Citrus Sinensis ID: 029713

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------19
MENNPSSSRTDRKTIERNRRNQMKALYSTLNSIVPHQRPMEATSLPDQLDEATKYIKRLQTNLERMKERKERLMGIEKPDAAAATSSSGNSSGTITTGLRSPQIEIHEMGSALEVVLTTGLDFQFMFIETIRLLHEEGVEIVNASFNVVEDTIFHTIHSKQIGDSGSDHDASARISERLKKFGQDGSAF
ccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccEEEEEEEccEEEEEEEEccccccHHHHHHHHHHHcccEEEEEEEEEEccEEEEEEEEEEEccccccHHHHHHHHHHHHHHHcccccc
ccccccccHccHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccEEEEEEcccEEEEEEEccccccccHHHHHHHHHHcccEEEEEEEEEcccEEEEEEEEEEcccccccccHHHHHHHHHHHHHHccccc
mennpsssrtdrKTIERNRRNQMKALYSTLNsivphqrpmeatslpdqLDEATKYIKRLQTNLERMKERKERLMgiekpdaaaatsssgnssgtittglrspqieIHEMGSALEVVLTTGLDFQFMFIETIRLLHEEGVEIVNASFNVVEDTIFHtihskqigdsgsdhDASARISERLKKfgqdgsaf
mennpsssrtdrktierNRRNQMKALYSTLnsivphqrpmeatslpdqldeATKYIKRLQTNLERMKERKERLMgiekpdaaaatsssgnssgtitTGLRSPQIEIHEMGSALEVVLTTGLDFQFMFIETIRLLHEEGVEIVNASFNVVEDTIFHTIhskqigdsgsDHDASARISERlkkfgqdgsaf
MENNPSSSRTDRKTIERNRRNQMKALYSTLNSIVPHQRPMEATSLPDQLDEATKYIKRLQTNLERMKERKERLMGIEKPDaaaatsssgnssgtittgLRSPQIEIHEMGSALEVVLTTGLDFQFMFIETIRLLHEEGVEIVNASFNVVEDTIFHTIHSKQIGDSGSDHDASARISERLKKFGQDGSAF
*******************************************************************************************************IEIHEMGSALEVVLTTGLDFQFMFIETIRLLHEEGVEIVNASFNVVEDTIFHTIHS******************************
******************RRNQMKALYSTLNSIVPHQR******LPDQLDEATKYIKRLQT*****************************************QIEIHEMGSALEVVLTTGLDFQFMFIETIRLLHEEGVEIVNASFNVVEDTIFHTIHSKQIG***SDHDASARISERLKKFGQ***AF
*************TIERNRRNQMKALYSTLNSIVPHQRPMEATSLPDQLDEATKYIKRLQTNLERMKERKERLMGIEK*****************TTGLRSPQIEIHEMGSALEVVLTTGLDFQFMFIETIRLLHEEGVEIVNASFNVVEDTIFHTIHSKQ**********SARISERLKK********
*********TDRKTIERNRRNQMKALYSTLNSIVPHQRPMEATSLPDQLDEATKYIKRLQTNLERMKERKERL**************************RSPQIEIHEMGSALEVVLTTGLDFQFMFIETIRLLHEEGVEIVNASFNVVEDTIFHTIHSKQIGDSGSDHDASARISERLKKFGQDGS**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MENNPSSSRTDRKTIERNRRNQMKALYSTLNSIVPHQRPMEATSLPDQxxxxxxxxxxxxxxxxxxxxxxxxxxxxEKPDAAAATSSSGNSSGTITTGLRSPQIEIHEMGSALEVVLTTGLDFQFMFIETIRLLHEEGVEIVNASFNVVEDTIFHTIHSKQIGDSGSDHDASARISERLKKFGQDGSAF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query189 2.2.26 [Sep-21-2011]
Q9FLI1174 Transcription factor bHLH no no 0.756 0.821 0.246 2e-08
Q9ZPY8566 Transcription factor ABA- no no 0.708 0.236 0.300 7e-07
Q9STJ7163 Transcription factor bHLH no no 0.724 0.840 0.256 4e-06
Q9LN95257 Transcription factor bHLH no no 0.841 0.618 0.246 2e-05
Q9LNJ5590 Transcription factor bHLH no no 0.634 0.203 0.268 5e-05
Q9M1K1253 Transcription factor ORG2 no no 0.391 0.292 0.293 8e-05
Q9FLI0204 Transcription factor bHLH no no 0.746 0.691 0.255 0.0001
Q9LQ08259 Transcription factor bHLH no no 0.449 0.328 0.272 0.0004
Q9STJ6221 Transcription factor bHLH no no 0.788 0.674 0.230 0.0006
>sp|Q9FLI1|BH036_ARATH Transcription factor bHLH36 OS=Arabidopsis thaliana GN=BHLH36 PE=2 SV=1 Back     alignment and function desciption
 Score = 59.3 bits (142), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 36/146 (24%), Positives = 78/146 (53%), Gaps = 3/146 (2%)

Query: 16  ERNRRNQMKALYSTLNSIVPHQRPMEATSLPDQLDEATKYIKRLQTNLERMKERKERLMG 75
           ER RR +M +LY++L S++P        S  DQ++EA  YIK LQ  ++ +  R++ LM 
Sbjct: 10  ERQRRQEMASLYASLRSLLPLHFIKGKRSTSDQVNEAVNYIKYLQRKIKELSVRRDDLMV 69

Query: 76  IEKPDAAAATSSSGNSSGTITTGLRSPQIEIHEMGSALEVVLTT-GLDFQFMFIETIRLL 134
           + +     +++        + +G     + + +    +E++L++     Q  F   +++L
Sbjct: 70  LSRGSLLGSSNGDFKEDVEMISG--KNHVVVRQCLVGVEIMLSSRCCGGQPRFSSVLQVL 127

Query: 135 HEEGVEIVNASFNVVEDTIFHTIHSK 160
            E G+ ++N+  ++V+D + +TI ++
Sbjct: 128 SEYGLCLLNSISSIVDDRLVYTIQAE 153

