Citrus Sinensis ID: 029884

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180------
MLVKQPNKSSYRESLKALEADIQHANTLAAALPRDYGGDFVQMRLSYSPFAPLVLFMIEWMDYSCTDTVPSYLGLLNILVYKVYVDGMPALSSKERKATLREFYAIIYPSLRQLESEFSELEDNSKRDQCSEISSRKRVEERRKLSDKDLDRNDECGICMENCTKMVLPNCGHSLCVNCFHDWYPR
ccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEEcccccHHHHHHHHHHHccccccccccccccEEEEEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHcccccccccHHHHHHHHHHcccccccccccccccccccccEEEcccccHHHHHHHHHHccc
cHHHccccccHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEEcccHHHHHHHHHHHHccccHHHHHHHHcccEEEEEEEEcccccccccHcHHccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccccccccccccccHcHHHHcccEEcccccEEcccccccHHHHHHHHHccc
mlvkqpnksSYRESLKALEADIQHANTLAAalprdyggdfvqmrlsyspfapLVLFMIEWMdysctdtvpsyLGLLNILVYKVYvdgmpalssKERKATLREFYAIIYPSLRQLESEFselednskrdqcseissrKRVEERRKLsdkdldrndecgicmenctkmvlpncghslcvncfhdwypr
mlvkqpnksSYRESLKALEADIQHANTLAAALPRDYGGDFVQMRLSYSPFAPLVLFMIEWMDYSCTDTVPSYLGLLNILVYKVYVDGMPALSSKERKATLREFYAIIYPSLRQLESEFselednskrdqcseissrkrveerrklsdkdldrndecGICMENCTKMVLPNCGHSLCVNCFHDWYPR
MLVKQPNKSSYRESLKALEADIQHANTLAAALPRDYGGDFVQMRLSYSPFAPLVLFMIEWMDYSCTDTVPSYLGLLNILVYKVYVDGMPALSSKERKATLREFYAIIYPSLRQLESEFSELEDNSKRDQCSEISSRKRVEERRKLSDKDLDRNDECGICMENCTKMVLPNCGHSLCVNCFHDWYPR
********************DIQHANTLAAALPRDYGGDFVQMRLSYSPFAPLVLFMIEWMDYSCTDTVPSYLGLLNILVYKVYVDGMPALSSKERKATLREFYAIIYPSLR******************************************ECGICMENCTKMVLPNCGHSLCVNCFHDWY**
**************LKALEADIQHANTLAAALPRDYGGDFVQMRLSYSPFAPLVLFMIEWMDYSCTDTVPSYLGLLNILVYKVYVDGMPALSSKERKATLREFYAIIYPSLRQLESEF*********************************RNDECGICMENCTKMVLPNCGHSLCVNCFHDWYP*
*************SLKALEADIQHANTLAAALPRDYGGDFVQMRLSYSPFAPLVLFMIEWMDYSCTDTVPSYLGLLNILVYKVYVDGMPALSSKERKATLREFYAIIYPSLRQLESE********************************LDRNDECGICMENCTKMVLPNCGHSLCVNCFHDWYPR
*****PNKSSYRESLKALEADIQHANTLAAALPRDYGGDFVQMRLSYSPFAPLVLFMIEWMDYSCTDTVPSYLGLLNILVYKVYVDGMPALSSKERKATLREFYAIIYPSLRQLESEFSELEDNSKRDQCSEISSRK*****RKLSDKDLDRNDECGICMENCTKMVLPNCGHSLCVNCFHDWYPR
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLVKQPNxxxxxxxxxxxxxxxxxxxxxAAALPRDYGGDFVQMRLSYSPFAPLVLFMIEWMDYSCTDTVPSYLGLLNILVYKVYVDGMPALSSKERKATLREFYAIIYPSxxxxxxxxxxxxxxxxxxxxxEISSRKRVEERRKLSDKDLDRNDECGICMENCTKMVLPNCGHSLCVNCFHDWYPR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query186
255547924253 protein binding protein, putative [Ricin 1.0 0.735 0.771 8e-81
359473694255 PREDICTED: uncharacterized protein LOC10 0.983 0.717 0.752 1e-80
297738323247 unnamed protein product [Vitis vinifera] 0.956 0.720 0.767 1e-79
224110810250 predicted protein [Populus trichocarpa] 0.994 0.74 0.747 4e-78
356567396243 PREDICTED: uncharacterized protein LOC10 0.956 0.732 0.639 4e-67
449435031243 PREDICTED: uncharacterized protein LOC10 0.956 0.732 0.623 2e-63
449512974243 PREDICTED: uncharacterized protein LOC10 0.956 0.732 0.612 5e-63
115471529253 Os07g0275300 [Oryza sativa Japonica Grou 0.935 0.687 0.588 6e-55
226505928253 RNA-binding protein [Zea mays] gi|195652 0.935 0.687 0.577 9e-55
218199426184 hypothetical protein OsI_25623 [Oryza sa 0.919 0.929 0.587 2e-54
>gi|255547924|ref|XP_002515019.1| protein binding protein, putative [Ricinus communis] gi|223546070|gb|EEF47573.1| protein binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  305 bits (780), Expect = 8e-81,   Method: Compositional matrix adjust.
 Identities = 145/188 (77%), Positives = 162/188 (86%), Gaps = 2/188 (1%)

