Citrus Sinensis ID: 029636
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 190 | ||||||
| 225433764 | 220 | PREDICTED: uncharacterized protein LOC10 | 0.963 | 0.831 | 0.605 | 2e-49 | |
| 224131566 | 190 | predicted protein [Populus trichocarpa] | 0.957 | 0.957 | 0.647 | 1e-48 | |
| 255580394 | 211 | conserved hypothetical protein [Ricinus | 0.963 | 0.867 | 0.564 | 1e-47 | |
| 224065024 | 188 | predicted protein [Populus trichocarpa] | 0.868 | 0.877 | 0.645 | 6e-46 | |
| 414877709 | 209 | TPA: hypothetical protein ZEAMMB73_85904 | 0.910 | 0.827 | 0.435 | 3e-33 | |
| 357160394 | 215 | PREDICTED: uncharacterized protein LOC10 | 0.963 | 0.851 | 0.402 | 5e-30 | |
| 219363323 | 224 | hypothetical protein [Zea mays] gi|19469 | 0.973 | 0.825 | 0.429 | 2e-29 | |
| 326487586 | 227 | predicted protein [Hordeum vulgare subsp | 0.847 | 0.709 | 0.4 | 3e-28 | |
| 125536178 | 223 | hypothetical protein OsI_37886 [Oryza sa | 0.968 | 0.825 | 0.417 | 4e-28 | |
| 108862372 | 225 | WW domain containing protein, expressed | 0.968 | 0.817 | 0.413 | 6e-28 |
| >gi|225433764|ref|XP_002271254.1| PREDICTED: uncharacterized protein LOC100251518 [Vitis vinifera] gi|297745164|emb|CBI39156.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 201 bits (510), Expect = 2e-49, Method: Compositional matrix adjust.
Identities = 121/200 (60%), Positives = 147/200 (73%), Gaps = 17/200 (8%)
Query: 2 VMELTELSLAPTHCVVVDKSNSSSESE---DNPSRKRKFLSDFSLLKTEPAIQTSVDLQI 58
+ME ELSLAP+ VDKS +SS SE + PS+KRKF SD +++P IQTSVDLQ+
Sbjct: 27 IMEFPELSLAPSPRHGVDKSTNSSSSESEANYPSKKRKF-SDHLFNRSDPMIQTSVDLQL 85
Query: 59 KDPLPLDWERCLDLQSGRMYYFNRKSSKKSWSLPE--NKQKLDLELNISSSSVSNCTSAA 116
KDPLPLDWE+CLDL+SGRMYY NRK+ +KSW+ P+ N+QKLDLELNI S++SNC
Sbjct: 86 KDPLPLDWEQCLDLESGRMYYLNRKTLRKSWNCPKDHNQQKLDLELNI--STLSNCPEKC 143
Query: 117 DDDESNN------KHHLSSASNNMVALACMNCHLLVILSKSSPSCPNCKFVHSLPNQQTQ 170
+S KH S+S+NMVALAC+NCHLLVILSKSSPSCPNCK+VHSLP QQ
Sbjct: 144 SSFDSQRLQDHSKKHQHCSSSSNMVALACLNCHLLVILSKSSPSCPNCKYVHSLPTQQIP 203
Query: 171 SSSAKVSGTKSMINTLSLLN 190
+S K KS ++TLSLLN
Sbjct: 204 TS--KAPPIKS-LDTLSLLN 220
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224131566|ref|XP_002321117.1| predicted protein [Populus trichocarpa] gi|222861890|gb|EEE99432.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255580394|ref|XP_002531024.1| conserved hypothetical protein [Ricinus communis] gi|223529399|gb|EEF31362.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|224065024|ref|XP_002301635.1| predicted protein [Populus trichocarpa] gi|222843361|gb|EEE80908.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|414877709|tpg|DAA54840.1| TPA: hypothetical protein ZEAMMB73_859049 [Zea mays] | Back alignment and taxonomy information |
|---|
| >gi|357160394|ref|XP_003578750.1| PREDICTED: uncharacterized protein LOC100823520 [Brachypodium distachyon] | Back alignment and taxonomy information |
|---|
| >gi|219363323|ref|NP_001137040.1| hypothetical protein [Zea mays] gi|194698104|gb|ACF83136.1| unknown [Zea mays] gi|413916772|gb|AFW56704.1| hypothetical protein ZEAMMB73_574320 [Zea mays] | Back alignment and taxonomy information |
|---|
| >gi|326487586|dbj|BAK05465.1| predicted protein [Hordeum vulgare subsp. vulgare] | Back alignment and taxonomy information |
|---|
| >gi|125536178|gb|EAY82666.1| hypothetical protein OsI_37886 [Oryza sativa Indica Group] | Back alignment and taxonomy information |
|---|
| >gi|108862372|gb|ABA96334.2| WW domain containing protein, expressed [Oryza sativa Japonica Group] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 190 | ||||||
| TAIR|locus:2138723 | 212 | AT4G08910 "AT4G08910" [Arabido | 0.552 | 0.495 | 0.345 | 1.4e-09 | |
| TAIR|locus:2194709 | 221 | AT1G78170 "AT1G78170" [Arabido | 0.268 | 0.230 | 0.392 | 3.2e-06 | |
| TAIR|locus:2164235 | 122 | AT5G06270 "AT5G06270" [Arabido | 0.389 | 0.606 | 0.296 | 5.5e-06 | |
| TAIR|locus:2015026 | 200 | AT1G22250 "AT1G22250" [Arabido | 0.247 | 0.235 | 0.415 | 1e-05 |
| TAIR|locus:2138723 AT4G08910 "AT4G08910" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 139 (54.0 bits), Expect = 1.4e-09, P = 1.4e-09
Identities = 39/113 (34%), Positives = 53/113 (46%)
Query: 53 SVDLQIK-DPLPLDWERCLDLQSGRMYYFNRKSSKKSWSLPENKQKLDLELNIXXXXXXN 111
S+DL++ P +D DL + Y + KK + E L LE
Sbjct: 88 SLDLELNLSPSLIDLNHHHDLSNYNKGYEEDERKKK---MMEKGSVLGLETK---KSMSR 141
Query: 112 CTSAADDDESNNKHHLSSASNN-MVALACMNCHLLVILSKSSPSCPNCKFVHS 163
DDD + + S MVA CM CH+LV+L K+SP+CPNCKF+HS
Sbjct: 142 VAFDLDDDCCDRGDGVGGRSEEEMVARVCMKCHMLVMLCKASPACPNCKFMHS 194
|
|
| TAIR|locus:2194709 AT1G78170 "AT1G78170" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2164235 AT5G06270 "AT5G06270" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2015026 AT1G22250 "AT1G22250" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 190 | |||
| smart00456 | 33 | smart00456, WW, Domain with 2 conserved Trp (W) re | 4e-04 | |
| pfam00397 | 30 | pfam00397, WW, WW domain | 9e-04 |
| >gnl|CDD|197736 smart00456, WW, Domain with 2 conserved Trp (W) residues | Back alignment and domain information |
|---|
Score = 36.0 bits (84), Expect = 4e-04
Identities = 13/34 (38%), Positives = 17/34 (50%), Gaps = 1/34 (2%)
Query: 61 PLPLDWERCLDLQSGRMYYFNRKSSKKSWSLPEN 94
PLP WE D GR YY+N ++ + W P
Sbjct: 1 PLPPGWEERKD-PDGRPYYYNHETKETQWEKPRE 33
|
Also known as the WWP or rsp5 domain. Binds proline-rich polypeptides. Length = 33 |