Arabidopsis thaliana (taxid: 3702)
>sp|Q9ZPY8|AIB_ARATH Transcription factor ABA-INDUCIBLE bHLH-TYPE OS=Arabidopsis thaliana GN=AIB PE=2 SV=2 Back     alignment and function description
>sp|Q9STJ7|BH118_ARATH Transcription factor bHLH118 OS=Arabidopsis thaliana GN=BHLH118 PE=2 SV=1 Back     alignment and function description
>sp|Q9LN95|BH055_ARATH Transcription factor bHLH55 OS=Arabidopsis thaliana GN=BHLH55 PE=2 SV=1 Back     alignment and function description
>sp|Q9LNJ5|BH013_ARATH Transcription factor bHLH13 OS=Arabidopsis thaliana GN=BHLH13 PE=2 SV=1 Back     alignment and function description
>sp|Q9M1K1|ORG2_ARATH Transcription factor ORG2 OS=Arabidopsis thaliana GN=ORG2 PE=1 SV=1 Back     alignment and function description
>sp|Q9FLI0|BH120_ARATH Transcription factor bHLH120 OS=Arabidopsis thaliana GN=BHLH120 PE=2 SV=2 Back     alignment and function description
>sp|Q9LQ08|BH125_ARATH Transcription factor bHLH125 OS=Arabidopsis thaliana GN=BHLH125 PE=2 SV=1 Back     alignment and function description
>sp|Q9STJ6|BH126_ARATH Transcription factor bHLH126 OS=Arabidopsis thaliana GN=BHLH126 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query189
224125352183 predicted protein [Populus trichocarpa] 0.962 0.994 0.710 3e-67
147822237174 hypothetical protein VITISV_010916 [Viti 0.910 0.988 0.692 5e-62
255536797210 DNA binding protein, putative [Ricinus c 0.947 0.852 0.647 6e-62
359496902152 PREDICTED: transcription factor bHLH36-l 0.804 1.0 0.706 3e-58
356546644181 PREDICTED: uncharacterized protein LOC10 0.936 0.977 0.620 5e-58
224079207162 predicted protein [Populus trichocarpa] 0.820 0.956 0.701 1e-57
356557693180 PREDICTED: uncharacterized protein LOC10 0.931 0.977 0.614 1e-56
357446631174 Transcription factor bHLH36 [Medicago tr 0.915 0.994 0.594 1e-55
388518121180 unknown [Lotus japonicus] 0.904 0.95 0.587 4e-54
124359694221 Helix-loop-helix DNA-binding [Medicago t 0.915 0.782 0.546 1e-53
>gi|224125352|ref|XP_002329784.1| predicted protein [Populus trichocarpa] gi|222870846|gb|EEF07977.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  259 bits (663), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 135/190 (71%), Positives = 152/190 (80%), Gaps = 8/190 (4%)

Query: 1   MENNPSSSRTDRKTIERNRRNQMKALYSTLNSIVPHQRPMEAT-SLPDQLDEATKYIKRL 59
           MENNPSSSRTDRKTIERNRRNQMKALYS LNS+VPHQ   E   SLPDQLDEA  YIKRL
Sbjct: 1   MENNPSSSRTDRKTIERNRRNQMKALYSQLNSLVPHQSSREPVLSLPDQLDEAASYIKRL 60

Query: 60  QTNLERMKERKERLMGIEKPDAAAATSSSGNSSGTITTGLRSPQIEIHEMGSALEVVLTT 119
           QTNLERMKE+K+ LMG E+ + A+ +S +G      TTGLRSPQIEI E GS LEVVL T
Sbjct: 61  QTNLERMKEKKDNLMGTERKNYASMSSCNG-----TTTGLRSPQIEIRETGSTLEVVLIT 115

Query: 120 GLDFQFMFIETIRLLHEEGVEIVNASFNVVEDTIFHTIHSKQIGDSGSDHDASARISERL 179
           GLD QFMF ETIR+LHEEG EI+NASF+VVEDT+FHTIHSK +GDS   + A ARIS+RL
Sbjct: 116 GLDGQFMFNETIRVLHEEGAEIINASFSVVEDTVFHTIHSK-VGDSAPSNGA-ARISQRL 173

Query: 180 KKFGQDGSAF 189
            +F QD +A 
Sbjct: 174 NQFVQDDNAL 183

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|147822237|emb|CAN61967.1| hypothetical protein VITISV_010916 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255536797|ref|XP_002509465.1| DNA binding protein, putative [Ricinus communis] gi|223549364|gb|EEF50852.1| DNA binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|359496902|ref|XP_003635365.1| PREDICTED: transcription factor bHLH36-like, partial [Vitis vinifera] gi|296086982|emb|CBI33238.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356546644|ref|XP_003541734.1| PREDICTED: uncharacterized protein LOC100784418 [Glycine max] Back     alignment and taxonomy information
>gi|224079207|ref|XP_002305793.1| predicted protein [Populus trichocarpa] gi|222848757|gb|EEE86304.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356557693|ref|XP_003547148.1| PREDICTED: uncharacterized protein LOC100814407 [Glycine max] Back     alignment and taxonomy information
>gi|357446631|ref|XP_003593591.1| Transcription factor bHLH36 [Medicago truncatula] gi|355482639|gb|AES63842.1| Transcription factor bHLH36 [Medicago truncatula] Back     alignment and taxonomy information
>gi|388518121|gb|AFK47122.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|124359694|gb|ABD32361.2| Helix-loop-helix DNA-binding [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query189
TAIR|locus:2133089190 AT4G20970 "AT4G20970" [Arabido 0.931 0.926 0.434 2e-33
TAIR|locus:505006117181 AT1G10585 [Arabidopsis thalian 0.767 0.801 0.277 1.5e-10
TAIR|locus:4515102513174 AT1G10586 [Arabidopsis thalian 0.767 0.833 0.259 3.2e-10
TAIR|locus:2165311174 AT5G51780 "AT5G51780" [Arabido 0.862 0.936 0.248 2.2e-09
UNIPROTKB|Q941Z7248 P0431G06.13-1 "BHLH transcript 0.910 0.693 0.213 2.9e-06
TAIR|locus:2138019163 AT4G25400 "AT4G25400" [Arabido 0.740 0.858 0.236 3.6e-06
TAIR|locus:2146663240 BHLH101 "AT5G04150" [Arabidops 0.767 0.604 0.236 6.1e-06
TAIR|locus:2080600253 bHLH38 "basic helix-loop-helix 0.391 0.292 0.293 2.1e-05
TAIR|locus:2080615258 bHLH39 "basic helix-loop-helix 0.391 0.286 0.293 0.00016
TAIR|locus:504956298259 AT1G62975 "AT1G62975" [Arabido 0.380 0.277 0.277 0.0004
TAIR|locus:2133089 AT4G20970 "AT4G20970" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 364 (133.2 bits), Expect = 2.0e-33, P = 2.0e-33
 Identities = 79/182 (43%), Positives = 109/182 (59%)

Query:     3 NNPSSSRT-DRKTIERNRRNQMKALYSTLNSIVPHQRPMEATSLPDQLDEATKYIKRLQT 61
             +N   SR+ DRKT+E+NRR QMK+LYS L S++PH    E  +LPDQLDEA  YIK+LQ 
Sbjct:     6 SNTGQSRSVDRKTVEKNRRMQMKSLYSELISLLPHHSSTEPLTLPDQLDEAANYIKKLQV 65

Query:    62 NLERMKERKERLMGIEKPDXXXXXXXXXXXXXXXXXXLRS-PQIEIHEMGSALEVVLTTG 120
             N+E+ +ERK  L+     +                   R  P+IEI E GS   + L T 
Sbjct:    66 NVEKKRERKRNLVATTTLEKLNSVGSSSVSSSVDVSVPRKLPKIEIQETGSIFHIFLVTS 125