Query: 1   MLVKQPNK--SSYRESLKALEADIQHANTLAAALPRDYGGDFVQMRLSYSPFAPLVLFMI 58
           M  KQPN   SS+RESLKALEADIQHANTLAAA+P DYGGD VQMRLSYSP AP +LF++
Sbjct: 1   MWQKQPNNKSSSFRESLKALEADIQHANTLAAAIPGDYGGDRVQMRLSYSPLAPFILFLV 60

Query: 59  EWMDYSCTDTVPSYLGLLNILVYKVYVDGMPALSSKERKATLREFYAIIYPSLRQLESEF 118
           EWMDYSCTD +PSYLGLL+ILVYKVYVDGMP LSSKERKATLREFYA IYPSLR LE EF
Sbjct: 61  EWMDYSCTDALPSYLGLLHILVYKVYVDGMPTLSSKERKATLREFYATIYPSLRLLEGEF 120

Query: 119 SELEDNSKRDQCSEISSRKRVEERRKLSDKDLDRNDECGICMENCTKMVLPNCGHSLCVN 178
            ELEDN +R Q +E  SRKRVE++RK SD D++R+DECGICME+  KMVLPNCGHSLC++
Sbjct: 121 IELEDNPRRSQWTEAFSRKRVEDKRKRSDYDIERDDECGICMEDSAKMVLPNCGHSLCIS 180

Query: 179 CFHDWYPR 186
           CFHDW  R
Sbjct: 181 CFHDWNTR 188

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359473694|ref|XP_002272517.2| PREDICTED: uncharacterized protein LOC100245965 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297738323|emb|CBI27524.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224110810|ref|XP_002315643.1| predicted protein [Populus trichocarpa] gi|222864683|gb|EEF01814.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356567396|ref|XP_003551906.1| PREDICTED: uncharacterized protein LOC100805014 [Glycine max] Back     alignment and taxonomy information
>gi|449435031|ref|XP_004135299.1| PREDICTED: uncharacterized protein LOC101207887 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449512974|ref|XP_004164193.1| PREDICTED: uncharacterized protein LOC101223953 [Cucumis sativus] Back     alignment and taxonomy information
>gi|115471529|ref|NP_001059363.1| Os07g0275300 [Oryza sativa Japonica Group] gi|113610899|dbj|BAF21277.1| Os07g0275300 [Oryza sativa Japonica Group] gi|222636824|gb|EEE66956.1| hypothetical protein OsJ_23829 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|226505928|ref|NP_001152052.1| RNA-binding protein [Zea mays] gi|195652155|gb|ACG45545.1| RNA-binding protein [Zea mays] gi|238014126|gb|ACR38098.1| unknown [Zea mays] gi|414884234|tpg|DAA60248.1| TPA: putative RING zinc finger domain superfamily protein [Zea mays] Back     alignment and taxonomy information
>gi|218199426|gb|EEC81853.1| hypothetical protein OsI_25623 [Oryza sativa Indica Group] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query186
TAIR|locus:2149750242 AIRP2 "ABA Insensitive RING Pr 0.940 0.723 0.480 3.1e-44
TAIR|locus:505006703242 AT5G58787 "AT5G58787" [Arabido 0.924 0.710 0.486 3.5e-43
TAIR|locus:505006120260 AT1G13195 [Arabidopsis thalian 0.951 0.680 0.483 9.3e-43
TAIR|locus:2024026251 AT1G24440 [Arabidopsis thalian 0.951 0.705 0.480 6.6e-42
TAIR|locus:2149750 AIRP2 "ABA Insensitive RING Protein 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 466 (169.1 bits), Expect = 3.1e-44, P = 3.1e-44
 Identities = 86/179 (48%), Positives = 124/179 (69%)