| >gnl|CDD|215899 pfam00397, WW, WW domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 190 | |||
| PF00397 | 31 | WW: WW domain; InterPro: IPR001202 Synonym(s): Rsp | 99.04 | |
| smart00456 | 32 | WW Domain with 2 conserved Trp (W) residues. Also | 98.84 | |
| cd00201 | 31 | WW Two conserved tryptophans domain; also known as | 98.69 | |
| KOG3259 | 163 | consensus Peptidyl-prolyl cis-trans isomerase [Pos | 98.24 | |
| KOG1891 | 271 | consensus Proline binding protein WW45 [General fu | 97.31 | |
| KOG1891 | 271 | consensus Proline binding protein WW45 [General fu | 96.63 | |
| COG5104 | 590 | PRP40 Splicing factor [RNA processing and modifica | 96.34 | |
| COG5104 | 590 | PRP40 Splicing factor [RNA processing and modifica | 95.41 | |
| KOG3209 | 984 | consensus WW domain-containing protein [General fu | 93.91 | |
| KOG0940 | 358 | consensus Ubiquitin protein ligase RSP5/NEDD4 [Pos | 90.35 | |
| PRK08351 | 61 | DNA-directed RNA polymerase subunit E''; Validated | 89.48 | |
| cd00201 | 31 | WW Two conserved tryptophans domain; also known as | 87.87 | |
| PF00397 | 31 | WW: WW domain; InterPro: IPR001202 Synonym(s): Rsp | 86.76 | |
| smart00391 | 77 | MBD Methyl-CpG binding domain. Methyl-CpG binding | 83.6 | |
| cd00122 | 62 | MBD MeCP2, MBD1, MBD2, MBD3, MBD4, CLLD8-like, and | 83.01 | |
| PRK06393 | 64 | rpoE DNA-directed RNA polymerase subunit E''; Vali | 82.74 | |
| KOG3209 | 984 | consensus WW domain-containing protein [General fu | 80.37 |
| >PF00397 WW: WW domain; InterPro: IPR001202 Synonym(s): Rsp5 or WWP domain The WW domain is a short conserved region in a number of unrelated proteins, which folds as a stable, triple stranded beta-sheet | Back alignment and domain information |
|---|
Probab=99.04 E-value=1e-10 Score=72.16 Aligned_cols=31 Identities=42% Similarity=0.999 Sum_probs=29.5
Q ss_pred CCccchhcccCCCcceEEeecCCCCccccCC
Q 029636 62 LPLDWERCLDLQSGRMYYFNRKSSKKSWSLP 92 (190)
Q Consensus 62 LPsgWEq~LDlkSG~iYY~N~~T~~ssw~dP 92 (190)
||.||+++.|.++|++||+|..|++++|++|
T Consensus 1 LP~gW~~~~~~~~g~~YY~N~~t~~s~W~~P 31 (31)
T PF00397_consen 1 LPPGWEEYFDPDSGRPYYYNHETGESQWERP 31 (31)
T ss_dssp SSTTEEEEEETTTSEEEEEETTTTEEESSST
T ss_pred CCcCCEEEEcCCCCCEEEEeCCCCCEEeCCC
Confidence 7999999998768999999999999999998
|
This short domain of approximately 40 amino acids, may be repeated up to four times in some proteins [, , , ]. The name WW or WWP derives from the presence of two signature tryptophan residues that are spaced 20-23 amino acids apart and are present in most WW domains known to date, as well as that of a conserved Pro. The WW domain binds to proteins with particular proline-motifs, [AP]-P-P-[AP]-Y, and/or phosphoserine- phosphothreonine-containing motifs [, ]. It is frequently associated with other domains typical for proteins in signal transduction processes. A large variety of proteins containing the WW domain are known. These include; dystrophin, a multidomain cytoskeletal protein; utrophin, a dystrophin-like protein of unknown function; vertebrate YAP protein, substrate of an unknown serine kinase; Mus musculus (Mouse) NEDD-4, involved in the embryonic development and differentiation of the central nervous system; Saccharomyces cerevisiae (Baker's yeast) RSP5, similar to NEDD-4 in its molecular organisation; Rattus norvegicus (Rat) FE65, a transcription-factor activator expressed preferentially in liver; Nicotiana tabacum (Common tobacco) DB10 protein, amongst others.; GO: 0005515 protein binding; PDB: 2JXW_A 2DK1_A 2JOC_A 2JO9_A 1YIU_A 1O6W_A 2JMF_A 1TK7_A 2KYK_A 2L5F_A .... |
| >smart00456 WW Domain with 2 conserved Trp (W) residues | Back alignment and domain information |
|---|
| >cd00201 WW Two conserved tryptophans domain; also known as the WWP or rsp5 domain; around 40 amino acids; functions as an interaction module in a diverse set of signalling proteins; binds specific proline-rich sequences but at low affinities compared to other peptide recognition proteins such as antibodies and receptors; WW domains have a single groove formed by a conserved Trp and Tyr which recognizes a pair of residues of the sequence X-Pro; variable loops and neighboring domains confer specificity in this domain; there are five distinct groups based on binding: 1) PPXY motifs 2) the PPLP motif; 3) PGM motifs; 4) PSP or PTP motifs; 5) PR motifs | Back alignment and domain information |
|---|
| >KOG3259 consensus Peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1891 consensus Proline binding protein WW45 [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1891 consensus Proline binding protein WW45 [General function prediction only] | Back alignment and domain information |
|---|
| >COG5104 PRP40 Splicing factor [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG5104 PRP40 Splicing factor [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG3209 consensus WW domain-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0940 consensus Ubiquitin protein ligase RSP5/NEDD4 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK08351 DNA-directed RNA polymerase subunit E''; Validated | Back alignment and domain information |
|---|