Query:   121 LDFQFMFIETIRLLHEE-GVEIVNASFNVVEDTIFHTIHSKQIGDSGSDHDASARISERL 179
             L+ +FMF E IR+L EE G EI +A +++V+D +FHT+H K       D+ A ++I ERL
Sbjct:   126 LEHKFMFCEIIRVLTEELGAEITHAGYSIVDDAVFHTLHCKV---EEHDYGARSQIPERL 182

Query:   180 KK 181
             +K
Sbjct:   183 EK 184
GO:0003677 "DNA binding" evidence=ISS
GO:0005634 "nucleus" evidence=ISM
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=TAS
GO:0050832 "defense response to fungus" evidence=IEP
TAIR|locus:505006117 AT1G10585 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:4515102513 AT1G10586 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2165311 AT5G51780 "AT5G51780" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q941Z7 P0431G06.13-1 "BHLH transcription factor-like" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2138019 AT4G25400 "AT4G25400" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2146663 BHLH101 "AT5G04150" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2080600 bHLH38 "basic helix-loop-helix 38" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2080615 bHLH39 "basic helix-loop-helix 39" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504956298 AT1G62975 "AT1G62975" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
estExt_fgenesh4_pg.C_1240042
hypothetical protein (183 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query189
pfam0001052 pfam00010, HLH, Helix-loop-helix DNA-binding domai 2e-06
cd0008360 cd00083, HLH, Helix-loop-helix domain, found in sp 3e-05
smart0035353 smart00353, HLH, helix loop helix domain 5e-04
>gnl|CDD|215654 pfam00010, HLH, Helix-loop-helix DNA-binding domain Back     alignment and domain information 
 Score = 42.4 bits (101), Expect = 2e-06
 Identities = 16/52 (30%), Positives = 25/52 (48%), Gaps = 1/52 (1%)

Query: 9  RTDRKTIERNRRNQMKALYSTLNSIVPHQRPMEATSLPDQLDEATKYIKRLQ 60
          R      ER RR+++   +  L  ++P   P +  S  + L  A +YIK LQ
Sbjct: 2  RKAHNERERRRRDRINDAFEELRELLPTP-PNKKLSKAEILRLAIEYIKHLQ 52

Length = 52
>gnl|CDD|238036 cd00083, HLH, Helix-loop-helix domain, found in specific DNA- binding proteins that act as transcription factors; 60-100 amino acids long Back     alignment and domain information
>gnl|CDD|197674 smart00353, HLH, helix loop helix domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 189
PF0001055 HLH: Helix-loop-helix DNA-binding domain only nucl 99.46
cd0008360 HLH Helix-loop-helix domain, found in specific DNA 99.46
smart0035353 HLH helix loop helix domain. 99.37
KOG1318411 consensus Helix loop helix transcription factor EB 98.9
KOG2483232 consensus Upstream transcription factor 2/L-myc-2 98.56
KOG1319229 consensus bHLHZip transcription factor BIGMAX [Tra 98.54
KOG4029228 consensus Transcription factor HAND2/Transcription 98.33
PLN0321793 transcription factor ATBS1; Provisional 98.22
KOG3561 803 consensus Aryl-hydrocarbon receptor nuclear transl 98.22
cd0492776 ACT_ACR-like_2 Second ACT domain, of a novel type 98.02
KOG4304250 consensus Transcriptional repressors of the hairy/ 97.97
KOG3960284 consensus Myogenic helix-loop-helix transcription 97.96
cd0489675 ACT_ACR-like_3 ACT domain-containing protein which 97.95
cd0489572 ACT_ACR_1 ACT domain-containing protein which is c 97.93
cd0489775 ACT_ACR_3 ACT domain-containing protein which is c 97.92
cd0490073 ACT_UUR-like_1 ACT domain family, ACT_UUR-like_1, 97.9
cd0492868 ACT_TyrKc Uncharacterized, N-terminal ACT domain o 97.85
KOG0561 373 consensus bHLH transcription factor [Transcription 97.81
cd0492574 ACT_ACR_2 ACT domain-containing protein which is c 97.65
cd0489970 ACT_ACR-UUR-like_2 C-terminal ACT domains of the b 97.5
cd0492672 ACT_ACR_4 C-terminal ACT domain, of a novel type o 97.42
KOG2588 953 consensus Predicted DNA-binding protein [Transcrip 97.22
KOG3898254 consensus Transcription factor NeuroD and related 96.78
cd0487370 ACT_UUR-ACR-like ACT domains of the bacterial sign 96.65
PRK03381 774 PII uridylyl-transferase; Provisional 96.62
PF1374076 ACT_6: ACT domain; PDB: 1ZPV_A 3P96_A 1U8S_A. 96.59
PF0184266 ACT: ACT domain; InterPro: IPR002912 The ACT domai 96.48
PRK00275895 glnD PII uridylyl-transferase; Provisional 96.45
cd0489377 ACT_GcvR_1 ACT domains that comprise the Glycine C 96.38
PRK0019490 hypothetical protein; Validated 96.3
PRK05007884 PII uridylyl-transferase; Provisional 96.29
KOG4447173 consensus Transcription factor TWIST [Transcriptio 96.12
cd0487574 ACT_F4HF-DF N-terminal ACT domain of formyltetrahy 96.11
PRK05092931 PII uridylyl-transferase; Provisional 96.09
cd0487288 ACT_1ZPV ACT domain proteins similar to the yet un 96.08
PRK04374869 PII uridylyl-transferase; Provisional 96.07
TIGR01693 850 UTase_glnD [Protein-PII] uridylyltransferase. This 96.04
PRK03059856 PII uridylyl-transferase; Provisional 96.01
PF1329180 ACT_4: ACT domain; PDB: 2KO1_B 3IBW_A. 95.94
cd0486981 ACT_GcvR_2 ACT domains that comprise the Glycine C 95.91
PRK01759854 glnD PII uridylyl-transferase; Provisional 95.82
KOG4395285 consensus Transcription factor Atonal, contains HT 95.8
PRK05007 884 PII uridylyl-transferase; Provisional 95.79
PRK03059 856 PII uridylyl-transferase; Provisional 95.7
PRK03381774 PII uridylyl-transferase; Provisional 95.62
PRK01759854 glnD PII uridylyl-transferase; Provisional 95.22
PRK00275 895 glnD PII uridylyl-transferase; Provisional 95.19
KOG3910632 consensus Helix loop helix transcription factor [T 95.1
cd0488774 ACT_MalLac-Enz ACT_MalLac-Enz CD includes the N-te 94.87
cd0487075 ACT_PSP_1 CT domains found N-terminal of phosphose 94.78
PRK04374 869 PII uridylyl-transferase; Provisional 94.78
cd0488673 ACT_ThrD-II-like C-terminal ACT domain of biodegra 94.64
cd0488876 ACT_PheB-BS C-terminal ACT domain of a small (~147 94.53
PRK04435147 hypothetical protein; Provisional 94.46
PRK05092 931 PII uridylyl-transferase; Provisional 94.44
TIGR01693850 UTase_glnD [Protein-PII] uridylyltransferase. This 94.3
COG2844867 GlnD UTP:GlnB (protein PII) uridylyltransferase [P 93.75
cd0488075 ACT_AAAH-PDT-like ACT domain of the nonheme iron-d 93.3
cd0487671 ACT_RelA-SpoT ACT domain found C-terminal of the R 92.93
PRK13011 286 formyltetrahydrofolate deformylase; Reviewed 92.54
cd0490580 ACT_CM-PDT C-terminal ACT domain of the bifunction 91.96
cd0488179 ACT_HSDH-Hom ACT_HSDH_Hom CD includes the C-termin 91.67
PRK06027 286 purU formyltetrahydrofolate deformylase; Reviewed 91.47
PRK08577136 hypothetical protein; Provisional 91.37
cd0487774 ACT_TyrR N-terminal ACT domain of the TyrR protein 91.31
KOG3560 712 consensus Aryl-hydrocarbon receptor [Transcription 90.9
cd0487472 ACT_Af1403 N-terminal ACT domain of the yet unchar 90.78
cd0489469 ACT_ACR-like_1 ACT domain-containing protein which 90.43
PF1371063 ACT_5: ACT domain; PDB: 2FGC_A 2PC6_A 2F1F_B. 90.41
cd0487971 ACT_3PGDH-like ACT_3PGDH-like CD includes the C-te 89.69
TIGR00655 280 PurU formyltetrahydrofolate deformylase. This mode 89.17
PRK00227693 glnD PII uridylyl-transferase; Provisional 89.06
KOG3558 768 consensus Hypoxia-inducible factor 1/Neuronal PAS 88.59
COG2844 867 GlnD UTP:GlnB (protein PII) uridylyltransferase [P 88.55
cd0490474 ACT_AAAH ACT domain of the nonheme iron-dependent, 87.89
COG383090 ACT domain-containing protein [Signal transduction 87.85
PRK13010 289 purU formyltetrahydrofolate deformylase; Reviewed 87.78
cd0487872 ACT_AHAS N-terminal ACT domain of the Escherichia 87.56
cd0211660 ACT ACT domains are commonly involved in specifica 87.0
PRK07334403 threonine dehydratase; Provisional 86.72
cd0490371 ACT_LSD C-terminal ACT domain of the L-serine dehy 86.71
KOG3559 598 consensus Transcriptional regulator SIM1 [Transcri 86.6
KOG4447173 consensus Transcription factor TWIST [Transcriptio 86.47
cd0493190 ACT_PAH ACT domain of the nonheme iron-dependent a 86.4
cd0488472 ACT_CBS C-terminal ACT domain of the cystathionine 85.45
cd0492974 ACT_TPH ACT domain of the nonheme iron-dependent a 85.06
COG4492150 PheB ACT domain-containing protein [General functi 85.04
cd0490969 ACT_PDH-BS C-terminal ACT domain of the monofuncti 83.79
cd0490273 ACT_3PGDH-xct C-terminal ACT (regulatory) domain o 83.51
cd0488956 ACT_PDH-BS-like C-terminal ACT domain of the monof 83.27
TIGR00119157 acolac_sm acetolactate synthase, small subunit. ac 81.97
cd0488372 ACT_AcuB C-terminal ACT domain of the Bacillus sub 81.78
PRK11589 190 gcvR glycine cleavage system transcriptional repre 81.49
PRK11895161 ilvH acetolactate synthase 3 regulatory subunit; R 80.57
>PF00010 HLH: Helix-loop-helix DNA-binding domain only nuclear translocator protein (Arnt) Back     alignment and domain information 
Probab=99.46  E-value=1.5e-13  Score=89.76  Aligned_cols=53  Identities=28%  Similarity=0.466  Sum_probs=47.1