Query:     8 KSSYRESLKALEADIQHANTLAAALPRDYGGDFVQMRLSYSPFAPLVLFMIEWMDYSCTD 67
             + S+++SLKALEADIQ ANTLA+  P +Y G +VQMRLSYSP A L LF+++W D  C  
Sbjct:     2 RKSFKDSLKALEADIQFANTLASEYPEEYDGGYVQMRLSYSPAAHLFLFLLQWTD--CH- 58

Query:    68 TVPSYLGLLNILVYKVYVDGMPALSSKERKATLREFYAIIYPSLRQLESEFSELEDNSKR 127
                  LGLL IL+YK YVDG   +S  ERK ++REFY +++PSL QL    +++E+  ++
Sbjct:    59 -FAGALGLLRILIYKAYVDGKTTMSLHERKTSIREFYDVLFPSLLQLHGGITDVEERKQK 117

Query:   128 DQCSEISSRKRVEERRKLSDKDLDRNDECGICMENCTKMVLPNCGHSLCVNCFHDWYPR 186
             + C +   +K   ++ K+S+ DL+R +ECGIC+E   K+VLP C HS+C+NC+ +W  R
Sbjct:   118 EICDKRYRKKDRTDKGKMSEIDLEREEECGICLEIRNKVVLPTCNHSMCINCYRNWRAR 176
GO:0005634 "nucleus" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA;ISS
GO:0005829 "cytosol" evidence=IDA
GO:0015996 "chlorophyll catabolic process" evidence=RCA
TAIR|locus:505006703 AT5G58787 "AT5G58787" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:505006120 AT1G13195 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2024026 AT1G24440 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query186
cd0016245 cd00162, RING, RING-finger (Really Interesting New 2e-05
pfam1392345 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI 5e-04
smart0018440 smart00184, RING, Ring finger 0.001
pfam1363946 pfam13639, zf-RING_2, Ring finger domain 0.004
PHA02929238 PHA02929, PHA02929, N1R/p28-like protein; Provisio 0.004
>gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information 
 Score = 39.7 bits (93), Expect = 2e-05
 Identities = 13/30 (43%), Positives = 17/30 (56%), Gaps = 1/30 (3%)

Query: 155 ECGICMENCTK-MVLPNCGHSLCVNCFHDW 183
           EC IC+E   + +VL  CGH  C +C   W
Sbjct: 1   ECPICLEEFREPVVLLPCGHVFCRSCIDKW 30

Length = 45
>gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|214546 smart00184, RING, Ring finger Back     alignment and domain information
>gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain Back     alignment and domain information
>gnl|CDD|222944 PHA02929, PHA02929, N1R/p28-like protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 186
KOG1039 344 consensus Predicted E3 ubiquitin ligase [Posttrans 99.66
KOG0823 230 consensus Predicted E3 ubiquitin ligase [Posttrans 99.06
KOG1002 791 consensus Nucleotide excision repair protein RAD16 99.05
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 98.98
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 98.76
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 98.64
PHA02926242 zinc finger-like protein; Provisional 98.62
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 98.5
PHA02929238 N1R/p28-like protein; Provisional 98.43
smart0050463 Ubox Modified RING finger domain. Modified RING fi 98.41
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 98.38
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 98.35
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 98.34
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 98.28
KOG2164 513 consensus Predicted E3 ubiquitin ligase [Posttrans 98.27
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 98.25
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 98.2
cd0016245 RING RING-finger (Really Interesting New Gene) dom 98.17
PF1463444 zf-RING_5: zinc-RING finger domain 98.1
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 97.92
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 97.53
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 97.49
KOG1001 674 consensus Helicase-like transcription factor HLTF/ 97.36
COG5152259 Uncharacterized conserved protein, contains RING a 97.35
KOG4159 398 consensus Predicted E3 ubiquitin ligase [Posttrans 97.08
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 96.65
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 96.62
KOG0802 543 consensus E3 ubiquitin ligase [Posttranslational m 96.52
PHA03096284 p28-like protein; Provisional 96.51
COG5243 491 HRD1 HRD ubiquitin ligase complex, ER membrane com 96.1
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 96.1
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 96.02
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 95.69
KOG1814 445 consensus Predicted E3 ubiquitin ligase [Posttrans 95.51
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 95.42
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 95.02
KOG0311 381 consensus Predicted E3 ubiquitin ligase [Posttrans 94.92
KOG1785 563 consensus Tyrosine kinase negative regulator CBL [ 94.48
KOG4692489 consensus Predicted E3 ubiquitin ligase [Posttrans 94.35
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 94.22
KOG1812 384 consensus Predicted E3 ubiquitin ligase [Posttrans 93.82
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 93.63
KOG1815 444 consensus Predicted E3 ubiquitin ligase [Posttrans 92.88
PF05883134 Baculo_RING: Baculovirus U-box/Ring-like domain; I 92.14
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 88.87
smart0064764 IBR In Between Ring fingers. the domains occurs be 87.89
KOG3039303 consensus Uncharacterized conserved protein [Funct 86.67
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 86.58
KOG2034911 consensus Vacuolar sorting protein PEP3/VPS18 [Int 85.65
KOG0804 493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 85.18
KOG3039 303 consensus Uncharacterized conserved protein [Funct 83.66
KOG4275350 consensus Predicted E3 ubiquitin ligase [Posttrans 82.19
COG5222 427 Uncharacterized conserved protein, contains RING Z 81.63
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 81.57
KOG0826357 consensus Predicted E3 ubiquitin ligase involved i 80.8
PF0148564 IBR: IBR domain; InterPro: IPR002867 Zinc finger ( 80.55
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=99.66  E-value=1.3e-17  Score=150.28  Aligned_cols=160  Identities=23%  Similarity=0.344  Sum_probs=120.8

Q ss_pred             HHhhHHHHHhhhhCCCCCCCceEEEeeccCCc-hhHHHHHHHHhhcCCCCCccccccceeEEEEEEe-eCCCccccchhh
Q 029884           19 EADIQHANTLAAALPRDYGGDFVQMRLSYSPF-APLVLFMIEWMDYSCTDTVPSYLGLLNILVYKVY-VDGMPALSSKER   96 (186)
Q Consensus        19 eadiq~an~la~~~pr~~~g~~~qm~l~y~~~-a~~~lfl~qw~d~~~~~~l~~~lgl~~iliykvy-~DGk~~~s~~~R   96 (186)
                      +.+++++ |++..+||++.+.--+||+++++. .++..++++|+|+.    .|+ .|+.++++|..+ .|+..+++.++|
T Consensus         2 d~~~~~~-tic~~~~~g~c~~g~~cr~~h~~~~~~~~~~~~~~~s~~----~~~-~~~~~~~~~~~~~~~~s~~~s~~~~   75 (344)
T KOG1039|consen    2 DLSLSQE-TICKYYQKGNCKFGDLCRLSHSLPDEEFATLLTPTTSSA----AAS-TGLSQSLIWANAVADASATMSVSSR   75 (344)
T ss_pred             ccccccc-hhhhhcccccccccceeeeeccCchhhcccccccccccc----ccc-cccchhhcccchhhccccccchhcc
Confidence            4678889 999999999999999999999999 99999999999998    776 899999999999 899999999988


Q ss_pred             --hhHHHHHhhhhcch---------HHHHhhhhhhhhhc----------cccccchhhhhhhhHHHhhhCCccCC-----
Q 029884           97 --KATLREFYAIIYPS---------LRQLESEFSELEDN----------SKRDQCSEISSRKRVEERRKLSDKDL-----  150 (186)
Q Consensus        97 --kati~efYa~I~ps---------LqqL~~~v~dle~~----------~q~~~~l~~~~kk~~e~~~~l~~~d~-----  150 (186)
                        +..+++++++.+|+         +-+.+.+..++...          .+...+...++.+.........+.+.     
T Consensus        76 ~~~~~~~~s~~~~~~s~~~~~~~~~~~~~~~g~~~~~~~~~~~~~c~l~~~~pi~~~~~~~~~~~~~~~~~~~~~e~~~a  155 (344)
T KOG1039|consen   76 PVLTAIRASSSISEPSSTQENPYSNHGQCRFGNGDVTLNGNNPESCGLGTQHPICKRQYKNSMKRGSSCALSSAMERSFA  155 (344)
T ss_pred             cchhhhhhhhccccccccccCccccccccccCCcccccccccccccccccccchhHHHHhhhhcccccccchHhhhhccC
Confidence              78899999999998         44444444333222          12222222222211111112223333     


Q ss_pred             ---CCcccccccccccCCCc--------ccCCCCcccHHHHhccc
Q 029884          151 ---DRNDECGICMENCTKMV--------LPNCGHSLCVNCFHDWY  184 (186)
Q Consensus       151 ---~~e~eC~IClE~~~~~V--------l~~CGH~FC~~Cl~~W~  184 (186)
                         ..+.+||||||.....+        +|||.|.||.+||..|+
T Consensus       156 ~~~s~~k~CGICme~i~ek~~~~~rfgilpnC~H~~Cl~Cir~wr  200 (344)
T KOG1039|consen  156 LQKSSEKECGICMETINEKAASERRFGILPNCNHSFCLNCIRKWR  200 (344)
T ss_pred             cCccccccceehhhhccccchhhhhcccCCCcchhhhhcHhHhhh
Confidence               34889999999866554        59999999999999998

>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA03096 p28-like protein; Provisional Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1812 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>KOG1815 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>smart00647 IBR In Between Ring fingers Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2034 consensus Vacuolar sorting protein PEP3/VPS18 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF01485 IBR: IBR domain; InterPro: IPR002867 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query186
4epo_C149 E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 1e-14
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 4e-10
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 3e-09
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 2e-05
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 1e-04
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 1e-04
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 3e-04
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 3e-04
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 3e-04
2ecm_A55 Ring finger and CHY zinc finger domain- containing 6e-04
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 7e-04
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 7e-04
2ea5_A68 Cell growth regulator with ring finger domain prot 8e-04
>4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 Back     alignment and structure
 Score = 67.0 bits (163), Expect = 1e-14
 Identities = 26/102 (25%), Positives = 39/102 (38%), Gaps = 16/102 (15%)

Query: 87  GMPALSS-----KERKATLREFYAIIYPSLRQLESEFSELEDNSKRDQCSEISSRKRVEE 141
           G P         +E   + ++F AII    ++LE    E E    +            EE
Sbjct: 4   GSPGFQEHWALMEELNRSKKDFEAIIQAKNKELEQTKEEKEKMQAQK-----------EE 52

Query: 142 RRKLSDKDLDRNDECGICMENCTKMVLPNCGHSLCVNCFHDW 183
                +  L+   +C IC E   + V  NC HS C  C ++W
Sbjct: 53  VLSHMNDVLENELQCIICSEYFIEAVTLNCAHSFCSYCINEW 94
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Length = 55 Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query186
2ysj_A63 Tripartite motif-containing protein 31; ring-type 99.03
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 99.02
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 98.98
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 98.97
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 98.92
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 98.92
2ysl_A73 Tripartite motif-containing protein 31; ring-type 98.92
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 98.9
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 98.89
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 98.89
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 98.88
2ecw_A85 Tripartite motif-containing protein 30; metal bind 98.87
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 98.85
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 98.83
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 98.82
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 98.81
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 98.79
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 98.78
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 98.78
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 98.77
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 98.76
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 98.76
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 98.75
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 98.75
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 98.74
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 98.74
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 98.73
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 98.72
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 98.72
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 98.71
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 98.7
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 98.7
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 98.7
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.69
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 98.68
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 98.67
2ecm_A55 Ring finger and CHY zinc finger domain- containing 98.63
1z6u_A150 NP95-like ring finger protein isoform B; structura 98.63
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 98.61
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 98.61
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 98.61
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 98.6
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 98.59
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 98.59
2ect_A78 Ring finger protein 126; metal binding protein, st 98.58
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 98.55
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 98.55
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 98.47
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 98.45
2f42_A179 STIP1 homology and U-box containing protein 1; cha 98.43
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 98.42
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 98.4
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 98.31
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 98.23
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.2
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 98.19
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 98.17
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 98.13
2ea5_A68 Cell growth regulator with ring finger domain prot 98.12
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 97.99
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 97.97
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 97.9
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 97.87
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 97.68
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 97.34
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 97.05
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 97.04
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 96.13
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 95.99
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 94.84
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 94.07
2jmo_A80 Parkin; IBR, E3 ligase, zinc binding domain, RBR; 88.62
1wd2_A60 Ariadne-1 protein homolog; ring, IBR, triad, zinc 86.16
1joc_A125 EEA1, early endosomal autoantigen 1; FYVE domain, 84.17
3nw0_A238 Non-structural maintenance of chromosomes element 81.14
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
Probab=99.03  E-value=7.9e-11  Score=78.72  Aligned_cols=36  Identities=31%  Similarity=0.719  Sum_probs=32.7