| >cd00201 WW Two conserved tryptophans domain; also known as the WWP or rsp5 domain; around 40 amino acids; functions as an interaction module in a diverse set of signalling proteins; binds specific proline-rich sequences but at low affinities compared to other peptide recognition proteins such as antibodies and receptors; WW domains have a single groove formed by a conserved Trp and Tyr which recognizes a pair of residues of the sequence X-Pro; variable loops and neighboring domains confer specificity in this domain; there are five distinct groups based on binding: 1) PPXY motifs 2) the PPLP motif; 3) PGM motifs; 4) PSP or PTP motifs; 5) PR motifs | Back alignment and domain information |
|---|
| >PF00397 WW: WW domain; InterPro: IPR001202 Synonym(s): Rsp5 or WWP domain The WW domain is a short conserved region in a number of unrelated proteins, which folds as a stable, triple stranded beta-sheet | Back alignment and domain information |
|---|
| >smart00391 MBD Methyl-CpG binding domain | Back alignment and domain information |
|---|
| >cd00122 MBD MeCP2, MBD1, MBD2, MBD3, MBD4, CLLD8-like, and BAZ2A-like proteins constitute a family of proteins that share the methyl-CpG-binding domain (MBD) | Back alignment and domain information |
|---|
| >PRK06393 rpoE DNA-directed RNA polymerase subunit E''; Validated | Back alignment and domain information |
|---|
| >KOG3209 consensus WW domain-containing protein [General function prediction only] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 190 | |||
| 2kxq_A | 90 | E3 ubiquitin-protein ligase smurf2; WW, smurf2, TG | 5e-06 | |
| 2kxq_A | 90 | E3 ubiquitin-protein ligase smurf2; WW, smurf2, TG | 5e-04 | |
| 2law_A | 38 | Yorkie homolog; YAP, SMAD1, CDK, signal transducti | 9e-06 | |
| 2djy_A | 42 | SMAD ubiquitination regulatory factor 2; beta shee | 2e-05 | |
| 1wr3_A | 36 | Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {M | 2e-05 | |
| 1tk7_A | 88 | CG4244-PB; WW domain, notch, signaling protein; NM | 2e-05 | |
| 1o6w_A | 75 | PRP40, PRE-mRNA processing protein PRP40; WW domai | 4e-05 | |
| 1wr4_A | 36 | Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {M | 5e-05 | |
| 1wmv_A | 54 | WWOX, WW domain containing oxidoreductase; all-bet | 6e-05 | |
| 1i5h_W | 50 | Rnedd4, ubiquitin ligase NEDD4; NEDD4, WW domains, | 7e-05 | |
| 2jxw_A | 75 | WW domain-binding protein 4; WW domain containing | 7e-05 | |
| 2kyk_A | 39 | E3 ubiquitin-protein ligase itchy homolog; LMP2A, | 7e-05 | |
| 1ymz_A | 43 | CC45; artificial protein, computational design, un | 8e-05 | |
| 2yse_A | 60 | Membrane-associated guanylate kinase, WW and PDZ d | 1e-04 | |
| 1wr7_A | 41 | NEDD4-2; all-beta, ligase; NMR {Mus musculus} Leng | 1e-04 | |
| 2l4j_A | 46 | YES-associated protein 2 (YAP2); WW domain, medaka | 1e-04 | |
| 2l5f_A | 92 | PRE-mRNA-processing factor 40 homolog A; 2WW, HYPA | 2e-04 | |
| 2ysf_A | 40 | E3 ubiquitin-protein ligase itchy homolog; AIP4, N | 2e-04 | |
| 2ysd_A | 57 | Membrane-associated guanylate kinase, WW and PDZ d | 2e-04 | |
| 2dmv_A | 43 | Itchy homolog E3 ubiquitin protein ligase; WW doma | 2e-04 | |
| 2ysh_A | 40 | GAS-7, growth-arrest-specific protein 7; WW domain | 2e-04 | |
| 2kpz_A | 49 | E3 ubiquitin-protein ligase NEDD4; WW domain, HTLV | 2e-04 | |
| 1jmq_A | 46 | YAP65, 65 kDa YES-associated protein; polyproline | 3e-04 | |
| 2jmf_A | 53 | E3 ubiquitin-protein ligase suppressor of deltex; | 3e-04 | |
| 2ez5_W | 46 | Dnedd4, E3 ubiquitin-protein ligase NEDD4; WW doma | 5e-04 | |
| 2ysg_A | 40 | Syntaxin-binding protein 4; synip, STXBP4, WW doma | 5e-04 | |
| 2jx8_A | 52 | Hpcif1, phosphorylated CTD-interacting factor 1; p | 6e-04 | |
| 2ysb_A | 49 | Salvador homolog 1 protein; WW domain, structural | 6e-04 | |
| 2jv4_A | 54 | Peptidyl-prolyl CIS/trans isomerase; ppiase domain | 7e-04 |
| >2kxq_A E3 ubiquitin-protein ligase smurf2; WW, smurf2, TGF-beta, modular binding, protein BIN; NMR {Homo sapiens} PDB: 2lb0_A* 2laz_A* Length = 90 | Back alignment and structure |
|---|
Score = 42.2 bits (99), Expect = 5e-06
Identities = 9/40 (22%), Positives = 19/40 (47%), Gaps = 1/40 (2%)
Query: 60 DPLPLDWERCLDLQSGRMYYFNRKSSKKSWSLPENKQKLD 99
LP +E+ Q G++Y+ + ++ +W P + L
Sbjct: 8 PDLPEGYEQRTT-QQGQVYFLHTQTGVSTWHDPRVPRDLS 46
|
| >2kxq_A E3 ubiquitin-protein ligase smurf2; WW, smurf2, TGF-beta, modular binding, protein BIN; NMR {Homo sapiens} PDB: 2lb0_A* 2laz_A* Length = 90 | Back alignment and structure |
|---|
| >2law_A Yorkie homolog; YAP, SMAD1, CDK, signal transduction, signaling protein-TRAN complex; NMR {Homo sapiens} Length = 38 | Back alignment and structure |
|---|
| >2djy_A SMAD ubiquitination regulatory factor 2; beta sheet, polyproline type II helix, PPII, ligase/signaling protein complex; NMR {Homo sapiens} PDB: 2lb1_A Length = 42 | Back alignment and structure |
|---|
| >1wr3_A Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {Mus musculus} Length = 36 | Back alignment and structure |
|---|
| >1tk7_A CG4244-PB; WW domain, notch, signaling protein; NMR {Drosophila melanogaster} SCOP: b.72.1.1 b.72.1.1 Length = 88 | Back alignment and structure |
|---|
| >1o6w_A PRP40, PRE-mRNA processing protein PRP40; WW domain PAIR, nuclear protein, mRNA splicing, ribonucleoprotein; NMR {Saccharomyces cerevisiae} SCOP: b.72.1.1 b.72.1.1 Length = 75 | Back alignment and structure |
|---|
| >1wr4_A Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {Mus musculus} PDB: 2lb2_A* Length = 36 | Back alignment and structure |
|---|
| >1wmv_A WWOX, WW domain containing oxidoreductase; all-beta, apoptosis; NMR {Homo sapiens} Length = 54 | Back alignment and structure |
|---|
| >1i5h_W Rnedd4, ubiquitin ligase NEDD4; NEDD4, WW domains, ENAC, PY motif, liddle syndrome, proline-rich, ligase; NMR {Rattus norvegicus} SCOP: b.72.1.1 PDB: 1yiu_A 2jo9_A 2joc_A* Length = 50 | Back alignment and structure |
|---|
| >2jxw_A WW domain-binding protein 4; WW domain containing protein, FBP21, WBP4, metal- binding, mRNA processing, mRNA splicing, nucleus, polymorphism; NMR {Homo sapiens} Length = 75 | Back alignment and structure |
|---|
| >2kyk_A E3 ubiquitin-protein ligase itchy homolog; LMP2A, PY motif, WW domain; NMR {Homo sapiens} Length = 39 | Back alignment and structure |
|---|
| >1ymz_A CC45; artificial protein, computational design, unknown function; NMR {Synthetic} SCOP: k.22.1.1 Length = 43 | Back alignment and structure |
|---|
| >2yse_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; MAGI-1, WW domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 60 | Back alignment and structure |
|---|
| >1wr7_A NEDD4-2; all-beta, ligase; NMR {Mus musculus} Length = 41 | Back alignment and structure |
|---|
| >2l4j_A YES-associated protein 2 (YAP2); WW domain, medaka, transcription; NMR {Oryzias latipes} Length = 46 | Back alignment and structure |
|---|
| >2l5f_A PRE-mRNA-processing factor 40 homolog A; 2WW, HYPA, FBP11, protein binding; NMR {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
| >2ysf_A E3 ubiquitin-protein ligase itchy homolog; AIP4, NAPP1, WW domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.22.1.1 Length = 40 | Back alignment and structure |
|---|
| >2ysd_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; MAGI1, WW domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.22.1.1 Length = 57 | Back alignment and structure |
|---|
| >2dmv_A Itchy homolog E3 ubiquitin protein ligase; WW domain, three stranded antiparallel beta sheet, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 43 | Back alignment and structure |
|---|
| >2ysh_A GAS-7, growth-arrest-specific protein 7; WW domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.22.1.1 Length = 40 | Back alignment and structure |
|---|
| >2kpz_A E3 ubiquitin-protein ligase NEDD4; WW domain, HTLV1, NEDD4, human modular domain, complex, HOST interaction, ligase; NMR {Homo sapiens} PDB: 2kq0_A 2laj_A* Length = 49 | Back alignment and structure |
|---|
| >1jmq_A YAP65, 65 kDa YES-associated protein; polyproline ligand, YAP65 mutant, structural protein; NMR {Homo sapiens} SCOP: b.72.1.1 PDB: 1k9q_A* 1k9r_A 1k5r_A* 2lax_A* 2lay_A* Length = 46 | Back alignment and structure |
|---|
| >2jmf_A E3 ubiquitin-protein ligase suppressor of deltex; WW domain, solution, complex, ligase/signaling protein complex; NMR {Drosophila melanogaster} SCOP: b.72.1.1 PDB: 2op7_A Length = 53 | Back alignment and structure |
|---|
| >2ez5_W Dnedd4, E3 ubiquitin-protein ligase NEDD4; WW domain, PY motif, binding affinity, signalling protein,ligase; NMR {Drosophila melanogaster} Length = 46 | Back alignment and structure |
|---|
| >2ysg_A Syntaxin-binding protein 4; synip, STXBP4, WW domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.22.1.1 Length = 40 | Back alignment and structure |
|---|
| >2jx8_A Hpcif1, phosphorylated CTD-interacting factor 1; protein fragment, WW domain, triple-standed beta-sheet, alpha-helix, nucleus, phosphorylation; NMR {Homo sapiens} Length = 52 | Back alignment and structure |
|---|
| >2ysb_A Salvador homolog 1 protein; WW domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: k.22.1.1 Length = 49 | Back alignment and structure |
|---|
| >2jv4_A Peptidyl-prolyl CIS/trans isomerase; ppiase domain, WW domain group IV, rotamase; NMR {Emericella nidulans} Length = 54 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 190 | |||
| 2kxq_A | 90 | E3 ubiquitin-protein ligase smurf2; WW, smurf2, TG | 99.49 | |
| 1tk7_A | 88 | CG4244-PB; WW domain, notch, signaling protein; NM | 99.49 | |
| 2dwv_A | 49 | Salvador homolog 1 protein; WW domain, dimer, stru | 99.33 | |
| 2law_A | 38 | Yorkie homolog; YAP, SMAD1, CDK, signal transducti | 99.33 | |
| 2ysf_A | 40 | E3 ubiquitin-protein ligase itchy homolog; AIP4, N | 99.26 | |
| 1wr3_A | 36 | Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {M | 99.25 | |
| 1wr7_A | 41 | NEDD4-2; all-beta, ligase; NMR {Mus musculus} | 99.25 | |
| 2zaj_A | 49 | Membrane-associated guanylate kinase, WW and PDZ d | 99.24 | |
| 1i5h_W | 50 | Rnedd4, ubiquitin ligase NEDD4; NEDD4, WW domains, | 99.24 | |
| 2ysg_A | 40 | Syntaxin-binding protein 4; synip, STXBP4, WW doma | 99.24 | |
| 1wr4_A | 36 | Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {M | 99.24 | |
| 2kyk_A | 39 | E3 ubiquitin-protein ligase itchy homolog; LMP2A, | 99.23 | |
| 2l4j_A | 46 | YES-associated protein 2 (YAP2); WW domain, medaka | 99.23 | |
| 2djy_A | 42 | SMAD ubiquitination regulatory factor 2; beta shee | 99.21 | |
| 2ez5_W | 46 | Dnedd4, E3 ubiquitin-protein ligase NEDD4; WW doma | 99.2 | |
| 1e0m_A | 37 | Wwprototype; SH3 prototype, protein design, de nov | 99.2 | |
| 1o6w_A | 75 | PRP40, PRE-mRNA processing protein PRP40; WW domai | 99.2 | |
| 1ymz_A | 43 | CC45; artificial protein, computational design, un | 99.19 | |
| 2jmf_A | 53 | E3 ubiquitin-protein ligase suppressor of deltex; | 99.19 | |
| 2dmv_A | 43 | Itchy homolog E3 ubiquitin protein ligase; WW doma | 99.19 | |
| 2kpz_A | 49 | E3 ubiquitin-protein ligase NEDD4; WW domain, HTLV | 99.19 | |
| 2yse_A | 60 | Membrane-associated guanylate kinase, WW and PDZ d | 99.17 | |
| 2ysd_A | 57 | Membrane-associated guanylate kinase, WW and PDZ d | 99.17 | |
| 2jxw_A | 75 | WW domain-binding protein 4; WW domain containing | 99.15 | |
| 2ysb_A | 49 | Salvador homolog 1 protein; WW domain, structural | 99.14 | |
| 2ysh_A | 40 | GAS-7, growth-arrest-specific protein 7; WW domain | 99.12 | |
| 1wmv_A | 54 | WWOX, WW domain containing oxidoreductase; all-bet | 99.11 | |
| 2l5f_A | 92 | PRE-mRNA-processing factor 40 homolog A; 2WW, HYPA | 99.05 | |
| 2jv4_A | 54 | Peptidyl-prolyl CIS/trans isomerase; ppiase domain | 99.05 | |
| 3l4h_A | 109 | E3 ubiquitin-protein ligase HECW1; E3 ligase, WW d | 99.0 | |
| 1jmq_A | 46 | YAP65, 65 kDa YES-associated protein; polyproline | 98.98 | |
| 2ho2_A | 38 | Fe65 protein, amyloid beta A4 protein-binding fami | 98.98 | |
| 2ysc_A | 39 | Amyloid beta A4 precursor protein-binding family B | 98.93 | |
| 1tk7_A | 88 | CG4244-PB; WW domain, notch, signaling protein; NM | 98.84 | |
| 2jx8_A | 52 | Hpcif1, phosphorylated CTD-interacting factor 1; p | 98.79 | |
| 2kxq_A | 90 | E3 ubiquitin-protein ligase smurf2; WW, smurf2, TG | 98.78 | |
| 2e45_A | 55 | Fe65 protein, amyloid beta A4 precursor protein-bi | 98.75 | |
| 3tc5_A | 166 | Peptidyl-prolyl CIS-trans isomerase NIMA-interact; | 98.64 | |
| 2ysi_A | 40 | Transcription elongation regulator 1; Ca150, FBP28 | 98.55 | |
| 2l5f_A | 92 | PRE-mRNA-processing factor 40 homolog A; 2WW, HYPA | 98.52 | |
| 1e0n_A | 27 | Hypothetical protein; YJQ8WW domain, WW domain, sa | 98.44 | |
| 1ywi_A | 41 | Formin-binding protein 3; WW domain, class II, pro | 98.38 | |
| 1e0l_A | 37 | Formin binding protein; SH3 domain, WW domain, FBP | 98.33 | |
| 1eg3_A | 261 | Dystrophin; EF-hand like domain, WW domain, struct | 98.32 | |
| 3olm_A | 429 | E3 ubiquitin-protein ligase RSP5; ligase; 2.50A {S | 98.25 | |
| 1o6w_A | 75 | PRP40, PRE-mRNA processing protein PRP40; WW domai | 98.11 | |
| 2jxw_A | 75 | WW domain-binding protein 4; WW domain containing | 97.95 | |
| 1yw5_A | 177 | Peptidyl prolyl CIS/trans isomerase; WW-domain, pp | 97.51 | |
| 2dk1_A | 50 | WW domain-binding protein 4; WBP-4, formin- bindin | 97.48 | |
| 2dk7_A | 73 | Transcription elongation regulator 1; structural g | 96.3 | |
| 2ysd_A | 57 | Membrane-associated guanylate kinase, WW and PDZ d | 96.13 | |
| 2djy_A | 42 | SMAD ubiquitination regulatory factor 2; beta shee | 94.32 | |
| 2ez5_W | 46 | Dnedd4, E3 ubiquitin-protein ligase NEDD4; WW doma | 94.07 | |
| 2zaj_A | 49 | Membrane-associated guanylate kinase, WW and PDZ d | 93.87 | |
| 2law_A | 38 | Yorkie homolog; YAP, SMAD1, CDK, signal transducti | 93.8 | |
| 2ysf_A | 40 | E3 ubiquitin-protein ligase itchy homolog; AIP4, N | 93.8 | |
| 2ysg_A | 40 | Syntaxin-binding protein 4; synip, STXBP4, WW doma | 93.76 | |
| 2kpz_A | 49 | E3 ubiquitin-protein ligase NEDD4; WW domain, HTLV | 93.7 | |
| 2dmv_A | 43 | Itchy homolog E3 ubiquitin protein ligase; WW doma | 93.69 | |
| 1wmv_A | 54 | WWOX, WW domain containing oxidoreductase; all-bet | 93.62 | |
| 1wr3_A | 36 | Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {M | 93.56 | |
| 1i5h_W | 50 | Rnedd4, ubiquitin ligase NEDD4; NEDD4, WW domains, | 93.55 | |
| 2kyk_A | 39 | E3 ubiquitin-protein ligase itchy homolog; LMP2A, | 93.4 | |
| 2jmf_A | 53 | E3 ubiquitin-protein ligase suppressor of deltex; | 93.32 | |
| 1wr4_A | 36 | Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {M | 93.04 | |
| 2ysb_A | 49 | Salvador homolog 1 protein; WW domain, structural | 92.88 | |
| 2dwv_A | 49 | Salvador homolog 1 protein; WW domain, dimer, stru | 92.85 | |
| 1wr7_A | 41 | NEDD4-2; all-beta, ligase; NMR {Mus musculus} | 92.83 | |
| 2l4j_A | 46 | YES-associated protein 2 (YAP2); WW domain, medaka | 92.79 | |
| 2yse_A | 60 | Membrane-associated guanylate kinase, WW and PDZ d | 92.76 | |
| 1e0m_A | 37 | Wwprototype; SH3 prototype, protein design, de nov | 92.42 | |
| 2jv4_A | 54 | Peptidyl-prolyl CIS/trans isomerase; ppiase domain | 92.23 | |
| 2ysh_A | 40 | GAS-7, growth-arrest-specific protein 7; WW domain | 91.64 | |
| 1ymz_A | 43 | CC45; artificial protein, computational design, un | 90.84 | |
| 1jmq_A | 46 | YAP65, 65 kDa YES-associated protein; polyproline | 90.28 | |
| 3c2i_A | 97 | Methyl-CPG-binding protein 2; water mediated recog | 88.82 | |
| 2jx8_A | 52 | Hpcif1, phosphorylated CTD-interacting factor 1; p | 85.52 | |
| 3l4h_A | 109 | E3 ubiquitin-protein ligase HECW1; E3 ligase, WW d | 85.5 | |
| 1ryq_A | 69 | DNA-directed RNA polymerase, subunit E''; structur | 84.44 | |
| 3p8b_A | 81 | DNA-directed RNA polymerase, subunit E''; transcri | 83.3 | |
| 3tc5_A | 166 | Peptidyl-prolyl CIS-trans isomerase NIMA-interact; | 82.88 | |
| 2ho2_A | 38 | Fe65 protein, amyloid beta A4 protein-binding fami | 80.51 |
| >2kxq_A E3 ubiquitin-protein ligase smurf2; WW, smurf2, TGF-beta, modular binding, protein BIN; NMR {Homo sapiens} PDB: 2lb0_A* 2laz_A* | Back alignment and structure |
|---|
Probab=99.49 E-value=1.8e-14 Score=105.89 Aligned_cols=62 Identities=16% Similarity=0.400 Sum_probs=51.4
Q ss_pred cCCceeeeccc---ccccCCCccccc---ccccCCCCCccchhcccCCCcceEEeecCCCCccccCCCc
Q 029636 32 SRKRKFLSDFS---LLKTEPAIQTSV---DLQIKDPLPLDWERCLDLQSGRMYYFNRKSSKKSWSLPEN 94 (190)
Q Consensus 32 ~~~R~~~~~~~---t~W~~P~~~~~i---EL~l~~PLPsgWEq~LDlkSG~iYY~N~~T~~ssw~dPr~ 94 (190)
..+|.||.||. |+|++|.....+ ......+||.|||++.| .+|++||+|++|++++|++|+.
T Consensus 20 ~~Gr~YY~n~~t~~t~W~~P~~~~~~~~~~~~~~~~LP~gWe~~~~-~~G~~Yy~n~~t~~t~w~~Pr~ 87 (90)
T 2kxq_A 20 QQGQVYFLHTQTGVSTWHDPRVPRDLSNINCEELGPLPPGWEIRNT-ATGRVYFVDHNNRTTQFTDPRL 87 (90)
T ss_dssp TTTEEEEEETTTTEEESSCSSSCSSSCSCCGGGTCCCCSSCCEEEC-TTSCEEEEETTTTEEESSCTTT
T ss_pred CCCCEEEEECCCCeEeeecccccccccccCcccccccCCCceEEEC-CCCCEEEEECCCCcEecCCCCc
Confidence 47899999998 999999755432 22234689999999999 5699999999999999999994
|
| >1tk7_A CG4244-PB; WW domain, notch, signaling protein; NMR {Drosophila melanogaster} SCOP: b.72.1.1 b.72.1.1 | Back alignment and structure |
|---|
| >2dwv_A Salvador homolog 1 protein; WW domain, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2law_A Yorkie homolog; YAP, SMAD1, CDK, signal transduction, signaling protein-TRAN complex; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysf_A E3 ubiquitin-protein ligase itchy homolog; AIP4, NAPP1, WW domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.22.1.1 | Back alignment and structure |
|---|
| >1wr3_A Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1wr7_A NEDD4-2; all-beta, ligase; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2zaj_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; BAI1-associated protein 1 (BAP-1); NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1i5h_W Rnedd4, ubiquitin ligase NEDD4; NEDD4, WW domains, ENAC, PY motif, liddle syndrome, proline-rich, ligase; NMR {Rattus norvegicus} SCOP: b.72.1.1 PDB: 1yiu_A 2jo9_A 2joc_A* | Back alignment and structure |
|---|
| >2ysg_A Syntaxin-binding protein 4; synip, STXBP4, WW domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.22.1.1 | Back alignment and structure |
|---|
| >1wr4_A Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {Mus musculus} PDB: 2lb2_A* | Back alignment and structure |
|---|
| >2kyk_A E3 ubiquitin-protein ligase itchy homolog; LMP2A, PY motif, WW domain; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2l4j_A YES-associated protein 2 (YAP2); WW domain, medaka, transcription; NMR {Oryzias latipes} | Back alignment and structure |
|---|
| >2djy_A SMAD ubiquitination regulatory factor 2; beta sheet, polyproline type II helix, PPII, ligase/signaling protein complex; NMR {Homo sapiens} PDB: 2lb1_A | Back alignment and structure |
|---|
| >2ez5_W Dnedd4, E3 ubiquitin-protein ligase NEDD4; WW domain, PY motif, binding affinity, signalling protein,ligase; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1e0m_A Wwprototype; SH3 prototype, protein design, de novo protein; NMR {} SCOP: k.22.1.1 | Back alignment and structure |
|---|
| >1o6w_A PRP40, PRE-mRNA processing protein PRP40; WW domain PAIR, nuclear protein, mRNA splicing, ribonucleoprotein; NMR {Saccharomyces cerevisiae} SCOP: b.72.1.1 b.72.1.1 | Back alignment and structure |
|---|
| >1ymz_A CC45; artificial protein, computational design, unknown function; NMR {Synthetic} SCOP: k.22.1.1 | Back alignment and structure |
|---|
| >2jmf_A E3 ubiquitin-protein ligase suppressor of deltex; WW domain, solution, complex, ligase/signaling protein complex; NMR {Drosophila melanogaster} SCOP: b.72.1.1 PDB: 2op7_A | Back alignment and structure |
|---|
| >2dmv_A Itchy homolog E3 ubiquitin protein ligase; WW domain, three stranded antiparallel beta sheet, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kpz_A E3 ubiquitin-protein ligase NEDD4; WW domain, HTLV1, NEDD4, human modular domain, complex, HOST interaction, ligase; NMR {Homo sapiens} PDB: 2kq0_A 2laj_A* | Back alignment and structure |
|---|
| >2yse_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; MAGI-1, WW domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysd_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; MAGI1, WW domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.22.1.1 | Back alignment and structure |
|---|
| >2jxw_A WW domain-binding protein 4; WW domain containing protein, FBP21, WBP4, metal- binding, mRNA processing, mRNA splicing, nucleus, polymorphism; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysb_A Salvador homolog 1 protein; WW domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: k.22.1.1 | Back alignment and structure |
|---|
| >2ysh_A GAS-7, growth-arrest-specific protein 7; WW domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.22.1.1 | Back alignment and structure |
|---|
| >1wmv_A WWOX, WW domain containing oxidoreductase; all-beta, apoptosis; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2l5f_A PRE-mRNA-processing factor 40 homolog A; 2WW, HYPA, FBP11, protein binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jv4_A Peptidyl-prolyl CIS/trans isomerase; ppiase domain, WW domain group IV, rotamase; NMR {Emericella nidulans} | Back alignment and structure |
|---|
| >3l4h_A E3 ubiquitin-protein ligase HECW1; E3 ligase, WW domain, UBL-conjugation pathway, structural GE structural genomics consortium, SGC, coiled coil; HET: MSE; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1jmq_A YAP65, 65 kDa YES-associated protein; polyproline ligand, YAP65 mutant, structural protein; NMR {Homo sapiens} SCOP: b.72.1.1 PDB: 1k9q_A* 1k9r_A 1k5r_A* 2lax_A* 2lay_A* | Back alignment and structure |
|---|
| >2ho2_A Fe65 protein, amyloid beta A4 protein-binding family B member 1; WW domain, beta sheet, Fe65, protein binding; 1.33A {Homo sapiens} SCOP: b.72.1.1 PDB: 2idh_A* 2oei_A | Back alignment and structure |
|---|
| >2ysc_A Amyloid beta A4 precursor protein-binding family B member 3; Fe65-like protein 2, WW domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.72.1.1 | Back alignment and structure |
|---|
| >1tk7_A CG4244-PB; WW domain, notch, signaling protein; NMR {Drosophila melanogaster} SCOP: b.72.1.1 b.72.1.1 | Back alignment and structure |
|---|
| >2jx8_A Hpcif1, phosphorylated CTD-interacting factor 1; protein fragment, WW domain, triple-standed beta-sheet, alpha-helix, nucleus, phosphorylation; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kxq_A E3 ubiquitin-protein ligase smurf2; WW, smurf2, TGF-beta, modular binding, protein BIN; NMR {Homo sapiens} PDB: 2lb0_A* 2laz_A* | Back alignment and structure |
|---|
| >2e45_A Fe65 protein, amyloid beta A4 precursor protein-binding family B member 1; triple-stranded beta-sheet; NMR {Homo sapiens} SCOP: b.72.1.1 | Back alignment and structure |
|---|
| >3tc5_A Peptidyl-prolyl CIS-trans isomerase NIMA-interact; PIN1 mutant (R14A), oncogenic transformation, small molecule cycle, rotamase, phosphoprotein; HET: 3T5 P6G; 1.40A {Homo sapiens} PDB: 2itk_A* 2q5a_A* 2xp3_A* 2xp4_A* 2xp5_A* 2xp7_A* 2xp8_A* 2xp9_A* 2xpa_A* 2xpb_A* 3kab_A* 3kag_A* 3kah_A* 3kai_A* 3kce_A* 3ntp_A* 3odk_A* 3oob_A* 2zr6_A* 1f8a_B* ... | Back alignment and structure |
|---|
| >2ysi_A Transcription elongation regulator 1; Ca150, FBP28, WW domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.22.1.1 | Back alignment and structure |
|---|
| >2l5f_A PRE-mRNA-processing factor 40 homolog A; 2WW, HYPA, FBP11, protein binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1e0n_A Hypothetical protein; YJQ8WW domain, WW domain, saccharomyces cerevisae, YJQ8 protein; NMR {Saccharomyces cerevisiae} SCOP: b.72.1.1 | Back alignment and structure |
|---|
| >1ywi_A Formin-binding protein 3; WW domain, class II, proline-rich peptides, protein-protein interactions, structural protein; NMR {Homo sapiens} SCOP: b.72.1.1 PDB: 1ywj_A 1zr7_A 2dyf_A | Back alignment and structure |
|---|
| >1e0l_A Formin binding protein; SH3 domain, WW domain, FBP28, signal transduction; NMR {Mus musculus} SCOP: b.72.1.1 PDB: 2jup_W 2rly_W 2rm0_W 2nnt_A | Back alignment and structure |
|---|
| >1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A | Back alignment and structure |
|---|
| >3olm_A E3 ubiquitin-protein ligase RSP5; ligase; 2.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1o6w_A PRP40, PRE-mRNA processing protein PRP40; WW domain PAIR, nuclear protein, mRNA splicing, ribonucleoprotein; NMR {Saccharomyces cerevisiae} SCOP: b.72.1.1 b.72.1.1 | Back alignment and structure |
|---|
| >2jxw_A WW domain-binding protein 4; WW domain containing protein, FBP21, WBP4, metal- binding, mRNA processing, mRNA splicing, nucleus, polymorphism; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1yw5_A Peptidyl prolyl CIS/trans isomerase; WW-domain, ppiase domain, ordered linker; 1.60A {Candida albicans} | Back alignment and structure |
|---|
| >2dk1_A WW domain-binding protein 4; WBP-4, formin- binding protein 21, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.72.1.1 | Back alignment and structure |
|---|
| >2dk7_A Transcription elongation regulator 1; structural genomics, WW domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysd_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; MAGI1, WW domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.22.1.1 | Back alignment and structure |
|---|
| >2djy_A SMAD ubiquitination regulatory factor 2; beta sheet, polyproline type II helix, PPII, ligase/signaling protein complex; NMR {Homo sapiens} PDB: 2lb1_A | Back alignment and structure |
|---|
| >2ez5_W Dnedd4, E3 ubiquitin-protein ligase NEDD4; WW domain, PY motif, binding affinity, signalling protein,ligase; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2zaj_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; BAI1-associated protein 1 (BAP-1); NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2law_A Yorkie homolog; YAP, SMAD1, CDK, signal transduction, signaling protein-TRAN complex; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysf_A E3 ubiquitin-protein ligase itchy homolog; AIP4, NAPP1, WW domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.22.1.1 | Back alignment and structure |
|---|
| >2ysg_A Syntaxin-binding protein 4; synip, STXBP4, WW domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.22.1.1 | Back alignment and structure |
|---|
| >2kpz_A E3 ubiquitin-protein ligase NEDD4; WW domain, HTLV1, NEDD4, human modular domain, complex, HOST interaction, ligase; NMR {Homo sapiens} PDB: 2kq0_A 2laj_A* | Back alignment and structure |
|---|
| >2dmv_A Itchy homolog E3 ubiquitin protein ligase; WW domain, three stranded antiparallel beta sheet, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wmv_A WWOX, WW domain containing oxidoreductase; all-beta, apoptosis; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wr3_A Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1i5h_W Rnedd4, ubiquitin ligase NEDD4; NEDD4, WW domains, ENAC, PY motif, liddle syndrome, proline-rich, ligase; NMR {Rattus norvegicus} SCOP: b.72.1.1 PDB: 1yiu_A 2jo9_A 2joc_A* | Back alignment and structure |
|---|
| >2kyk_A E3 ubiquitin-protein ligase itchy homolog; LMP2A, PY motif, WW domain; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jmf_A E3 ubiquitin-protein ligase suppressor of deltex; WW domain, solution, complex, ligase/signaling protein complex; NMR {Drosophila melanogaster} SCOP: b.72.1.1 PDB: 2op7_A | Back alignment and structure |
|---|
| >1wr4_A Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {Mus musculus} PDB: 2lb2_A* | Back alignment and structure |
|---|
| >2ysb_A Salvador homolog 1 protein; WW domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: k.22.1.1 | Back alignment and structure |
|---|
| >2dwv_A Salvador homolog 1 protein; WW domain, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1wr7_A NEDD4-2; all-beta, ligase; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2l4j_A YES-associated protein 2 (YAP2); WW domain, medaka, transcription; NMR {Oryzias latipes} | Back alignment and structure |
|---|
| >2yse_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; MAGI-1, WW domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1e0m_A Wwprototype; SH3 prototype, protein design, de novo protein; NMR {} SCOP: k.22.1.1 | Back alignment and structure |
|---|
| >2jv4_A Peptidyl-prolyl CIS/trans isomerase; ppiase domain, WW domain group IV, rotamase; NMR {Emericella nidulans} | Back alignment and structure |
|---|
| >2ysh_A GAS-7, growth-arrest-specific protein 7; WW domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.22.1.1 | Back alignment and structure |
|---|
| >1ymz_A CC45; artificial protein, computational design, unknown function; NMR {Synthetic} SCOP: k.22.1.1 | Back alignment and structure |
|---|
| >1jmq_A YAP65, 65 kDa YES-associated protein; polyproline ligand, YAP65 mutant, structural protein; NMR {Homo sapiens} SCOP: b.72.1.1 PDB: 1k9q_A* 1k9r_A 1k5r_A* 2lax_A* 2lay_A* | Back alignment and structure |
|---|
| >3c2i_A Methyl-CPG-binding protein 2; water mediated recognition; HET: DNA 5CM; 2.50A {Homo sapiens} PDB: 1qk9_A | Back alignment and structure |
|---|
| >2jx8_A Hpcif1, phosphorylated CTD-interacting factor 1; protein fragment, WW domain, triple-standed beta-sheet, alpha-helix, nucleus, phosphorylation; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3l4h_A E3 ubiquitin-protein ligase HECW1; E3 ligase, WW domain, UBL-conjugation pathway, structural GE structural genomics consortium, SGC, coiled coil; HET: MSE; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1ryq_A DNA-directed RNA polymerase, subunit E''; structural genomics, zinc, PSI, protein structure initiative; 1.38A {Pyrococcus furiosus} SCOP: g.41.9.3 PDB: 3qqc_E | Back alignment and structure |
|---|
| >3p8b_A DNA-directed RNA polymerase, subunit E''; transcription elongation factor, RNA polymerase, transferase transcription complex; 1.80A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3tc5_A Peptidyl-prolyl CIS-trans isomerase NIMA-interact; PIN1 mutant (R14A), oncogenic transformation, small molecule cycle, rotamase, phosphoprotein; HET: 3T5 P6G; 1.40A {Homo sapiens} PDB: 2itk_A* 2q5a_A* 2xp3_A* 2xp4_A* 2xp5_A* 2xp7_A* 2xp8_A* 2xp9_A* 2xpa_A* 2xpb_A* 3kab_A* 3kag_A* 3kah_A* 3kai_A* 3kce_A* 3ntp_A* 3odk_A* 3oob_A* 2zr6_A* 1f8a_B* ... | Back alignment and structure |
|---|
| >2ho2_A Fe65 protein, amyloid beta A4 protein-binding family B member 1; WW domain, beta sheet, Fe65, protein binding; 1.33A {Homo sapiens} SCOP: b.72.1.1 PDB: 2idh_A* 2oei_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 190 | ||||
| d1pina1 | 34 | b.72.1.1 (A:6-39) Mitotic rotamase PIN1 {Human (Ho | 2e-07 | |
| d1tk7a1 | 45 | b.72.1.1 (A:1-45) Suppressor of deltex (Cg4244-pb) | 1e-06 | |
| d1i5hw_ | 50 | b.72.1.1 (W:) Ubiquitin ligase NEDD4 WWIII domain | 3e-06 | |
| d2jmfa1 | 33 | b.72.1.1 (A:521-553) Ubiquitin ligase NEDD4 WWIII | 8e-06 | |
| d1jmqa_ | 46 | b.72.1.1 (A:) Yap65 ww domain {Human (Homo sapiens | 1e-05 | |
| d2rm0w1 | 37 | b.72.1.1 (W:1-37) Formin binding protein FBP28 dom | 7e-04 | |
| d1o6wa2 | 46 | b.72.1.1 (A:30-75) Splicing factor prp40 {Baker's | 0.002 |
| >d1pina1 b.72.1.1 (A:6-39) Mitotic rotamase PIN1 {Human (Homo sapiens) [TaxId: 9606]} Length = 34 | Back information, alignment and structure |
|---|
class: All beta proteins fold: WW domain-like superfamily: WW domain family: WW domain domain: Mitotic rotamase PIN1 species: Human (Homo sapiens) [TaxId: 9606]
Score = 43.5 bits (103), Expect = 2e-07
Identities = 13/31 (41%), Positives = 18/31 (58%)
Query: 62 LPLDWERCLDLQSGRMYYFNRKSSKKSWSLP 92
LP WE+ + SGR+YYFN ++ W P
Sbjct: 2 LPPGWEKRMSRSSGRVYYFNHITNASQWERP 32
|
| >d1tk7a1 b.72.1.1 (A:1-45) Suppressor of deltex (Cg4244-pb) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 45 | Back information, alignment and structure |
|---|
| >d1i5hw_ b.72.1.1 (W:) Ubiquitin ligase NEDD4 WWIII domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 50 | Back information, alignment and structure |
|---|
| >d2jmfa1 b.72.1.1 (A:521-553) Ubiquitin ligase NEDD4 WWIII domain {fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 33 | Back information, alignment and structure |
|---|
| >d1jmqa_ b.72.1.1 (A:) Yap65 ww domain {Human (Homo sapiens) [TaxId: 9606]} Length = 46 | Back information, alignment and structure |
|---|
| >d2rm0w1 b.72.1.1 (W:1-37) Formin binding protein FBP28 domain {Domestic mouse (Mus musculus) [TaxId: 10090]} Length = 37 | Back information, alignment and structure |
|---|
| >d1o6wa2 b.72.1.1 (A:30-75) Splicing factor prp40 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 46 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 190 | |||
| d2jmfa1 | 33 | Ubiquitin ligase NEDD4 WWIII domain {fruit fly (Dr | 99.34 | |
| d1jmqa_ | 46 | Yap65 ww domain {Human (Homo sapiens) [TaxId: 9606 | 99.3 | |
| d1pina1 | 34 | Mitotic rotamase PIN1 {Human (Homo sapiens) [TaxId | 99.29 | |
| d1tk7a1 | 45 | Suppressor of deltex (Cg4244-pb) {Fruit fly (Droso | 99.17 | |
| d1i5hw_ | 50 | Ubiquitin ligase NEDD4 WWIII domain {Rat (Rattus n | 99.15 | |
| d2rm0w1 | 37 | Formin binding protein FBP28 domain {Domestic mous | 98.61 | |
| d1ywia1 | 28 | Huntingtin-interacting protein HYPA/FBP11 {Human ( | 98.21 | |
| d1o6wa2 | 46 | Splicing factor prp40 {Baker's yeast (Saccharomyce | 98.18 | |
| d1o6wa1 | 29 | Splicing factor prp40 {Baker's yeast (Saccharomyce | 98.18 | |
| d2dk1a1 | 38 | WW domain-binding protein 4, WBP4 {Human (Homo sap | 98.01 | |
| d2ho2a1 | 33 | Amyloid beta A4 precursor protein-binding family B | 97.46 | |
| d2jmfa1 | 33 | Ubiquitin ligase NEDD4 WWIII domain {fruit fly (Dr | 94.73 | |
| d1pina1 | 34 | Mitotic rotamase PIN1 {Human (Homo sapiens) [TaxId | 93.36 | |
| d1tk7a1 | 45 | Suppressor of deltex (Cg4244-pb) {Fruit fly (Droso | 93.26 | |
| d1jmqa_ | 46 | Yap65 ww domain {Human (Homo sapiens) [TaxId: 9606 | 93.03 | |
| d1eg3a3 | 38 | Dystrophin {Human (Homo sapiens) [TaxId: 9606]} | 92.19 | |
| d1i5hw_ | 50 | Ubiquitin ligase NEDD4 WWIII domain {Rat (Rattus n | 92.08 | |
| d2rm0w1 | 37 | Formin binding protein FBP28 domain {Domestic mous | 81.12 |
| >d2jmfa1 b.72.1.1 (A:521-553) Ubiquitin ligase NEDD4 WWIII domain {fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: WW domain-like superfamily: WW domain family: WW domain domain: Ubiquitin ligase NEDD4 WWIII domain species: fruit fly (Drosophila melanogaster) [TaxId: 7227]
Probab=99.34 E-value=1.7e-13 Score=84.68 Aligned_cols=32 Identities=22% Similarity=0.653 Sum_probs=30.7
Q ss_pred CCCccchhcccCCCcceEEeecCCCCccccCCC
Q 029636 61 PLPLDWERCLDLQSGRMYYFNRKSSKKSWSLPE 93 (190)
Q Consensus 61 PLPsgWEq~LDlkSG~iYY~N~~T~~ssw~dPr 93 (190)
|||.|||++.|. +|++||+|++|++++|+|||
T Consensus 2 pLP~GWe~~~d~-~G~~Yyinh~t~~T~w~~PR 33 (33)
T d2jmfa1 2 PLPPGWEIRYTA-AGERFFVDHNTRRTTFEDPR 33 (33)
T ss_dssp CCCTTEEEEECT-TSCEEEEETTTCCEESSCCC
T ss_pred ccCCCeeEEECC-CCCEEEEECCCCcEecCCCC
Confidence 899999999995 69999999999999999997
|
| >d1jmqa_ b.72.1.1 (A:) Yap65 ww domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pina1 b.72.1.1 (A:6-39) Mitotic rotamase PIN1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tk7a1 b.72.1.1 (A:1-45) Suppressor of deltex (Cg4244-pb) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1i5hw_ b.72.1.1 (W:) Ubiquitin ligase NEDD4 WWIII domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2rm0w1 b.72.1.1 (W:1-37) Formin binding protein FBP28 domain {Domestic mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ywia1 b.72.1.1 (A:15-42) Huntingtin-interacting protein HYPA/FBP11 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1o6wa2 b.72.1.1 (A:30-75) Splicing factor prp40 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1o6wa1 b.72.1.1 (A:1-29) Splicing factor prp40 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2dk1a1 b.72.1.1 (A:7-44) WW domain-binding protein 4, WBP4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ho2a1 b.72.1.1 (A:253-285) Amyloid beta A4 precursor protein-binding family B member 1, APBB1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2jmfa1 b.72.1.1 (A:521-553) Ubiquitin ligase NEDD4 WWIII domain {fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1pina1 b.72.1.1 (A:6-39) Mitotic rotamase PIN1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tk7a1 b.72.1.1 (A:1-45) Suppressor of deltex (Cg4244-pb) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1jmqa_ b.72.1.1 (A:) Yap65 ww domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1eg3a3 b.72.1.1 (A:47-84) Dystrophin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i5hw_ b.72.1.1 (W:) Ubiquitin ligase NEDD4 WWIII domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2rm0w1 b.72.1.1 (W:1-37) Formin binding protein FBP28 domain {Domestic mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|