Q ss_pred             chhhhhHHHHHHHHHHHHHHHHHHhcCCCC--CCCCCCChhhhHHHHHHHHHHHH
Q 029713            8 SRTDRKTIERNRRNQMKALYSTLNSIVPHQ--RPMEATSLPDQLDEATKYIKRLQ   60 (189)
Q Consensus         8 ~~~~h~~~ER~RR~~mn~~~~~LrsllP~~--~~~~k~s~~~~l~~ai~yI~~Lq   60 (189)
                      +|..|+..||+||..||..|..|+.+||..  ....|.+..++|..||+||++||
T Consensus         1 rR~~h~~~Er~RR~~i~~~~~~L~~llp~~~~~~~~k~~K~~iL~~ai~yI~~Lq   55 (55)
T PF00010_consen    1 RRQKHNERERRRRDRINDCFDELRELLPSCSAGSSRKLSKASILQKAIDYIKQLQ   55 (55)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHCCSSHHCCTTSSSSHHHHHHHHHHHHHHHH
T ss_pred             CCchHHHHHHHHHHHHHHHHHHHHHhccchhccccccCCHHHHHHHHHHHHHHhC
Confidence            478999999999999999999999999986  24566777777999999999997

; InterPro: IPR011598 The helix-loop-helix (HLH) DNA-binding domain consists of a closed bundle of four helices in a left-handed twist with two crossover connections. The HLH domain directs dimerisation, and is juxtaposed to basic regions to create a DNA interaction interface surface that recognises specific DNA sequences. Basic region/HLH (bHLH) proteins regulate diverse biological pathways []. bHLH proteins include MyoD [], SREBPs (sterol regulatory element binding proteins) [], and yeast Pho4 (phosphatase system) []. In certain proteins the bHLH domain contains a leucine-zipper motif. The bHLH/leucine zipper (bHLHZip) domain specifies dimerisation within a network of proteins and determines sequence-specific DNA binding []. bHLHZip domains occur in the transcription factors Myc, Mad, Max and Usf [, ]. This entry is bHLHZip, which covers the bHLH domain and the leucine zipper motif, when present.; PDB: 1NLW_A 1NKP_D 1A93_A 2A93_A 1AM9_C 3U5V_A 1A0A_B 2QL2_C 1UKL_C 1AN4_B ....
>cd00083 HLH Helix-loop-helix domain, found in specific DNA- binding proteins that act as transcription factors; 60-100 amino acids long Back     alignment and domain information
>smart00353 HLH helix loop helix domain Back     alignment and domain information
>KOG1318 consensus Helix loop helix transcription factor EB [Transcription] Back     alignment and domain information
>KOG2483 consensus Upstream transcription factor 2/L-myc-2 protein [Transcription] Back     alignment and domain information
>KOG1319 consensus bHLHZip transcription factor BIGMAX [Transcription] Back     alignment and domain information
>KOG4029 consensus Transcription factor HAND2/Transcription factor TAL1/TAL2/LYL1 [Transcription] Back     alignment and domain information
>PLN03217 transcription factor ATBS1; Provisional Back     alignment and domain information
>KOG3561 consensus Aryl-hydrocarbon receptor nuclear translocator [Transcription] Back     alignment and domain information
>cd04927 ACT_ACR-like_2 Second ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>KOG4304 consensus Transcriptional repressors of the hairy/E(spl) family (contains HLH) [Transcription] Back     alignment and domain information
>KOG3960 consensus Myogenic helix-loop-helix transcription factor [Transcription] Back     alignment and domain information
>cd04896 ACT_ACR-like_3 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04895 ACT_ACR_1 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04897 ACT_ACR_3 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04900 ACT_UUR-like_1 ACT domain family, ACT_UUR-like_1, includes the first of two C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains Back     alignment and domain information
>cd04928 ACT_TyrKc Uncharacterized, N-terminal ACT domain of an Arabidopsis/Oryza predicted tyrosine kinase and other related ACT domains Back     alignment and domain information
>KOG0561 consensus bHLH transcription factor [Transcription] Back     alignment and domain information
>cd04925 ACT_ACR_2 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04899 ACT_ACR-UUR-like_2 C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains Back     alignment and domain information
>cd04926 ACT_ACR_4 C-terminal ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>KOG2588 consensus Predicted DNA-binding protein [Transcription] Back     alignment and domain information
>KOG3898 consensus Transcription factor NeuroD and related HTH proteins [Transcription] Back     alignment and domain information
>cd04873 ACT_UUR-ACR-like ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD Back     alignment and domain information
>PRK03381 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PF13740 ACT_6: ACT domain; PDB: 1ZPV_A 3P96_A 1U8S_A Back     alignment and domain information
>PF01842 ACT: ACT domain; InterPro: IPR002912 The ACT domain is found in a variety of contexts and is proposed to be a conserved regulatory binding fold Back     alignment and domain information
>PRK00275 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>cd04893 ACT_GcvR_1 ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains Back     alignment and domain information
>PRK00194 hypothetical protein; Validated Back     alignment and domain information
>PRK05007 PII uridylyl-transferase; Provisional Back     alignment and domain information
>KOG4447 consensus Transcription factor TWIST [Transcription] Back     alignment and domain information
>cd04875 ACT_F4HF-DF N-terminal ACT domain of formyltetrahydrofolate deformylase (F4HF-DF; formyltetrahydrofolate hydrolase) Back     alignment and domain information
>PRK05092 PII uridylyl-transferase; Provisional Back     alignment and domain information
>cd04872 ACT_1ZPV ACT domain proteins similar to the yet uncharacterized Streptococcus pneumoniae ACT domain protein Back     alignment and domain information
>PRK04374 PII uridylyl-transferase; Provisional Back     alignment and domain information
>TIGR01693 UTase_glnD [Protein-PII] uridylyltransferase Back     alignment and domain information
>PRK03059 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PF13291 ACT_4: ACT domain; PDB: 2KO1_B 3IBW_A Back     alignment and domain information
>cd04869 ACT_GcvR_2 ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains Back     alignment and domain information
>PRK01759 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>KOG4395 consensus Transcription factor Atonal, contains HTH domain [Transcription] Back     alignment and domain information
>PRK05007 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK03059 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK03381 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK01759 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK00275 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>KOG3910 consensus Helix loop helix transcription factor [Transcription] Back     alignment and domain information
>cd04887 ACT_MalLac-Enz ACT_MalLac-Enz CD includes the N-terminal ACT domain of putative NAD-dependent malic enzyme 1, Bacillus subtilis YqkI and related domains Back     alignment and domain information
>cd04870 ACT_PSP_1 CT domains found N-terminal of phosphoserine phosphatase (PSP, SerB) Back     alignment and domain information
>PRK04374 PII uridylyl-transferase; Provisional Back     alignment and domain information
>cd04886 ACT_ThrD-II-like C-terminal ACT domain of biodegradative (catabolic) threonine dehydratase II (ThrD-II) and other related ACT domains Back     alignment and domain information
>cd04888 ACT_PheB-BS C-terminal ACT domain of a small (~147 a Back     alignment and domain information
>PRK04435 hypothetical protein; Provisional Back     alignment and domain information
>PRK05092 PII uridylyl-transferase; Provisional Back     alignment and domain information
>TIGR01693 UTase_glnD [Protein-PII] uridylyltransferase Back     alignment and domain information
>COG2844 GlnD UTP:GlnB (protein PII) uridylyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd04880 ACT_AAAH-PDT-like ACT domain of the nonheme iron-dependent, aromatic amino acid hydroxylases (AAAH) Back     alignment and domain information
>cd04876 ACT_RelA-SpoT ACT domain found C-terminal of the RelA/SpoT domains Back     alignment and domain information
>PRK13011 formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>cd04905 ACT_CM-PDT C-terminal ACT domain of the bifunctional chorismate mutase-prephenate dehydratase (CM-PDT) enzyme and the prephenate dehydratase (PDT) enzyme Back     alignment and domain information
>cd04881 ACT_HSDH-Hom ACT_HSDH_Hom CD includes the C-terminal ACT domain of the NAD(P)H-dependent, homoserine dehydrogenase (HSDH) and related domains Back     alignment and domain information
>PRK06027 purU formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>PRK08577 hypothetical protein; Provisional Back     alignment and domain information
>cd04877 ACT_TyrR N-terminal ACT domain of the TyrR protein Back     alignment and domain information
>KOG3560 consensus Aryl-hydrocarbon receptor [Transcription] Back     alignment and domain information
>cd04874 ACT_Af1403 N-terminal ACT domain of the yet uncharacterized, small (~133 a Back     alignment and domain information
>cd04894 ACT_ACR-like_1 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>PF13710 ACT_5: ACT domain; PDB: 2FGC_A 2PC6_A 2F1F_B Back     alignment and domain information
>cd04879 ACT_3PGDH-like ACT_3PGDH-like CD includes the C-terminal ACT (regulatory) domain of D-3-phosphoglycerate dehydrogenase (3PGDH) Back     alignment and domain information
>TIGR00655 PurU formyltetrahydrofolate deformylase Back     alignment and domain information
>PRK00227 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>KOG3558 consensus Hypoxia-inducible factor 1/Neuronal PAS domain protein NPAS1 [Signal transduction mechanisms; Transcription] Back     alignment and domain information
>COG2844 GlnD UTP:GlnB (protein PII) uridylyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd04904 ACT_AAAH ACT domain of the nonheme iron-dependent, aromatic amino acid hydroxylases (AAAH) Back     alignment and domain information
>COG3830 ACT domain-containing protein [Signal transduction mechanisms] Back     alignment and domain information
>PRK13010 purU formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>cd04878 ACT_AHAS N-terminal ACT domain of the Escherichia coli IlvH-like regulatory subunit of acetohydroxyacid synthase (AHAS) Back     alignment and domain information
>cd02116 ACT ACT domains are commonly involved in specifically binding an amino acid or other small ligand leading to regulation of the enzyme Back     alignment and domain information
>PRK07334 threonine dehydratase; Provisional Back     alignment and domain information
>cd04903 ACT_LSD C-terminal ACT domain of the L-serine dehydratase (LSD), iron-sulfur-dependent, beta subunit Back     alignment and domain information
>KOG3559 consensus Transcriptional regulator SIM1 [Transcription] Back     alignment and domain information
>KOG4447 consensus Transcription factor TWIST [Transcription] Back     alignment and domain information
>cd04931 ACT_PAH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, phenylalanine hydroxylases (PAH) Back     alignment and domain information
>cd04884 ACT_CBS C-terminal ACT domain of the cystathionine beta-synthase (CBS) domain protein found in Thermotoga maritima, Tm0935, and delta proteobacteria Back     alignment and domain information
>cd04929 ACT_TPH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, tryptophan hydroxylases (TPH), both peripheral (TPH1) and neuronal (TPH2) enzymes Back     alignment and domain information
>COG4492 PheB ACT domain-containing protein [General function prediction only] Back     alignment and domain information
>cd04909 ACT_PDH-BS C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH) Back     alignment and domain information
>cd04902 ACT_3PGDH-xct C-terminal ACT (regulatory) domain of D-3-phosphoglycerate dehydrogenase (3PGDH) Back     alignment and domain information
>cd04889 ACT_PDH-BS-like C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH) enzyme that catalyzes the formation of 4-hydroxyphenylpyruvate from prephenate Back     alignment and domain information
>TIGR00119 acolac_sm acetolactate synthase, small subunit Back     alignment and domain information
>cd04883 ACT_AcuB C-terminal ACT domain of the Bacillus subtilis acetoin utilization protein, AcuB Back     alignment and domain information
>PRK11589 gcvR glycine cleavage system transcriptional repressor; Provisional Back     alignment and domain information
>PRK11895 ilvH acetolactate synthase 3 regulatory subunit; Reviewed Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query189
1nkp_A88 C-MYC, MYC proto-oncogene protein; transcription, 5e-09
1nkp_B83 MAX protein, MYC proto-oncogene protein; transcrip 9e-08
1hlo_A80 Protein (transcription factor MAX); transcriptiona 1e-06
1nlw_A80 MAD protein, MAX dimerizer; transcription factor, 1e-06
1am9_A82 Srebp-1A, protein (sterol regulatory element bindi 3e-05
1an4_A65 Protein (upstream stimulatory factor); protein-DNA 3e-05
>1nkp_A C-MYC, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 Length = 88 Back     alignment and structure
 Score = 50.4 bits (121), Expect = 5e-09
 Identities = 17/65 (26%), Positives = 29/65 (44%)

Query: 9  RTDRKTIERNRRNQMKALYSTLNSIVPHQRPMEATSLPDQLDEATKYIKRLQTNLERMKE 68
          R     +ER RRN++K  +  L   +P     E       L +AT YI  +Q   +++  
Sbjct: 7  RRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLIS 66

Query: 69 RKERL 73
           ++ L
Sbjct: 67 EEDLL 71
>1nkp_B MAX protein, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 PDB: 1an2_A* 1r05_A 1nlw_B Length = 83 Back     alignment and structure
>1hlo_A Protein (transcription factor MAX); transcriptional regulation, DNA binding, complex (transcription factor MAX/DNA), transcription/DNA complex; HET: DNA; 2.80A {Homo sapiens} SCOP: a.38.1.1 Length = 80 Back     alignment and structure
>1nlw_A MAD protein, MAX dimerizer; transcription factor, DNA, BHLHZ, transcription/DNA complex; 2.00A {Homo sapiens} SCOP: a.38.1.1 Length = 80 Back     alignment and structure
>1am9_A Srebp-1A, protein (sterol regulatory element binding protein 1A); basic-helix-loop- helix-leucine zipper, transcription factor; HET: DNA; 2.30A {Homo sapiens} SCOP: a.38.1.1 PDB: 1ukl_C Length = 82 Back     alignment and structure
>1an4_A Protein (upstream stimulatory factor); protein-DNA complex, double helix, overhanging base, transcription/DNA complex; HET: DNA; 2.90A {Homo sapiens} SCOP: a.38.1.1 Length = 65 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query189
1nlw_A80 MAD protein, MAX dimerizer; transcription factor, 99.68
1am9_A82 Srebp-1A, protein (sterol regulatory element bindi 99.67
1nkp_A88 C-MYC, MYC proto-oncogene protein; transcription, 99.63
1nkp_B83 MAX protein, MYC proto-oncogene protein; transcrip 99.63
1hlo_A80 Protein (transcription factor MAX); transcriptiona 99.63
4h10_B71 Circadian locomoter output cycles protein kaput; B 99.58
1a0a_A63 BHLH, protein (phosphate system positive regulator 99.57
2ql2_B60 Neurod1, neurogenic differentiation factor 1; basi 99.55
1an4_A65 Protein (upstream stimulatory factor); protein-DNA 99.55
3u5v_A76 Protein MAX, transcription factor E2-alpha chimer; 99.55
4ati_A118 MITF, microphthalmia-associated transcription fact 99.51
1mdy_A68 Protein (MYOD BHLH domain); protein-DNA complex, t 99.45
4h10_A73 ARYL hydrocarbon receptor nuclear translocator-LI 99.44
2lfh_A68 DNA-binding protein inhibitor ID-3; structural gen 99.14
4f3l_A 361 Mclock, circadian locomoter output cycles protein 98.98
4aya_A97 DNA-binding protein inhibitor ID-2; cell cycle; 2. 98.8
4f3l_B 387 BMAL1B; BHLH, PAS, circadian rhythm proteins, tran 98.79
4ath_A83 MITF, microphthalmia-associated transcription fact 98.35
1zpv_A91 ACT domain protein; structural genomics, PSI, prot 96.89
1u8s_A 192 Glycine cleavage system transcriptional repressor, 95.29
2nyi_A 195 Unknown protein; protein structure initiative, PSI 95.12
2ko1_A88 CTR148A, GTP pyrophosphokinase; homodimer, alpha+b 94.9
1u8s_A192 Glycine cleavage system transcriptional repressor, 93.98
2nyi_A195 Unknown protein; protein structure initiative, PSI 93.58
3p96_A 415 Phosphoserine phosphatase SERB; ssgcid, structural 90.26
3o1l_A 302 Formyltetrahydrofolate deformylase; structural gen 89.56
3n0v_A 286 Formyltetrahydrofolate deformylase; formyl transfe 89.52
3obi_A 288 Formyltetrahydrofolate deformylase; structural gen 88.3
2f1f_A164 Acetolactate synthase isozyme III small subunit; f 86.49
3lou_A 292 Formyltetrahydrofolate deformylase; structural gen 86.12
3nrb_A 287 Formyltetrahydrofolate deformylase; N-terminal ACT 84.98
2pc6_A165 Probable acetolactate synthase isozyme III (small; 83.07
3he4_B46 Synzip5; heterodimeric coiled-coil, de novo protei 82.38
2fgc_A193 Acetolactate synthase, small subunit; regulatory s 80.05
>1nlw_A MAD protein, MAX dimerizer; transcription factor, DNA, BHLHZ, transcription/DNA complex; 2.00A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
Probab=99.68  E-value=1.7e-16  Score=110.80  Aligned_cols=67  Identities=22%  Similarity=0.339  Sum_probs=61.7

Q ss_pred             chhhhhHHHHHHHHHHHHHHHHHHhcCCCCCCCCCCChhhhHHHHHHHHHHHHHHHHHHHHHHHHHh
Q 029713            8 SRTDRKTIERNRRNQMKALYSTLNSIVPHQRPMEATSLPDQLDEATKYIKRLQTNLERMKERKERLM   74 (189)
Q Consensus         8 ~~~~h~~~ER~RR~~mn~~~~~LrsllP~~~~~~k~s~~~~l~~ai~yI~~Lq~~v~~L~~~~~~~~   74 (189)
                      .|..||..||+||..||..|..|+++||..+...|+|.+.||..|++||+.|+++.+.|..+++.+.
T Consensus         1 ~R~~HN~~ER~RR~~lk~~f~~Lr~~vP~~~~~~k~sk~~iL~kA~~yI~~L~~~~~~l~~e~~~L~   67 (80)
T 1nlw_A            1 SRSTHNEMEKNRRAHLRLSLEKLKGLVPLGPDSSRHTTLSLLTKAKLHIKKLEDSDRKAVHQIDQLQ   67 (80)
T ss_dssp             CHHHHHHHHHHHHHHHHHHHHHHHHSSCCCSSSCCCTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CcchHHHHHHHHHHHHHHHHHHHHHHcCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            3789999999999999999999999999887778888888899999999999999999998887764
>1am9_A Srebp-1A, protein (sterol regulatory element binding protein 1A); basic-helix-loop- helix-leucine zipper, transcription factor; HET: DNA; 2.30A {Homo sapiens} SCOP: a.38.1.1 PDB: 1ukl_C Back     alignment and structure
>1nkp_A C-MYC, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>1nkp_B MAX protein, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 PDB: 1an2_A* 1r05_A 1nlw_B Back     alignment and structure
>1hlo_A Protein (transcription factor MAX); transcriptional regulation, DNA binding, complex (transcription factor MAX/DNA), transcription/DNA complex; HET: DNA; 2.80A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>4h10_B Circadian locomoter output cycles protein kaput; BHLH, circadian transcription, transcription-DNA complex; 2.40A {Homo sapiens} Back     alignment and structure
>1a0a_A BHLH, protein (phosphate system positive regulatory protein PHO4); transcription factor, basic helix loop helix; HET: DNA; 2.80A {Saccharomyces cerevisiae} SCOP: a.38.1.1 Back     alignment and structure
>2ql2_B Neurod1, neurogenic differentiation factor 1; basic-helix-loop-helix; HET: DNA; 2.50A {Mus musculus} Back     alignment and structure
>1an4_A Protein (upstream stimulatory factor); protein-DNA complex, double helix, overhanging base, transcription/DNA complex; HET: DNA; 2.90A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>3u5v_A Protein MAX, transcription factor E2-alpha chimer; basic helix-loop-helix (BHLH); 1.70A {Mus musculus} PDB: 2ql2_A* Back     alignment and structure
>4ati_A MITF, microphthalmia-associated transcription factor; DNA-binding protein-DNA complex, melanoma; 2.60A {Mus musculus} PDB: 4atk_A Back     alignment and structure
>1mdy_A Protein (MYOD BHLH domain); protein-DNA complex, transcription/DNA complex; HET: DNA; 2.80A {Mus musculus} SCOP: a.38.1.1 PDB: 1mdy_B* Back     alignment and structure
>4h10_A ARYL hydrocarbon receptor nuclear translocator-LI 1; BHLH, circadian transcription, transcription-DNA complex; 2.40A {Homo sapiens} Back     alignment and structure
>2lfh_A DNA-binding protein inhibitor ID-3; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>4f3l_A Mclock, circadian locomoter output cycles protein kaput; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Back     alignment and structure
>4aya_A DNA-binding protein inhibitor ID-2; cell cycle; 2.10A {Homo sapiens} Back     alignment and structure
>4f3l_B BMAL1B; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Back     alignment and structure
>4ath_A MITF, microphthalmia-associated transcription factor; DNA binding protein, melanoma; HET: MSE; 1.95A {Mus musculus} Back     alignment and structure
>1zpv_A ACT domain protein; structural genomics, PSI, protein structure INIT midwest center for structural genomics, MCSG, unknown funct; 1.90A {Streptococcus pneumoniae} SCOP: d.58.18.7 Back     alignment and structure
>1u8s_A Glycine cleavage system transcriptional repressor, putative; structural genomics, protein structure initiative (PSI), domain swapping; 2.45A {Vibrio cholerae} SCOP: d.58.18.5 d.58.18.5 Back     alignment and structure
>2nyi_A Unknown protein; protein structure initiative, PSI, center for eukaryotic structural genomics, CESG, structural genomics; 1.80A {Galdieria sulphuraria} Back     alignment and structure
>2ko1_A CTR148A, GTP pyrophosphokinase; homodimer, alpha+beta, transferase, structural genomics, PSI-2, protein structure initiative; NMR {Chlorobaculum tepidum} PDB: 3ibw_A Back     alignment and structure
>1u8s_A Glycine cleavage system transcriptional repressor, putative; structural genomics, protein structure initiative (PSI), domain swapping; 2.45A {Vibrio cholerae} SCOP: d.58.18.5 d.58.18.5 Back     alignment and structure
>2nyi_A Unknown protein; protein structure initiative, PSI, center for eukaryotic structural genomics, CESG, structural genomics; 1.80A {Galdieria sulphuraria} Back     alignment and structure
>3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} Back     alignment and structure
>3o1l_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 2.20A {Pseudomonas syringae PV} Back     alignment and structure
>3n0v_A Formyltetrahydrofolate deformylase; formyl transferase, ACT domain, structural genomics, joint C structural genomics, JCSG; HET: MSE; 2.25A {Pseudomonas putida} Back     alignment and structure
>3obi_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 1.95A {Rhodopseudomonas palustris} Back     alignment and structure
>2f1f_A Acetolactate synthase isozyme III small subunit; ferredoxin fold, ACT domain, transferase; HET: P33 1PE; 1.75A {Escherichia coli} SCOP: d.58.18.6 d.58.18.6 Back     alignment and structure
>3lou_A Formyltetrahydrofolate deformylase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative hydrolase; HET: MSE; 1.90A {Burkholderia mallei} Back     alignment and structure
>3nrb_A Formyltetrahydrofolate deformylase; N-terminal ACT domain, structural genomics, joint center for structural genomics, JCSG; HET: MSE FLC; 2.05A {Pseudomonas putida} Back     alignment and structure
>2pc6_A Probable acetolactate synthase isozyme III (small; regulatory subunit, structural genomi protein structure initiative; HET: MSE; 2.50A {Nitrosomonas europaea atcc 19718} SCOP: d.58.18.6 d.58.18.6 Back     alignment and structure
>3he4_B Synzip5; heterodimeric coiled-coil, de novo protein; 2.46A {Artificial gene} Back     alignment and structure
>2fgc_A Acetolactate synthase, small subunit; regulatory subunit, structural genomi protein structure initiative; 2.30A {Thermotoga maritima} SCOP: d.58.18.6 d.58.18.6 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 189
d1nkpa_88 a.38.1.1 (A:) Myc proto-oncogene protein {Human (H 6e-12
d1nlwa_79 a.38.1.1 (A:) Mad protein {Human (Homo sapiens) [T 6e-11
d1nkpb_83 a.38.1.1 (B:) Max protein {Human (Homo sapiens) [T 9e-08
d1am9a_80 a.38.1.1 (A:) SREBP-1a {Human (Homo sapiens) [TaxI 3e-07
d1a0aa_63 a.38.1.1 (A:) Pho4 B/HLH domain {Baker's yeast (Sa 2e-05
d1an4a_65 a.38.1.1 (A:) Usf B/HLH domain {Human (Homo sapien 2e-05
d1mdya_68 a.38.1.1 (A:) Myod B/HLH domain {Mouse (Mus muscul 3e-05
d1uklc_61 a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens) [TaxId 2e-04
>d1nkpa_ a.38.1.1 (A:) Myc proto-oncogene protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure

class: All alpha proteins
fold: HLH-like
superfamily: HLH, helix-loop-helix DNA-binding domain
family: HLH, helix-loop-helix DNA-binding domain
domain: Myc proto-oncogene protein
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 56.8 bits (137), Expect = 6e-12
 Identities = 17/65 (26%), Positives = 29/65 (44%)

Query: 9  RTDRKTIERNRRNQMKALYSTLNSIVPHQRPMEATSLPDQLDEATKYIKRLQTNLERMKE 68
          R     +ER RRN++K  +  L   +P     E       L +AT YI  +Q   +++  
Sbjct: 7  RRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLIS 66

Query: 69 RKERL 73
           ++ L
Sbjct: 67 EEDLL 71
>d1nlwa_ a.38.1.1 (A:) Mad protein {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1nkpb_ a.38.1.1 (B:) Max protein {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1am9a_ a.38.1.1 (A:) SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1a0aa_ a.38.1.1 (A:) Pho4 B/HLH domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 63 Back     information, alignment and structure
>d1an4a_ a.38.1.1 (A:) Usf B/HLH domain {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1mdya_ a.38.1.1 (A:) Myod B/HLH domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 68 Back     information, alignment and structure
>d1uklc_ a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 61 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query189
d1nlwa_79 Mad protein {Human (Homo sapiens) [TaxId: 9606]} 99.68
d1nkpa_88 Myc proto-oncogene protein {Human (Homo sapiens) [ 99.65
d1am9a_80 SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} 99.61
d1nkpb_83 Max protein {Human (Homo sapiens) [TaxId: 9606]} 99.59
d1a0aa_63 Pho4 B/HLH domain {Baker's yeast (Saccharomyces ce 99.57
d1mdya_68 Myod B/HLH domain {Mouse (Mus musculus) [TaxId: 10 99.56
d1an4a_65 Usf B/HLH domain {Human (Homo sapiens) [TaxId: 960 99.46
d1uklc_61 SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} 99.37
d1zpva183 UPF0237 protein SP0238 {Streptococcus pneumoniae [ 96.94
d1u8sa186 putative transcriptional repressor VC2159 {Vibrio 96.56
d1u8sa293 putative transcriptional repressor VC2159 {Vibrio 95.67
d1y7pa277 Hypothetical protein AF1403, N-terminal domain {Ar 94.33
d2qmwa280 Prephenate dehydratase C-terminal domain {Staphylo 90.18
d2f06a270 Hypothetical protein BT0572 {Bacteroides thetaiota 88.7
d1sc6a384 Phosphoglycerate dehydrogenase, regulatory (C-term 87.53
d2f06a171 Hypothetical protein BT0572 {Bacteroides thetaiota 83.0
d2fgca278 Acetolactate synthase small subunit, IlvH {Thermot 82.58
>d1nlwa_ a.38.1.1 (A:) Mad protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: HLH-like
superfamily: HLH, helix-loop-helix DNA-binding domain
family: HLH, helix-loop-helix DNA-binding domain
domain: Mad protein
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.68  E-value=8.2e-17  Score=110.32  Aligned_cols=67  Identities=22%  Similarity=0.339  Sum_probs=60.5

Q ss_pred             chhhhhHHHHHHHHHHHHHHHHHHhcCCCCCCCCCCChhhhHHHHHHHHHHHHHHHHHHHHHHHHHh
Q 029713            8 SRTDRKTIERNRRNQMKALYSTLNSIVPHQRPMEATSLPDQLDEATKYIKRLQTNLERMKERKERLM   74 (189)
Q Consensus         8 ~~~~h~~~ER~RR~~mn~~~~~LrsllP~~~~~~k~s~~~~l~~ai~yI~~Lq~~v~~L~~~~~~~~   74 (189)
                      .|..||..||+||..||+.|..|+++||......|+|.+++|..||+||+.|++.++.|..+++.+.
T Consensus         1 ~R~~Hn~~Er~RR~~in~~f~~L~~llP~~~~~~k~sK~~iL~~A~~yI~~L~~~~~~l~~~~~~L~   67 (79)
T d1nlwa_           1 SRSTHNEMEKNRRAHLRLSLEKLKGLVPLGPDSSRHTTLSLLTKAKLHIKKLEDSDRKAVHQIDQLQ   67 (79)
T ss_dssp             CHHHHHHHHHHHHHHHHHHHHHHHHSSCCCSSSCCCTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             ChHHHHHHHHHHHHHHHHHHHHHHHhCccCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            3789999999999999999999999999887667777777899999999999999999998887664
>d1nkpa_ a.38.1.1 (A:) Myc proto-oncogene protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1am9a_ a.38.1.1 (A:) SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nkpb_ a.38.1.1 (B:) Max protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a0aa_ a.38.1.1 (A:) Pho4 B/HLH domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mdya_ a.38.1.1 (A:) Myod B/HLH domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1an4a_ a.38.1.1 (A:) Usf B/HLH domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uklc_ a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zpva1 d.58.18.7 (A:1-83) UPF0237 protein SP0238 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1u8sa1 d.58.18.5 (A:2-87) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1u8sa2 d.58.18.5 (A:88-180) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1y7pa2 d.58.18.12 (A:2-78) Hypothetical protein AF1403, N-terminal domain {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2qmwa2 d.58.18.3 (A:185-264) Prephenate dehydratase C-terminal domain {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2f06a2 d.58.18.11 (A:1-70) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1sc6a3 d.58.18.1 (A:327-410) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f06a1 d.58.18.11 (A:71-141) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d2fgca2 d.58.18.6 (A:27-104) Acetolactate synthase small subunit, IlvH {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure