domain {Bacil | 99.61 | |
| d1g0sa_ | 209 | ADP-ribose pyrophosphatase {Escherichia coli [TaxI | 99.6 | |
| d1viua_ | 189 | ADP-ribose pyrophosphatase homologue YffH {Escheri | 99.44 | |
| d1u20a1 | 196 | U8 snorna-binding protein x29 {African clawed frog | 99.43 | |
| d1x51a1 | 142 | A/G-specific adenine DNA glycosylase {Human (Homo | 99.41 | |
| d1q33a_ | 292 | NUDT9 (mitochondrial ADP-ribose pyrophosphatase) { | 99.21 |
| >d1hzta_ d.113.1.2 (A:) Isopentenyl diphosphate isomerase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Nudix superfamily: Nudix family: IPP isomerase-like domain: Isopentenyl diphosphate isomerase species: Escherichia coli [TaxId: 562]
Probab=99.97 E-value=1.4e-31 Score=206.04 Aligned_cols=139 Identities=29% Similarity=0.441 Sum_probs=115.5
Q ss_pred ceEEEEEEEEeCCceEEEeeecCCCCCCCCCccccccccCCCCCChhhhhhhhcHHHHHHHHHHHHhCCCCCCCCCCcee
Q 029516 10 LHRAFSVFLFNSKYELLLQQRSGTKVTFPLVWTNTCCSHPLYRESELIEENALGVRNAAQRKLLDELGICAEDVPVDEFT 89 (192)
Q Consensus 10 ~h~av~v~i~~~~~~lLL~~R~~~k~~~pg~W~~p~gG~ve~gEs~~~~~~~~~~~eaa~REl~EEtGl~~~~~~~~~l~ 89 (192)
+|+||+|+|+|++|++||+||+..|..+||.|++++|||+++||| +.+||+||+.|||||++.... .
T Consensus 1 lHra~~v~i~n~~g~vLl~kRs~~k~~~pg~w~~~pgG~ve~gEt---------~~eaa~RE~~EE~Gi~~~~~~---~- 67 (153)
T d1hzta_ 1 LHLAFSSWLFNAKGQLLVTRRALSKKAWPGVWTNSVCGHPQLGES---------NEDAVIRRCRYELGVEITPPE---S- 67 (153)
T ss_dssp CEECEEEEEECTTCCEEEEEECTTCSSSTTCEEESEEECCCTTCC---------HHHHHHHHHHHHHCCCBSCCE---E-
T ss_pred CceEEEEEEEECCCEEEEEEeCCCCCCCCCceecccCceeecCCc---------HHHHHHHHHHHHcCceeeccc---c-
Confidence 599999999999999999999999999999999966999999999 899999999999999876431 1
Q ss_pred eeeEEEEEccCCCCcceeEEEEEEEEeeCCccCCCccccccEEEecHHHHHHHHHhhcCCCCCcccChhHHHHHHHH
Q 029516 90 PLGRILYKAPSDGKWGEHELDYLLFIVRDVSVNPNPDEVAEYKYVNREQLKELLRKADAGEEGLKLSPWFRLVVDNF 166 (192)
Q Consensus 90 ~~~~~~~~~~~~~~~~~~~~~~~f~~~~~~~~~~~~~Ev~~~~Wv~~~el~~~~~~~~~~~~~~~~~p~~~~~~~~~ 166 (192)
....+.|....+++...+.++++|.+..+..+.++++|+++++|++++||.+++..+ |..|+|||+..+.+.
T Consensus 68 ~~~~~~y~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Ev~~~~W~~~~el~~~i~~~-----p~~~tpW~~~~~~~~ 139 (153)
T d1hzta_ 68 IYPDFRYRATDPSGIVENEVCPVFAARTTSALQINDDEVMDYQWCDLADVLHGIDAT-----PWAFSPWMVMQATNR 139 (153)
T ss_dssp EETTCEEEEECTTSCEEEEECCEEEEEBCSCCCCCTTTEEEEEEECHHHHHHHHHHC-----GGGBCHHHHHHHHSH
T ss_pred eeccccccccccccccceeEEEEEEEeeCCCccCChhheeEEEEeeHHHHHHHHHcC-----CcccCHHHHHHHhhH
Confidence 122344555544555556666777777777888898999999999999999999875 689999999887753
|
| >d2fkba1 d.113.1.2 (A:8-168) Hypothetical protein YfcD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2o5fa1 d.113.1.2 (A:7-168) Hypothetical protein DR0079 {Deinococcus radiodurans str. R1 (Deinococcus radiodurans R1) [TaxId: 243230]} | Back information, alignment and structure |
|---|
| >d1sjya_ d.113.1.1 (A:) Hypothetical protein DR1025 {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d1vcda1 d.113.1.1 (A:1-126) AP6A hydrolase Ndx1 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2b0va1 d.113.1.1 (A:4-149) Hypothetical protein NE0184 {Nitrosomonas europaea [TaxId: 915]} | Back information, alignment and structure |
|---|
| >d1ryaa_ d.113.1.5 (A:) GDP-mannose mannosyl hydrolase NudD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1puna_ d.113.1.1 (A:) Nucleoside triphosphate pyrophosphorylase (MutT) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jkna_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Narrow-leaved blue lupine (Lupinus angustifolius) [TaxId: 3871]} | Back information, alignment and structure |
|---|
| >d1vk6a2 d.113.1.4 (A:126-256) NADH pyrophosphatase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2b06a1 d.113.1.1 (A:1-155) Hypothetical protein SP1235 (spr1115) {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1ktga_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1irya_ d.113.1.1 (A:) 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2azwa1 d.113.1.1 (A:2-148) Hypothetical protein EF1141 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1nqza_ d.113.1.1 (A:) Coenzyme A pyrophosphatase {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d2fvva1 d.113.1.1 (A:8-142) Diphosphoinositol polyphosphate phosphohydrolase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2a6ta2 d.113.1.7 (A:95-245) mRNA decapping enzyme Dcp2p catalytic domain {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1xsba_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fb1a2 d.113.1.6 (A:3-149) Hypothetical protein BT0354, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d1k2ea_ d.113.1.1 (A:) Hypothetical protein PAE3301 {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1v8ya_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2fmla2 d.113.1.6 (A:3-204) Hypothetical protein EF2700, N-terminal domain {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1vhza_ d.113.1.1 (A:) ADP compounds hydrolase NudE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1mqea_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1rrqa2 d.113.1.3 (A:234-360) Adenine glycosylase MutY, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1g0sa_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1viua_ d.113.1.1 (A:) ADP-ribose pyrophosphatase homologue YffH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1u20a1 d.113.1.1 (A:14-209) U8 snorna-binding protein x29 {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1x51a1 d.113.1.3 (A:8-149) A/G-specific adenine DNA glycosylase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q33a_ d.113.1.1 (A:) NUDT9 (mitochondrial ADP-ribose pyrophosphatase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|