Q ss_pred             CCCcccccccccccCCCcccCCCCcccHHHHhcccC
Q 029884          150 LDRNDECGICMENCTKMVLPNCGHSLCVNCFHDWYP  185 (186)
Q Consensus       150 ~~~e~eC~IClE~~~~~Vl~~CGH~FC~~Cl~~W~~  185 (186)
                      .+++.+|+||++...+|+.++|||.||..||.+|..
T Consensus        17 ~~~~~~C~IC~~~~~~p~~~~CgH~fC~~Ci~~~~~   52 (63)
T 2ysj_A           17 LQEEVICPICLDILQKPVTIDCGHNFCLKCITQIGE   52 (63)
T ss_dssp             CCCCCBCTTTCSBCSSCEECTTSSEECHHHHHHHHH
T ss_pred             CccCCCCCcCCchhCCeEEeCCCCcchHHHHHHHHH
Confidence            457789999999999999999999999999999963
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>2jmo_A Parkin; IBR, E3 ligase, zinc binding domain, RBR; NMR {Homo sapiens} Back     alignment and structure
>1wd2_A Ariadne-1 protein homolog; ring, IBR, triad, zinc finger, ligase; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1joc_A EEA1, early endosomal autoantigen 1; FYVE domain, inositol 3-phosphate binding, membrane protein; HET: ITP; 2.20A {Homo sapiens} SCOP: g.50.1.1 h.1.21.1 PDB: 1hyi_A* 1hyj_A Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 186
d1fbva479 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta 4e-06
d1rmda286 g.44.1.1 (A:1-86) V(D)J recombination activating p 1e-05
d1iyma_55 g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati 4e-05
d1jm7a_103 g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie 5e-05
d1chca_68 g.44.1.1 (A:) Immediate early protein, IEEHV {Equi 9e-05
d1bora_56 g.44.1.1 (A:) Acute promyelocytic leukaemia proto- 2e-04
d1jm7b_97 g.44.1.1 (B:) bard1 RING domain {Human (Homo sapie 2e-04
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: CBL
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 41.1 bits (96), Expect = 4e-06
 Identities = 14/47 (29%), Positives = 22/47 (46%)

Query: 137 KRVEERRKLSDKDLDRNDECGICMENCTKMVLPNCGHSLCVNCFHDW 183
           K  +E+ +L  +       C IC EN   + +  CGH +C +C   W
Sbjct: 7   KVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTSW 53
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query186
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 98.96
d2c2la280 STIP1 homology and U box-containing protein 1, STU 98.9
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 98.88
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 98.86
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 98.8
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 98.74
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 98.7
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 98.69
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 98.64
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 98.63
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 98.6
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 98.49
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 98.43
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 98.4
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 98.29
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 98.01
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 97.71
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: U-box
domain: E3 ubiquitin ligase PUB14
species: Thale-cress (Arabidopsis thaliana) [TaxId: 3702]

Probab=98.96  E-value=6.3e-11  Score=81.96  Aligned_cols=36  Identities=17%  Similarity=0.346  Sum_probs=33.2

Q ss_pred             CCCcccccccccccCCCcccCCCCcccHHHHhcccC
Q 029884          150 LDRNDECGICMENCTKMVLPNCGHSLCVNCFHDWYP  185 (186)
Q Consensus       150 ~~~e~eC~IClE~~~~~Vl~~CGH~FC~~Cl~~W~~  185 (186)
                      ..+++.|+||++++.+||++.|||+||..||.+|..
T Consensus         5 iP~~l~CpIc~~~m~dPV~~~cgh~fc~~ci~~~~~   40 (78)
T d1t1ha_           5 FPEYFRCPISLELMKDPVIVSTGQTYERSSIQKWLD   40 (78)
T ss_dssp             CSSSSSCTTTSCCCSSEEEETTTEEEEHHHHHHHHT
T ss_pred             CCccCCCcCcCchhhCceEccCCCcchHHHHHHHHH
Confidence            457899999999999999999999999999999964
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure