Citrus Sinensis ID: 029969

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180----

MSPFSCGWSTSGGNLPVADLSVVAKTIKSGFVPVLHGDAVLDDVQGCAILSGDVIIRHLAAYMKPDYVVFLTDVLGVYSHPPTEPNAVLLREIAVGEDGSWSITKPTLQHMNNQVEITVAAHDTTGGMVTKISEAAMIAKLGIDVYIVKAASSHSVKALSGELREKIPDDWLGTVIHFSREEVQ

ccccccEEEEcccccccccHHHHHHHHHcccEEEEcccEEEEcccccEEccccHHHHHHHHHccccEEEEEcccccccccccccccccEEEEEEEcccccccccccccccccccEEEccccccccccHHHHHHHHHHHHHccccEEEEEcccccHHHHHcccccccccccccccEEEccccccc

ccccccEEEEccccEEcccHHHHHHHHHcccEEEEEccEEEEccccEEEEccHHHHHHHHHHccccEEEEEEcccccccccccccccEEEEEEEcccccccccccHHHHHHHHHccccccccccccHHHHHHHHHHHHHHccccEEEEEcccHHHHHHHccccHHHcccccEEEEEEccccccc

mspfscgwstsggnlpvadLSVVAKTIksgfvpvlhgdavlddvqgcaILSGDVIIRHLAAYMKPDYVVFLTDVlgvyshpptepnAVLLREIAvgedgswsitkptlqhmNNQVEITVAAHDTTGGMVTKISEAAMIAKLGIDVYIVKAASSHSVKALSGElrekipddwlgtVIHFSREEVQ

mspfscgwstsggnlpVADLSVVAKTIKSGFVPVLHGDAVLDDVQGCAILSGDVIIRHLAAYMKPDYVVFLTDVLGVYSHPPTEPNAVLLREIAVGEDGSWSITKPTLQHMNNQVEITVAAHDTTGGMVTKISEAAMIAKLGIDVYIVKAASSHSVKAlsgelrekipddwlgtVIHFSREEVQ

MSPFSCGWSTSGGNLPVADLSVVAKTIKSGFVPVLHGDAVLDDVQGCAILSGDVIIRHLAAYMKPDYVVFLTDVLGVYSHPPTEPNAVLLREIAVGEDGSWSITKPTLQHMNNQVEITVAAHDTTGGMVTKISEAAMIAKLGIDVYIVKAASSHSVKALSGELREKIPDDWLGTVIHFSREEVQ

*****CGWSTSGGNLPVADLSVVAKTIKSGFVPVLHGDAVLDDVQGCAILSGDVIIRHLAAYMKPDYVVFLTDVLGVYSHPPTEPNAVLLREIAVGEDGSWSITKPTLQHMNNQVEITVAAHDTTGGMVTKISEAAMIAKLGIDVYIVKAASSHSVKALSGELREKIPDDWLGTVIHF******

*SPFSCGWSTSGGNLPVADLSVVAKTIKSGFVPVLHGDAVLDDVQGCAILSGDVIIRHLAAYMKPDYVVFLTDVLGVYSHPPTEPNAVLLREIAVGEDGSWSITK*****************DTTGGMVTKISEAAMIAKLGIDVYIVKAASSHSVKALSGELREKIPDDWLGTVI********

**********SGGNLPVADLSVVAKTIKSGFVPVLHGDAVLDDVQGCAILSGDVIIRHLAAYMKPDYVVFLTDVLGVYSHPPTEPNAVLLREIAVGEDGSWSITKPTLQHMNNQVEITVAAHDTTGGMVTKISEAAMIAKLGIDVYIVKAASSHSVKALSGELREKIPDDWLGTVIHFSREEVQ

*SPFSCGWSTSGGNLPVADLSVVAKTIKSGFVPVLHGDAVLDDVQGCAILSGDVIIRHLAAYMKPDYVVFLTDVLGVYSHPPTEPNAVLLREIAVGEDGSWSITKPTLQHMNNQVEITVAAHDTTGGMVTKISEAAMIAKLGIDVYIVKAASSHSVKALSGELREKIPDDWLGTVIHFSR****

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MSPFSCGWSTSGGNLPVADLSVVAKTIKSGFVPVLHGDAVLDDVQGCAILSGDVIIRHLAAYMKPDYVVFLTDVLGVYSHPPTEPNAVLLREIAVGEDGSWSITKPTLQHMNNQVEITVAAHDTTGGMVTKISEAAMIAKLGIDVYIVKAASSHSVKALSGELREKIPDDWLGTVIHFSREEVQ

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		184	2.2.26 [Sep-21-2011]
Q60352		260	Uncharacterized protein M	yes	no	0.744	0.526	0.317	1e-09
A1KTV5		369	Glutamate 5-kinase OS=Nei	yes	no	0.625	0.311	0.282	1e-05
Q9JZG2		369	Glutamate 5-kinase OS=Nei	yes	no	0.625	0.311	0.282	1e-05
Q97R95		369	Glutamate 5-kinase OS=Str	yes	no	0.625	0.311	0.270	1e-05
C1CDS8		369	Glutamate 5-kinase OS=Str	yes	no	0.625	0.311	0.270	1e-05
C1CRW2		369	Glutamate 5-kinase OS=Str	yes	no	0.625	0.311	0.270	1e-05
C1CK17		369	Glutamate 5-kinase OS=Str	yes	no	0.625	0.311	0.270	1e-05
C1C6R3		369	Glutamate 5-kinase OS=Str	yes	no	0.625	0.311	0.270	1e-05
Q8DQ61		369	Glutamate 5-kinase OS=Str	yes	no	0.625	0.311	0.270	1e-05
Q04KZ3		369	Glutamate 5-kinase OS=Str	yes	no	0.625	0.311	0.270	1e-05

>sp\|Q60352\|Y044_METJA Uncharacterized protein MJ0044 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0044 PE=1 SV=1	Back alignment and function desciption

 Score = 62.8 bits (151), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 54/170 (31%), Positives = 79/170 (46%), Gaps = 33/170 (19%)

Query: 13  GNLPVADLSVVAKTIKSGFVPVLHGDAVLDDVQGCAILSGDVIIRHLAAYMKPDYVVFLT 72
           G+  + D S + + +K   VPV+HGD V+DD  G  I+SGD I+ +LA  +K D +++ T
Sbjct: 120 GDKLIFDTSAIKEMLKRNLVPVIHGDIVIDDKNGYRIISGDDIVPYLANELKADLILYAT 179

Query: 73  DVLGVY--SHPPTEPNAVLLREIAVGEDGSWSITKPTLQHMNNQVEITVAAHDTTGGMVT 130
           DV GV   + P    +   + +I     GS SI                   D TGGM  
Sbjct: 180 DVDGVLIDNKPIKRIDKNNIYKILNYLSGSNSI-------------------DVTGGMKY 220

Query: 131 KISEAAMIAKLGIDVYIVKAASSHSV-KALSGELREKIPDDWLGTVIHFS 179
           KI    MI K     ++     ++++ KAL GE+         GT I FS
Sbjct: 221 KID---MIRKNKCRGFVFNGNKANNIYKALLGEVE--------GTEIDFS 259

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (taxid: 243232)

>sp\|A1KTV5\|PROB_NEIMF Glutamate 5-kinase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / FAM18) GN=proB PE=3 SV=1	Back alignment and function description

>sp\|Q9JZG2\|PROB_NEIMB Glutamate 5-kinase OS=Neisseria meningitidis serogroup B (strain MC58) GN=proB PE=3 SV=1	Back alignment and function description

>sp\|Q97R95\|PROB_STRPN Glutamate 5-kinase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=proB PE=3 SV=1	Back alignment and function description

>sp\|C1CDS8\|PROB_STRZJ Glutamate 5-kinase OS=Streptococcus pneumoniae (strain JJA) GN=proB PE=3 SV=1	Back alignment and function description

>sp\|C1CRW2\|PROB_STRZT Glutamate 5-kinase OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=proB PE=3 SV=1	Back alignment and function description

>sp\|C1CK17\|PROB_STRZP Glutamate 5-kinase OS=Streptococcus pneumoniae (strain P1031) GN=proB PE=3 SV=1	Back alignment and function description

>sp\|C1C6R3\|PROB_STRP7 Glutamate 5-kinase OS=Streptococcus pneumoniae (strain 70585) GN=proB PE=3 SV=1	Back alignment and function description

>sp\|Q8DQ61\|PROB_STRR6 Glutamate 5-kinase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=proB PE=3 SV=2	Back alignment and function description

>sp\|Q04KZ3\|PROB_STRP2 Glutamate 5-kinase OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=proB PE=3 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		184
255542138		337	conserved hypothetical protein [Ricinus	0.967	0.528	0.831	2e-81
118486766		335	unknown [Populus trichocarpa]	0.967	0.531	0.786	1e-78
297845538		330	aspartate/glutamate/uridylate kinase fam	0.978	0.545	0.733	5e-75
449452142		371	PREDICTED: uncharacterized protein MJ004	0.972	0.482	0.754	2e-74
225424940		340	PREDICTED: uncharacterized protein MJ004	0.978	0.529	0.762	2e-74
27368645		227	hypothetical protein [Cicer arietinum]	0.961	0.779	0.755	9e-73
9295741		339	T24P13.2 [Arabidopsis thaliana]	0.978	0.530	0.714	1e-72
22329798		332	amino acid kinase-like protein [Arabidop	0.978	0.542	0.714	2e-72
17528974		332	unknown protein [Arabidopsis thaliana]	0.978	0.542	0.708	3e-72
363807624		335	uncharacterized protein LOC100792453 [Gl	0.961	0.528	0.744	6e-72

>gi\|255542138\|ref\|XP_002512133.1\| conserved hypothetical protein [Ricinus communis] gi\|223549313\|gb\|EEF50802.1\| conserved hypothetical protein [Ricinus communis]	Back alignment and taxonomy information

 Score =  306 bits (784), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 148/178 (83%), Positives = 158/178 (88%)

Query: 1   MSPFSCGWSTSGGNLPVADLSVVAKTIKSGFVPVLHGDAVLDDVQGCAILSGDVIIRHLA 60
           MSPFSCGWSTS  N+  ADLS+VAK I SGFVPVLHGDAVLD+ QGC ILSGDVIIRHLA
Sbjct: 151 MSPFSCGWSTSQRNMESADLSMVAKAIGSGFVPVLHGDAVLDEFQGCTILSGDVIIRHLA 210

Query: 61  AYMKPDYVVFLTDVLGVYSHPPTEPNAVLLREIAVGEDGSWSITKPTLQHMNNQVEITVA 120
           AY+KP+ VVFLTDVLGVY  PP+EP AVLLREIAV EDGSWS+  PT Q+MNNQVEITVA
Sbjct: 211 AYLKPESVVFLTDVLGVYDRPPSEPGAVLLREIAVNEDGSWSVVNPTRQNMNNQVEITVA 270

Query: 121 AHDTTGGMVTKISEAAMIAKLGIDVYIVKAASSHSVKALSGELREKIPDDWLGTVIHF 178
           AHDTTGGM TKISEAAMIAKLGIDVYIVKAA+SHS+KALSGELR  IPDDWLGTVI F
Sbjct: 271 AHDTTGGMETKISEAAMIAKLGIDVYIVKAATSHSLKALSGELRGTIPDDWLGTVIRF 328

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|118486766\|gb\|ABK95218.1\| unknown [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|297845538\|ref\|XP_002890650.1\| aspartate/glutamate/uridylate kinase family protein [Arabidopsis lyrata subsp. lyrata] gi\|297336492\|gb\|EFH66909.1\| aspartate/glutamate/uridylate kinase family protein [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi\|449452142\|ref\|XP_004143819.1\| PREDICTED: uncharacterized protein MJ0044-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|225424940\|ref\|XP_002263763.1\| PREDICTED: uncharacterized protein MJ0044 [Vitis vinifera] gi\|296088284\|emb\|CBI36510.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|27368645\|emb\|CAD59684.1\| hypothetical protein [Cicer arietinum]	Back alignment and taxonomy information

>gi\|9295741\|gb\|AAF87047.1\|AC006535_25 T24P13.2 [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|22329798\|ref\|NP_173986.2\| amino acid kinase-like protein [Arabidopsis thaliana] gi\|23297385\|gb\|AAN12957.1\| unknown protein [Arabidopsis thaliana] gi\|332192592\|gb\|AEE30713.1\| amino acid kinase-like protein [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|17528974\|gb\|AAL38697.1\| unknown protein [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|363807624\|ref\|NP_001242413.1\| uncharacterized protein LOC100792453 [Glycine max] gi\|255636162\|gb\|ACU18423.1\| unknown [Glycine max]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		184
TAIR\|locus:2200580		332	AT1G26640 "AT1G26640" [Arabido	0.978	0.542	0.714	1.3e-68
DICTYBASE\|DDB_G0288029		296	DDB_G0288029 "amino acid kinas	0.739	0.459	0.378	5.8e-18

TAIR\|locus:2200580 AT1G26640 "AT1G26640" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 696 (250.1 bits), Expect = 1.3e-68, P = 1.3e-68
 Identities = 130/182 (71%), Positives = 158/182 (86%)

Query:     1 MSPFSCGWSTSGGNLPVADLSVVAKTIKSGFVPVLHGDAVLDDVQGCAILSGDVIIRHLA 60
             MSPFSCGWSTS  ++  ADL+ VAKTI SGFVPVLHGDAVLD++ GC ILSGDVIIRHLA
Sbjct:   151 MSPFSCGWSTSKRDVASADLATVAKTIDSGFVPVLHGDAVLDNILGCTILSGDVIIRHLA 210

Query:    61 AYMKPDYVVFLTDVLGVYSHPPT--EPNAVLLREIAVGEDGSWSITKPTLQHMNNQVEIT 118
              ++KP+YVVFLTDVLGVY  PP+  EP+AVLL+EIAVGEDGSW +  P L+H + +V+ +
Sbjct:   211 DHLKPEYVVFLTDVLGVYDRPPSPSEPDAVLLKEIAVGEDGSWKVVNPLLEHTDKKVDYS 270

Query:   119 VAAHDTTGGMVTKISEAAMIAKLGIDVYIVKAASSHSVKALSGELREKIPDDWLGTVIHF 178
             VAAHDTTGGM TKISEAAMIAKLG+DVYIVKAA++HS +AL+G+LR+ +P+DWLGT+I F
Sbjct:   271 VAAHDTTGGMETKISEAAMIAKLGVDVYIVKAATTHSQRALNGDLRDSVPEDWLGTIIRF 330

Query:   179 SR 180
             S+
Sbjct:   331 SK 332

GO:0003674 "molecular_function" evidence=ND

GO:0005737 "cytoplasm" evidence=ISM

GO:0008652 "cellular amino acid biosynthetic process" evidence=IEA

DICTYBASE\|DDB_G0288029 DDB_G0288029 "amino acid kinase" [Dictyostelium discoideum (taxid:44689)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	fgenesh2_kg.1__2698__AT1G26640.1	annotation not avaliable (330 aa)
		(Arabidopsis lyrata)
Predicted Functional Partners:
	fgenesh2_kg.6__2716__AT5G27450.1	annotation not avaliable (378 aa)	•		•	0.770
	Al_scaffold_0004_608	annotation not avaliable (291 aa)	•	•	•	0.718
	scaffold_202163.1	annotation not avaliable (297 aa)	•			0.575
	fgenesh2_kg.3__447__AT3G04770.1	annotation not avaliable (318 aa)	•			0.544
	Al_scaffold_0002_357	annotation not avaliable (71 aa)	•			0.416

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		184
cd04241		252	cd04241, AAK_FomA-like, AAK_FomA-like: This CD inc	4e-47
COG1608		252	COG1608, COG1608, Predicted archaeal kinase [Gener	8e-27
pfam00696		230	pfam00696, AA_kinase, Amino acid kinase family	8e-16
cd04242		251	cd04242, AAK_G5K_ProB, AAK_G5K_ProB: Glutamate-5-k	2e-09
PRK05429		372	PRK05429, PRK05429, gamma-glutamyl kinase; Provisi	6e-09
COG0263		369	COG0263, ProB, Glutamate 5-kinase [Amino acid tran	4e-08
PRK12314		266	PRK12314, PRK12314, gamma-glutamyl kinase; Provisi	2e-07
PLN02418		718	PLN02418, PLN02418, delta-1-pyrroline-5-carboxylat	5e-07
PRK13402		368	PRK13402, PRK13402, gamma-glutamyl kinase; Provisi	3e-06
TIGR01027		363	TIGR01027, proB, glutamate 5-kinase	2e-05
cd04256		284	cd04256, AAK_P5CS_ProBA, AAK_P5CS_ProBA: Glutamate	2e-04
TIGR01092		715	TIGR01092, P5CS, delta l-pyrroline-5-carboxylate s	5e-04
cd02115		248	cd02115, AAK, Amino Acid Kinases (AAK) superfamily	0.001
PLN02512		309	PLN02512, PLN02512, acetylglutamate kinase	0.001
COG0548		265	COG0548, ArgB, Acetylglutamate kinase [Amino acid	0.001
TIGR00761		231	TIGR00761, argB, acetylglutamate kinase	0.003

>gnl\|CDD\|239774 cd04241, AAK_FomA-like, AAK_FomA-like: This CD includes a fosfomycin biosynthetic gene product, FomA, and similar proteins found in a wide range of organisms	Back alignment and domain information

 Score =  153 bits (390), Expect = 4e-47
 Identities = 68/176 (38%), Positives = 89/176 (50%), Gaps = 22/176 (12%)

Query: 1   MSPFSCGWSTSGGNLPVADLSVVAKTIKSGFVPVLHGDAVLDDVQGCAILSGDVIIRHLA 60
           + P S   + +G  +   DL V+ + +  GFVPVLHGD VLD+  G  ILSGD I+  LA
Sbjct: 99  VPPSSFFVTENGRIVS-FDLEVIKELLDRGFVPVLHGDVVLDEGGGITILSGDDIVVELA 157

Query: 61  AYMKPDYVVFLTDVLGVYSHPPTEPNAVLLREIAVGEDGSWSITKPTLQHMNNQVEITVA 120
             +KP+ V+FLTDV GVY  PP  P+A L+ EI V   GS       L           A
Sbjct: 158 KALKPERVIFLTDVDGVYDKPP--PDAKLIPEIDV---GSLEDILAALG---------SA 203

Query: 121 AHDTTGGMVTKISEAAMIAKLGIDVYIVKAASSHSVKALSGELREKIPDDWLGTVI 176
             D TGGM  KI E   +A+ GI+VYI               L   +  +++GT I
Sbjct: 204 GTDVTGGMAGKIEELLELARRGIEVYIFNGDK-------PENLYRALLGNFIGTRI 252

Together, the fomA and fomB genes in the fosfomycin biosynthetic gene cluster of Streptomyces wedmorensis confer high-level fosfomycin resistance. FomA and FomB proteins converted fosfomycin to fosfomycin monophosphate and fosfomycin diphosphate in the presence of ATP and a magnesium ion, indicating that FomA and FomB catalyzed phosphorylations of fosfomycin and fosfomycin monophosphate, respectively. FomA and related sequences in this CD are members of the Amino Acid Kinase Superfamily (AAK). Length = 252

>gnl\|CDD\|224524 COG1608, COG1608, Predicted archaeal kinase [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|216067 pfam00696, AA_kinase, Amino acid kinase family	Back alignment and domain information

>gnl\|CDD\|239775 cd04242, AAK_G5K_ProB, AAK_G5K_ProB: Glutamate-5-kinase (G5K) catalyzes glutamate-dependent ATP cleavage; G5K transfers the terminal phosphoryl group of ATP to the gamma-carboxyl group of glutamate, in the first and controlling step of proline (and, in mammals, ornithine) biosynthesis	Back alignment and domain information

>gnl\|CDD\|235460 PRK05429, PRK05429, gamma-glutamyl kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|223341 COG0263, ProB, Glutamate 5-kinase [Amino acid transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|183430 PRK12314, PRK12314, gamma-glutamyl kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|215230 PLN02418, PLN02418, delta-1-pyrroline-5-carboxylate synthase	Back alignment and domain information

>gnl\|CDD\|184032 PRK13402, PRK13402, gamma-glutamyl kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|162163 TIGR01027, proB, glutamate 5-kinase	Back alignment and domain information

>gnl\|CDD\|239789 cd04256, AAK_P5CS_ProBA, AAK_P5CS_ProBA: Glutamate-5-kinase (G5K) domain of the bifunctional delta 1-pyrroline-5-carboxylate synthetase (P5CS), composed of an N-terminal G5K (ProB) and a C-terminal glutamyl 5- phosphate reductase (G5PR, ProA), the first and second enzyme catalyzing proline (and, in mammals, ornithine) biosynthesis	Back alignment and domain information

>gnl\|CDD\|130164 TIGR01092, P5CS, delta l-pyrroline-5-carboxylate synthetase	Back alignment and domain information

>gnl\|CDD\|239033 cd02115, AAK, Amino Acid Kinases (AAK) superfamily, catalytic domain; present in such enzymes like N-acetylglutamate kinase (NAGK), carbamate kinase (CK), aspartokinase (AK), glutamate-5-kinase (G5K) and UMP kinase (UMPK)	Back alignment and domain information

>gnl\|CDD\|178128 PLN02512, PLN02512, acetylglutamate kinase	Back alignment and domain information

>gnl\|CDD\|223622 COG0548, ArgB, Acetylglutamate kinase [Amino acid transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|233118 TIGR00761, argB, acetylglutamate kinase	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		184
COG1608		252	Predicted archaeal kinase [General function predic	99.97
cd04241		252	AAK_FomA-like AAK_FomA-like: This CD includes a fo	99.97
cd04256		284	AAK_P5CS_ProBA AAK_P5CS_ProBA: Glutamate-5-kinase	99.95
PRK12314		266	gamma-glutamyl kinase; Provisional	99.94
COG0263		369	ProB Glutamate 5-kinase [Amino acid transport and	99.94
PRK14058		268	acetylglutamate/acetylaminoadipate kinase; Provisi	99.94
cd04242		251	AAK_G5K_ProB AAK_G5K_ProB: Glutamate-5-kinase (G5K	99.94
PTZ00489		264	glutamate 5-kinase; Provisional	99.93
PRK13402		368	gamma-glutamyl kinase; Provisional	99.93
CHL00202		284	argB acetylglutamate kinase; Provisional	99.93
PRK00942		283	acetylglutamate kinase; Provisional	99.93
PRK05429		372	gamma-glutamyl kinase; Provisional	99.93
PLN02512		309	acetylglutamate kinase	99.93
cd04250		279	AAK_NAGK-C AAK_NAGK-C: N-Acetyl-L-glutamate kinase	99.93
TIGR01027		363	proB glutamate 5-kinase. Bacterial ProB proteins h	99.93
COG0548		265	ArgB Acetylglutamate kinase [Amino acid transport	99.93
cd04249		252	AAK_NAGK-NC AAK_NAGK-NC: N-Acetyl-L-glutamate kina	99.92
cd04238		256	AAK_NAGK-like AAK_NAGK-like: N-Acetyl-L-glutamate	99.92
TIGR01092		715	P5CS delta l-pyrroline-5-carboxylate synthetase. T	99.92
cd04251		257	AAK_NAGK-UC AAK_NAGK-UC: N-Acetyl-L-glutamate kina	99.91
cd04237		280	AAK_NAGS-ABP AAK_NAGS-ABP: N-acetylglutamate (NAG)	99.91
PRK05279		441	N-acetylglutamate synthase; Validated	99.9
PRK12686		312	carbamate kinase; Reviewed	99.9
cd02115		248	AAK Amino Acid Kinases (AAK) superfamily, catalyti	99.9
PRK12353		314	putative amino acid kinase; Reviewed	99.9
TIGR00761		231	argB acetylglutamate kinase. This model describes	99.89
PLN02418		718	delta-1-pyrroline-5-carboxylate synthase	99.89
cd04252		248	AAK_NAGK-fArgBP AAK_NAGK-fArgBP: N-Acetyl-L-glutam	99.89
TIGR01890		429	N-Ac-Glu-synth amino-acid N-acetyltransferase. Thi	99.88
PRK12454		313	carbamate kinase-like carbamoyl phosphate syntheta	99.87
cd04236		271	AAK_NAGS-Urea AAK_NAGS-Urea: N-acetylglutamate (NA	99.87
cd04235		308	AAK_CK AAK_CK: Carbamate kinase (CK) catalyzes bot	99.87
PF00696		242	AA_kinase: Amino acid kinase family Match to Gluta	99.87
TIGR00746		310	arcC carbamate kinase. The seed alignment for this	99.87
PRK12352		316	putative carbamate kinase; Reviewed	99.86
PRK14558		231	pyrH uridylate kinase; Provisional	99.86
cd04255		262	AAK_UMPK-MosAB AAK_UMPK-MosAB: This CD includes th	99.86
cd04239		229	AAK_UMPK-like AAK_UMPK-like: UMP kinase (UMPK)-lik	99.86
TIGR02076		221	pyrH_arch uridylate kinase, putative. This family	99.86
cd04253		221	AAK_UMPK-PyrH-Pf AAK_UMPK-PyrH-Pf: UMP kinase (UMP	99.86
PRK14556		249	pyrH uridylate kinase; Provisional	99.85
PRK00358		231	pyrH uridylate kinase; Provisional	99.85
KOG1154		285	consensus Gamma-glutamyl kinase [Amino acid transp	99.85
cd04246		239	AAK_AK-DapG-like AAK_AK-DapG-like: Amino Acid Kina	99.85
PRK14557		247	pyrH uridylate kinase; Provisional	99.85
PRK09411		297	carbamate kinase; Reviewed	99.85
cd04254		231	AAK_UMPK-PyrH-Ec UMP kinase (UMPK)-Ec, the microbi	99.84
cd04261		239	AAK_AKii-LysC-BS AAK_AKii-LysC-BS: Amino Acid Kina	99.84
PRK12354		307	carbamate kinase; Reviewed	99.84
TIGR02075		233	pyrH_bact uridylate kinase. This protein, also cal	99.83
COG0528		238	PyrH Uridylate kinase [Nucleotide transport and me	99.81
cd04260		244	AAK_AKi-DapG-BS AAK_AKi-DapG-BS: Amino Acid Kinase	99.81
cd04234		227	AAK_AK AAK_AK: Amino Acid Kinase Superfamily (AAK)	99.79
PRK04531		398	acetylglutamate kinase; Provisional	99.78
PRK06635		404	aspartate kinase; Reviewed	99.75
PLN02825		515	amino-acid N-acetyltransferase	99.75
PRK08210		403	aspartate kinase I; Reviewed	99.75
TIGR00656		401	asp_kin_monofn aspartate kinase, monofunctional cl	99.73
PRK08841		392	aspartate kinase; Validated	99.71
TIGR02078		327	AspKin_pair Pyrococcus aspartate kinase subunit, p	99.7
TIGR00657		441	asp_kinases aspartate kinase. The Lys-sensitive en	99.7
PRK07431		587	aspartate kinase; Provisional	99.69
cd04240		203	AAK_UC AAK_UC: Uncharacterized (UC) amino acid kin	99.68
COG0549		312	ArcC Carbamate kinase [Amino acid transport and me	99.66
PRK08373		341	aspartate kinase; Validated	99.65
PRK06291		465	aspartate kinase; Provisional	99.63
cd04244		298	AAK_AK-LysC-like AAK_AK-LysC-like: Amino Acid Kina	99.59
COG0527		447	LysC Aspartokinases [Amino acid transport and meta	99.49
cd04259		295	AAK_AK-DapDC AAK_AK-DapDC: Amino Acid Kinase Super	99.49
cd04245		288	AAK_AKiii-YclM-BS AAK_AKiii-YclM-BS: Amino Acid Ki	99.48
PRK05925		440	aspartate kinase; Provisional	99.45
cd04243		293	AAK_AK-HSDH-like AAK_AK-HSDH-like: Amino Acid Kina	99.44
cd04257		294	AAK_AK-HSDH AAK_AK-HSDH: Amino Acid Kinase Superfa	99.43
PRK09084		448	aspartate kinase III; Validated	99.41
cd04247		306	AAK_AK-Hom3 AAK_AK-Hom3: Amino Acid Kinase Superfa	99.38
PRK08961		861	bifunctional aspartate kinase/diaminopimelate deca	99.37
PRK09034		454	aspartate kinase; Reviewed	99.35
PRK09436		819	thrA bifunctional aspartokinase I/homoserine dehyd	99.34
cd04258		292	AAK_AKiii-LysC-EC AAK_AKiii-LysC-EC: Amino Acid Ki	99.26
COG2054		212	Uncharacterized archaeal kinase related to asparto	99.24
PLN02551		521	aspartokinase	99.23
PRK09466		810	metL bifunctional aspartate kinase II/homoserine d	99.15
PRK09181		475	aspartate kinase; Validated	99.02
cd04248		304	AAK_AK-Ectoine AAK_AK-Ectoine: Amino Acid Kinase S	98.91
KOG2436		520	consensus Acetylglutamate kinase/acetylglutamate s	98.35
KOG0456		559	consensus Aspartate kinase [Amino acid transport a	98.32
COG1778		170	Low specificity phosphatase (HAD superfamily) [Gen	83.98

>COG1608 Predicted archaeal kinase [General function prediction only]	Back alignment and domain information

Probab=99.97  E-value=7.6e-31  Score=214.15  Aligned_cols=151  Identities=42%  Similarity=0.626  Sum_probs=132.2

Q ss_pred             CCCCcceeeccCCCcceechHHHHHHHHcCCeeEEcCceEeeCCCceeeechhHHHHHHHHhcCCCEEEEeecccceecC
Q 029969            1 MSPFSCGWSTSGGNLPVADLSVVAKTIKSGFVPVLHGDAVLDDVQGCAILSGDVIIRHLAAYMKPDYVVFLTDVLGVYSH   80 (184)
Q Consensus         1 ~~~~~~~~~~~~g~v~~~~~~~I~~lL~~G~IPIv~gd~~~~e~~~~~~~s~D~iA~~lA~~l~Ad~li~ltdVdGVy~~   80 (184)
                      ++|++|.  +++|++.....+.+..+|+.|++||++||.+.++..++.++|+|.++.+||+.|++|+++|+|||||||+.
T Consensus       100 ~~P~s~~--~~~gr~~~~~l~~i~~~l~~gfvPvl~GDVv~d~~~g~~IiSGDdIv~~LA~~l~pd~v~f~tdVdGVy~~  177 (252)
T COG1608         100 VVPISFS--TFNGRILYTYLEAIKDALEKGFVPVLYGDVVPDDDNGYEIISGDDIVLHLAKELKPDRVIFLTDVDGVYDR  177 (252)
T ss_pred             ccCccee--ecCCceeechHHHHHHHHHcCCEeeeecceEEcCCCceEEEeccHHHHHHHHHhCCCEEEEEecCCceecC
Confidence            3788885  66899988889999999999999999999999766689999999999999999999999999999999999


Q ss_pred             CC-cCCCceeeeeeeccCCCCcccchhHHHhhccchhhhcccccccCchHHHHHHHHHHHHCCCeEEEEcCCCcChh-hh
Q 029969           81 PP-TEPNAVLLREIAVGEDGSWSITKPTLQHMNNQVEITVAAHDTTGGMVTKISEAAMIAKLGIDVYIVKAASSHSV-KA  158 (184)
Q Consensus        81 dp-~~p~~~li~~I~~~e~~~~~~~~~~l~~~~~~~~~~~~~~~vtGgm~~Kl~aa~~a~~~gi~v~I~~g~~~~~l-~~  158 (184)
                      +| +.|+...++++....         .+.        ++.+.|+||||..|++++.++.+.+.+|+++||++++++ ++
T Consensus       178 ~p~~~p~~~~l~~i~~~~---------~~~--------gs~~~DVTGGi~~Kl~~~~~~~~~~~~vyi~ng~~~~ni~~~  240 (252)
T COG1608         178 DPGKVPDARLLSEIEGRV---------ALG--------GSGGTDVTGGIAKKLEALLEIARYGKEVYIFNGNKPENIYRA  240 (252)
T ss_pred             CCCcCccccchhhhhhhh---------hhc--------CcCcccchhhHHHHHHHHHHHHhcCceEEEECCCCHHHHHHH
Confidence            99 588888777775532         122        224579999999999999999999999999999999998 78


Q ss_pred             hcCCcccCCCCCccccEEEc
Q 029969          159 LSGELREKIPDDWLGTVIHF  178 (184)
Q Consensus       159 l~Ge~~~~~~~~~~GT~i~~  178 (184)
                      |+|+.+        ||+|.+
T Consensus       241 l~G~~v--------GT~I~~  252 (252)
T COG1608         241 LRGENV--------GTRIDG  252 (252)
T ss_pred             hcCCCC--------ceEecC
Confidence            999984        999864

>cd04241 AAK_FomA-like AAK_FomA-like: This CD includes a fosfomycin biosynthetic gene product, FomA, and similar proteins found in a wide range of organisms	Back alignment and domain information

>cd04256 AAK_P5CS_ProBA AAK_P5CS_ProBA: Glutamate-5-kinase (G5K) domain of the bifunctional delta 1-pyrroline-5-carboxylate synthetase (P5CS), composed of an N-terminal G5K (ProB) and a C-terminal glutamyl 5- phosphate reductase (G5PR, ProA), the first and second enzyme catalyzing proline (and, in mammals, ornithine) biosynthesis	Back alignment and domain information

>PRK12314 gamma-glutamyl kinase; Provisional	Back alignment and domain information

>COG0263 ProB Glutamate 5-kinase [Amino acid transport and metabolism]	Back alignment and domain information

>PRK14058 acetylglutamate/acetylaminoadipate kinase; Provisional	Back alignment and domain information

>cd04242 AAK_G5K_ProB AAK_G5K_ProB: Glutamate-5-kinase (G5K) catalyzes glutamate-dependent ATP cleavage; G5K transfers the terminal phosphoryl group of ATP to the gamma-carboxyl group of glutamate, in the first and controlling step of proline (and, in mammals, ornithine) biosynthesis	Back alignment and domain information

>PTZ00489 glutamate 5-kinase; Provisional	Back alignment and domain information

>PRK13402 gamma-glutamyl kinase; Provisional	Back alignment and domain information

>CHL00202 argB acetylglutamate kinase; Provisional	Back alignment and domain information

>PRK00942 acetylglutamate kinase; Provisional	Back alignment and domain information

>PRK05429 gamma-glutamyl kinase; Provisional	Back alignment and domain information

>PLN02512 acetylglutamate kinase	Back alignment and domain information

>cd04250 AAK_NAGK-C AAK_NAGK-C: N-Acetyl-L-glutamate kinase - cyclic (NAGK-C) catalyzes the phosphorylation of the gamma-COOH group of N-acetyl-L-glutamate (NAG) by ATP in the second step of arginine biosynthesis found in some bacteria and photosynthetic organisms using the non-acetylated, cyclic route of ornithine biosynthesis	Back alignment and domain information

>TIGR01027 proB glutamate 5-kinase	Back alignment and domain information

>COG0548 ArgB Acetylglutamate kinase [Amino acid transport and metabolism]	Back alignment and domain information

>cd04249 AAK_NAGK-NC AAK_NAGK-NC: N-Acetyl-L-glutamate kinase - noncyclic (NAGK-NC) catalyzes the phosphorylation of the gamma-COOH group of N-acetyl-L-glutamate (NAG) by ATP in the second step of microbial arginine biosynthesis using the acetylated, noncyclic route of ornithine biosynthesis	Back alignment and domain information

>cd04238 AAK_NAGK-like AAK_NAGK-like: N-Acetyl-L-glutamate kinase (NAGK)-like	Back alignment and domain information

>TIGR01092 P5CS delta l-pyrroline-5-carboxylate synthetase	Back alignment and domain information

>cd04251 AAK_NAGK-UC AAK_NAGK-UC: N-Acetyl-L-glutamate kinase - uncharacterized (NAGK-UC)	Back alignment and domain information

>cd04237 AAK_NAGS-ABP AAK_NAGS-ABP: N-acetylglutamate (NAG) kinase-like domain of the NAG Synthase (NAGS) of the arginine-biosynthesis pathway (ABP) found in gamma- and beta-proteobacteria and higher plant chloroplasts	Back alignment and domain information

>PRK05279 N-acetylglutamate synthase; Validated	Back alignment and domain information

>PRK12686 carbamate kinase; Reviewed	Back alignment and domain information

>cd02115 AAK Amino Acid Kinases (AAK) superfamily, catalytic domain; present in such enzymes like N-acetylglutamate kinase (NAGK), carbamate kinase (CK), aspartokinase (AK), glutamate-5-kinase (G5K) and UMP kinase (UMPK)	Back alignment and domain information

>PRK12353 putative amino acid kinase; Reviewed	Back alignment and domain information

>TIGR00761 argB acetylglutamate kinase	Back alignment and domain information

>PLN02418 delta-1-pyrroline-5-carboxylate synthase	Back alignment and domain information

>cd04252 AAK_NAGK-fArgBP AAK_NAGK-fArgBP: N-Acetyl-L-glutamate kinase (NAGK) of the fungal arginine-biosynthetic pathway (fArgBP)	Back alignment and domain information

>TIGR01890 N-Ac-Glu-synth amino-acid N-acetyltransferase	Back alignment and domain information

>PRK12454 carbamate kinase-like carbamoyl phosphate synthetase; Reviewed	Back alignment and domain information

>cd04236 AAK_NAGS-Urea AAK_NAGS-Urea: N-acetylglutamate (NAG) kinase-like domain of the NAG Synthase (NAGS) of the urea cycle found in animals	Back alignment and domain information

>cd04235 AAK_CK AAK_CK: Carbamate kinase (CK) catalyzes both the ATP-phosphorylation of carbamate and carbamoyl phosphate (CP) utilization with the production of ATP from ADP and CP	Back alignment and domain information

>PF00696 AA_kinase: Amino acid kinase family Match to Glutamate-5-kinases, C-terminal end of the alignment Match to Aspartate kinases; InterPro: IPR001048 This entry contains proteins with various specificities and includes the aspartate, glutamate and uridylate kinase families	Back alignment and domain information

>TIGR00746 arcC carbamate kinase	Back alignment and domain information

>PRK12352 putative carbamate kinase; Reviewed	Back alignment and domain information

>PRK14558 pyrH uridylate kinase; Provisional	Back alignment and domain information

>cd04255 AAK_UMPK-MosAB AAK_UMPK-MosAB: This CD includes the alpha and beta subunits of the Mo storage protein (MosA and MosB) which are related to uridine monophosphate kinase (UMPK) enzymes that catalyze the phosphorylation of UMP by ATP, yielding UDP, and playing a key role in pyrimidine nucleotide biosynthesis	Back alignment and domain information

>cd04239 AAK_UMPK-like AAK_UMPK-like: UMP kinase (UMPK)-like, the microbial/chloroplast uridine monophosphate kinase (uridylate kinase) enzyme that catalyzes UMP phosphorylation and plays a key role in pyrimidine nucleotide biosynthesis	Back alignment and domain information

>TIGR02076 pyrH_arch uridylate kinase, putative	Back alignment and domain information

>cd04253 AAK_UMPK-PyrH-Pf AAK_UMPK-PyrH-Pf: UMP kinase (UMPK)-Pf, the mostly archaeal uridine monophosphate kinase (uridylate kinase) enzymes that catalyze UMP phosphorylation and play a key role in pyrimidine nucleotide biosynthesis; regulation of this process is via feed-back control and via gene repression of carbamoyl phosphate synthetase (the first enzyme of the pyrimidine biosynthesis pathway)

Back alignment and domain information

>PRK14556 pyrH uridylate kinase; Provisional	Back alignment and domain information

>PRK00358 pyrH uridylate kinase; Provisional	Back alignment and domain information

>KOG1154 consensus Gamma-glutamyl kinase [Amino acid transport and metabolism]	Back alignment and domain information

>cd04246 AAK_AK-DapG-like AAK_AK-DapG-like: Amino Acid Kinase Superfamily (AAK), AK-DapG-like; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the diaminopimelate-sensitive aspartokinase isoenzyme AKI (DapG), a monofunctional enzymes found in Bacilli (Bacillus subtilis 168), Clostridia, and Actinobacteria bacterial species, as well as, the catalytic AK domain of the lysine-sensitive aspartokinase isoenzyme AKII of Bacillus subtilis 168, the lysine plus threonine-sensitive aspartokinase of Corynebacterium glutamicum, and related isoenzymes

Back alignment and domain information

>PRK14557 pyrH uridylate kinase; Provisional	Back alignment and domain information

>PRK09411 carbamate kinase; Reviewed	Back alignment and domain information

>cd04254 AAK_UMPK-PyrH-Ec UMP kinase (UMPK)-Ec, the microbial/chloroplast uridine monophosphate kinase (uridylate kinase) enzyme that catalyzes UMP phosphorylation and plays a key role in pyrimidine nucleotide biosynthesis; regulation of this process is via feed-back control and via gene repression of carbamoyl phosphate synthetase (the first enzyme of the pyrimidine biosynthesis pathway)	Back alignment and domain information

>cd04261 AAK_AKii-LysC-BS AAK_AKii-LysC-BS: Amino Acid Kinase Superfamily (AAK), AKii; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the lysine-sensitive aspartokinase isoenzyme AKII of Bacillus subtilis 168, and the lysine plus threonine-sensitive aspartokinase of Corynebacterium glutamicum, and related sequences	Back alignment and domain information

>PRK12354 carbamate kinase; Reviewed	Back alignment and domain information

>TIGR02075 pyrH_bact uridylate kinase	Back alignment and domain information

>COG0528 PyrH Uridylate kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>cd04260 AAK_AKi-DapG-BS AAK_AKi-DapG-BS: Amino Acid Kinase Superfamily (AAK), AKi-DapG; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the diaminopimelate-sensitive aspartokinase isoenzyme AKI (DapG), a monofunctional class enzyme found in Bacilli (Bacillus subtilis 168), Clostridia, and Actinobacteria bacterial species	Back alignment and domain information

>cd04234 AAK_AK AAK_AK: Amino Acid Kinase Superfamily (AAK), Aspartokinase (AK); this CD includes the N-terminal catalytic domain of aspartokinase (4-L-aspartate-4-phosphotransferase;)	Back alignment and domain information

>PRK04531 acetylglutamate kinase; Provisional	Back alignment and domain information

>PRK06635 aspartate kinase; Reviewed	Back alignment and domain information

>PLN02825 amino-acid N-acetyltransferase	Back alignment and domain information

>PRK08210 aspartate kinase I; Reviewed	Back alignment and domain information

>TIGR00656 asp_kin_monofn aspartate kinase, monofunctional class	Back alignment and domain information

>PRK08841 aspartate kinase; Validated	Back alignment and domain information

>TIGR02078 AspKin_pair Pyrococcus aspartate kinase subunit, putative	Back alignment and domain information

>TIGR00657 asp_kinases aspartate kinase	Back alignment and domain information

>PRK07431 aspartate kinase; Provisional	Back alignment and domain information

>cd04240 AAK_UC AAK_UC: Uncharacterized (UC) amino acid kinase-like proteins found mainly in archaea and a few bacteria	Back alignment and domain information

>COG0549 ArcC Carbamate kinase [Amino acid transport and metabolism]	Back alignment and domain information

>PRK08373 aspartate kinase; Validated	Back alignment and domain information

>PRK06291 aspartate kinase; Provisional	Back alignment and domain information

>cd04244 AAK_AK-LysC-like AAK_AK-LysC-like: Amino Acid Kinase Superfamily (AAK), AK-LysC-like; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the lysine-sensitive AK isoenzyme found in higher plants	Back alignment and domain information

>COG0527 LysC Aspartokinases [Amino acid transport and metabolism]	Back alignment and domain information

>cd04259 AAK_AK-DapDC AAK_AK-DapDC: Amino Acid Kinase Superfamily (AAK), AK-DapDC; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the bifunctional enzyme AK - DAP decarboxylase (DapDC) found in some bacteria	Back alignment and domain information

>cd04245 AAK_AKiii-YclM-BS AAK_AKiii-YclM-BS: Amino Acid Kinase Superfamily (AAK), AKiii-YclM-BS; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the lysine plus threonine-sensitive aspartokinase isoenzyme AKIII, a monofunctional class enzyme found in Bacilli (Bacillus subtilis YclM) and Clostridia species	Back alignment and domain information

>PRK05925 aspartate kinase; Provisional	Back alignment and domain information

>cd04243 AAK_AK-HSDH-like AAK_AK-HSDH-like: Amino Acid Kinase Superfamily (AAK), AK-HSDH-like; this family includes the N-terminal catalytic domain of aspartokinase (AK) of the bifunctional enzyme AK- homoserine dehydrogenase (HSDH)	Back alignment and domain information

>cd04257 AAK_AK-HSDH AAK_AK-HSDH: Amino Acid Kinase Superfamily (AAK), AK-HSDH; this CD includes the N-terminal catalytic domain of aspartokinase (AK) of the bifunctional enzyme AK - homoserine dehydrogenase (HSDH)	Back alignment and domain information

>PRK09084 aspartate kinase III; Validated	Back alignment and domain information

>cd04247 AAK_AK-Hom3 AAK_AK-Hom3: Amino Acid Kinase Superfamily (AAK), AK-Hom3; this CD includes the N-terminal catalytic domain of the aspartokinase HOM3, a monofunctional class enzyme found in Saccharomyces cerevisiae and other related AK domains	Back alignment and domain information

>PRK08961 bifunctional aspartate kinase/diaminopimelate decarboxylase protein; Provisional	Back alignment and domain information

>PRK09034 aspartate kinase; Reviewed	Back alignment and domain information

>PRK09436 thrA bifunctional aspartokinase I/homoserine dehydrogenase I; Provisional	Back alignment and domain information

>cd04258 AAK_AKiii-LysC-EC AAK_AKiii-LysC-EC: Amino Acid Kinase Superfamily (AAK), AKiii-LysC-EC: this CD includes the N-terminal catalytic aspartokinase (AK) domain of the lysine-sensitive aspartokinase isoenzyme AKIII	Back alignment and domain information

>COG2054 Uncharacterized archaeal kinase related to aspartokinases, uridylate kinases [General function prediction only]	Back alignment and domain information

>PLN02551 aspartokinase	Back alignment and domain information

>PRK09466 metL bifunctional aspartate kinase II/homoserine dehydrogenase II; Provisional	Back alignment and domain information

>PRK09181 aspartate kinase; Validated	Back alignment and domain information

>cd04248 AAK_AK-Ectoine AAK_AK-Ectoine: Amino Acid Kinase Superfamily (AAK), AK-Ectoine; this CD includes the N-terminal catalytic domain of the aspartokinase of the ectoine (1,4,5,6-tetrahydro-2-methyl pyrimidine-4-carboxylate) biosynthetic pathway found in Methylomicrobium alcaliphilum, Vibrio cholerae, and other various halotolerant or halophilic bacteria	Back alignment and domain information

>KOG2436 consensus Acetylglutamate kinase/acetylglutamate synthase [Amino acid transport and metabolism]	Back alignment and domain information

>KOG0456 consensus Aspartate kinase [Amino acid transport and metabolism]	Back alignment and domain information

>COG1778 Low specificity phosphatase (HAD superfamily) [General function prediction only]	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		184
3ll9_A		269	X-Ray Structures Of Isopentenyl Phosphate Kinase Le		7e-14
3lkk_A		249	Crystal Structure Of The Isopentenyl Phosphate Kina		2e-13
3ll5_A		249	Crystal Structure Of T. Acidophilum Isopentenyl Pho		1e-11
3k4o_A		266	Crystal Structure Of Isopentenyl Phosphate Kinase F		1e-10

>pdb|3LL9|A Chain A, X-Ray Structures Of Isopentenyl Phosphate Kinase Length = 269

Back alignment and structure

Iteration: 1

Score = 73.6 bits (179), Expect = 7e-14, Method: Compositional matrix adjust. Identities = 51/154 (33%), Positives = 85/154 (55%), Gaps = 18/154 (11%) Query: 13 GNLPVADLSVVAKTIKSGFVPVLHGDAVLDDVQGC--AILSGDVIIRHLAAYMKPDYVVF 70 G + AD+S++ ++ G VPV++GD VLD + +++SGD +I H + + P+ V+ Sbjct: 119 GRISHADISLIRSYLEEGXVPVVYGDVVLDSDRRLKFSVISGDQLINHFSLRLXPERVIL 178 Query: 71 LTDVLGVYS-HPPTEPNAVLLREIAVGEDGSWSITKPTLQHMNNQVEITVAAHDTTGGMV 129 TDV GVY+ +P P+A LL I +D L+ ++ + D TGG V Sbjct: 179 GTDVDGVYTRNPKKHPDARLLDVIGSLDD---------LESLDGTLNT-----DVTGGXV 224 Query: 130 TKISEAAMIAKLGIDVYIVKAASSHSV-KALSGE 162 KI E ++A+ G++ I+ AA ++ +AL GE Sbjct: 225 GKIRELLLLAEKGVESEIINAAVPGNIERALLGE 258

PyMOL of 3ll9

>pdb|3LKK|A Chain A, Crystal Structure Of The Isopentenyl Phosphate Kinase Substr Complex Length = 249

Back alignment and structure

>pdb|3LL5|A Chain A, Crystal Structure Of T. Acidophilum Isopentenyl Phosphate Ki Product Complex Length = 249

Back alignment and structure

>pdb|3K4O|A Chain A, Crystal Structure Of Isopentenyl Phosphate Kinase From Methanocaldococcus Jannaschii Length = 266

Back alignment and structure

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		184
3ll5_A		249	Gamma-glutamyl kinase related protein; alternate m	1e-31
3ll9_A		269	Isopentenyl phosphate kinase; mevalonate biosynthe	4e-31
3d40_A		286	FOMA protein; fosfomycin, antibiotic resistance, k	4e-30
3k4o_A		266	Isopentenyl phosphate kinase; small molecule kinas	2e-25
2j5v_A		367	Glutamate 5-kinase; proline biosynthesis, gamma gl	4e-09
2ako_A		251	Glutamate 5-kinase; structural genomics, PSI, prot	4e-08
2ogx_A		276	Molybdenum storage protein subunit alpha; open alp	8e-07
2we5_A		310	Carbamate kinase 1; arginine catabolism, arginine	2e-05
3s6k_A		467	Acetylglutamate kinase; synthase, transferase; 2.8	4e-04
2brx_A		244	Uridylate kinase; UMP kinase, amino acid kinase, p	6e-04

>3ll5_A Gamma-glutamyl kinase related protein; alternate mevalonate pathway, isopentenyl phsophate kinase, beta-alpha sandwich fold; HET: MSE ADP IPE ATP IP8; 1.99A {Thermoplasma acidophilum} PDB: 3lkk_A* Length = 249	Back alignment and structure

 Score =  113 bits (285), Expect = 1e-31
 Identities = 47/161 (29%), Positives = 70/161 (43%), Gaps = 29/161 (18%)

Query: 19  DLSVVAKTIKSGFVPVLHGDAVLDDVQGCAILSGDVIIRHLAAYMKPDYVVFLTDVLGVY 78
           D + + + I +GFVPV +GD  + D     I SGD I+  +A  +KPD  VFLTDV G+Y
Sbjct: 114 DYTPLIRYIDAGFVPVSYGDVYIKDEHSYGIYSGDDIMADMAELLKPDVAVFLTDVDGIY 173

Query: 79  SHPP-TEPNAVLLREIAVGEDGSWSITKPTLQHMNNQVEITVAAHDTTGGMVTKISEAAM 137
           S  P   P+AVLLR+I                  +  +      +D TGG+  K      
Sbjct: 174 SKDPKRNPDAVLLRDI------------------DTNITFDRVQNDVTGGIGKKFESMVK 215

Query: 138 IAK-LGIDVYIVKAASSHSV-KALSGELREKIPDDWLGTVI 176
           +   +   VY++       +               ++GTVI
Sbjct: 216 MKSSVKNGVYLINGNHPERIGDIGKES--------FIGTVI 248

PyMOL of 3ll5

>3ll9_A Isopentenyl phosphate kinase; mevalonate biosynthesis isoprenoid, transferase; HET: ADP; 2.15A {Methanothermobacter thermautotrophicusorganism_taxid} Length = 269	Back alignment and structure

>3d40_A FOMA protein; fosfomycin, antibiotic resistance, kinase, phosphoryl transfer, transferase; 1.53A {Streptomyces wedmorensis} PDB: 3d41_A* 3qun_A* 3quo_A* 3qur_A* 3qvf_A* 3qvh_A* Length = 286	Back alignment and structure

>3k4o_A Isopentenyl phosphate kinase; small molecule kinase, ATP-binding, transferase, methanocald jannaschii, isopentenyl monophosphate; 2.05A {Methanocaldococcus jannaschii} PDB: 3k4y_A* 3k52_A* 3k56_A* Length = 266	Back alignment and structure

>2j5v_A Glutamate 5-kinase; proline biosynthesis, gamma glutamyl kinase, amino-acid biosynthesis, transferase, feedback regulation, PUA domain; HET: RGP; 2.5A {Escherichia coli} PDB: 2j5t_A* 2w21_A Length = 367	Back alignment and structure

>2ako_A Glutamate 5-kinase; structural genomics, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics, nysgxrc; HET: ADP; 2.20A {Campylobacter jejuni} SCOP: c.73.1.3 Length = 251	Back alignment and structure

>2ogx_A Molybdenum storage protein subunit alpha; open alpha/beta structure, metal binding protein; HET: ATP; 1.60A {Azotobacter vinelandii} Length = 276	Back alignment and structure

>2we5_A Carbamate kinase 1; arginine catabolism, arginine metabolism, ATP synthesys, open alpha/beta sheet, phosphotransferase, transferase; HET: ADP; 1.39A {Enterococcus faecalis} PDB: 1b7b_A 2we4_A* Length = 310	Back alignment and structure

>3s6k_A Acetylglutamate kinase; synthase, transferase; 2.80A {Xanthomonas campestris PV} Length = 467	Back alignment and structure

>2brx_A Uridylate kinase; UMP kinase, amino acid kinase, phosphoryl group transfer, pyrimidine biosynthesis, transferase; 2.40A {Pyrococcus furiosus} SCOP: c.73.1.3 PDB: 2ji5_A* 2bmu_A* 2bri_A* Length = 244	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		184
3ll9_A		269	Isopentenyl phosphate kinase; mevalonate biosynthe	99.97
3ll5_A		249	Gamma-glutamyl kinase related protein; alternate m	99.95
3d40_A		286	FOMA protein; fosfomycin, antibiotic resistance, k	99.95
2ap9_A		299	NAG kinase, acetylglutamate kinase, AGK; structura	99.95
2rd5_A		298	Acetylglutamate kinase-like protein; protein-prote	99.94
2egx_A		269	Putative acetylglutamate kinase; struc genomics, N	99.94
2v5h_A		321	Acetylglutamate kinase; amino-acid biosynthesis, t	99.94
2ako_A		251	Glutamate 5-kinase; structural genomics, PSI, prot	99.94
2j5v_A		367	Glutamate 5-kinase; proline biosynthesis, gamma gl	99.94
3k4o_A		266	Isopentenyl phosphate kinase; small molecule kinas	99.93
2buf_A		300	Acetylglutamate kinase; acetyglutamate kinase, ADP	99.92
2bty_A		282	Acetylglutamate kinase; N-acetyl-L-glutamate kinas	99.92
2j4j_A		226	Uridylate kinase; transferase, nucleoside monophos	99.92
2e9y_A		316	Carbamate kinase; transferase, structural genomics	99.91
2we5_A		310	Carbamate kinase 1; arginine catabolism, arginine	99.91
1gs5_A		258	Acetylglutamate kinase; carbamate kinase, amino ac	99.91
3l86_A		279	Acetylglutamate kinase; ARGB, amino-acid biosynthe	99.9
3zzh_A		307	Acetylglutamate kinase; transferase, arginine bios	99.9
1e19_A		314	Carbamate kinase-like carbamoylphosphate synthetas	99.9
3d2m_A		456	Putative acetylglutamate synthase; protein-COA-Glu	99.9
2ogx_A		276	Molybdenum storage protein subunit alpha; open alp	99.9
3kzf_A		317	Carbamate kinase; arginine dihydrolase pathway, gi	99.89
2ogx_B		270	Molybdenum storage protein subunit beta; open alph	99.89
3ek6_A		243	Uridylate kinase; UMPK unique GTP B site, alloster	99.89
1z9d_A		252	Uridylate kinase, UK, UMP kinase; structural genom	99.88
3s6g_A		460	N-acetylglutamate kinase / N-acetylglutamate SYNT;	99.88
2brx_A		244	Uridylate kinase; UMP kinase, amino acid kinase, p	99.88
2va1_A		256	Uridylate kinase; UMPK, transferase, pyrimidine bi	99.88
4ab7_A		464	Protein Arg5,6, mitochondrial; transferase, argini	99.88
4a7w_A		240	Uridylate kinase; transferase; HET: GTP; 1.80A {He	99.88
2ij9_A		219	Uridylate kinase; structural genomics, protein str	99.88
1ybd_A		239	Uridylate kinase; alpha/beta/alpha fold, hexamer,	99.88
2a1f_A		247	Uridylate kinase; PYRH, structural genomics, PSI,	99.87
3nwy_A		281	Uridylate kinase; allosterically activated form, A	99.87
3s6k_A		467	Acetylglutamate kinase; synthase, transferase; 2.8	99.86
2jjx_A		255	Uridylate kinase, UMP kinase; structural genomics,	99.86
4axs_A		332	Carbamate kinase; oxidoreductase; 2.50A {Mycoplasm	99.85
3c1m_A		473	Probable aspartokinase; allosteric inhibition, thr	99.8
3ab4_A		421	Aspartokinase; aspartate kinase, concerted inhibit	99.79
3l76_A		600	Aspartokinase; allostery, ACT domains, kinase tran	99.73
2cdq_A		510	Aspartokinase; aspartate kinase, amino acid metabo	99.72
3tvi_A		446	Aspartokinase; structural genomics, ACT domains, r	99.71
2j0w_A		449	Lysine-sensitive aspartokinase 3; feedback inhibit	99.68

>3ll9_A Isopentenyl phosphate kinase; mevalonate biosynthesis isoprenoid, transferase; HET: ADP; 2.15A {Methanothermobacter thermautotrophicusorganism_taxid}	Back alignment and structure

Probab=99.97  E-value=2.7e-30  Score=215.82  Aligned_cols=155  Identities=37%  Similarity=0.563  Sum_probs=120.6

Q ss_pred             CCCCcceeeccCCCcceechHHHHHHHHcCCeeEEcCceEeeCC--CceeeechhHHHHHHHHhcCCCEEEEeeccccee
Q 029969            1 MSPFSCGWSTSGGNLPVADLSVVAKTIKSGFVPVLHGDAVLDDV--QGCAILSGDVIIRHLAAYMKPDYVVFLTDVLGVY   78 (184)
Q Consensus         1 ~~~~~~~~~~~~g~v~~~~~~~I~~lL~~G~IPIv~gd~~~~e~--~~~~~~s~D~iA~~lA~~l~Ad~li~ltdVdGVy   78 (184)
                      |++.++++. +.|+++.+|.+.|+.+|++|+|||++|+...++.  .+.+++++|++|+++|.+|+||+|+|+|||||||
T Consensus       108 l~g~~~~~~-~~g~v~~v~~~~i~~lL~~g~ipVi~~~~~~~~~~~g~~~~~~~D~~Aa~lA~~l~Ad~li~ltdv~Gv~  186 (269)
T 3ll9_A          108 MQPSAFIRA-HAGRISHADISLIRSYLEEGMVPVVYGDVVLDSDRRLKFSVISGDQLINHFSLRLMPERVILGTDVDGVY  186 (269)
T ss_dssp             CCGGGTEEE-ETTEEEEECCHHHHHHHHTTCEEEEECEEEEBSCTTTSEEEECHHHHHHHHHHHHCCSEEEEEESSSSCB
T ss_pred             EcchHcCeE-ecCeeeeecHHHHHHHHHCCCEEEECCCEEecccccCcceecchHHHHHHHHHHcCCCeEEEecCCCEEE
Confidence            455666444 3799999999999999999999999997776544  5678999999999999999999999999999999


Q ss_pred             cCCC-cCCCceeeeeeeccCCCCcccchhHHHhhccchhhhcccccccCchHHHHHHHHHHHHCCCeEEEEcCCCcChh-
Q 029969           79 SHPP-TEPNAVLLREIAVGEDGSWSITKPTLQHMNNQVEITVAAHDTTGGMVTKISEAAMIAKLGIDVYIVKAASSHSV-  156 (184)
Q Consensus        79 ~~dp-~~p~~~li~~I~~~e~~~~~~~~~~l~~~~~~~~~~~~~~~vtGgm~~Kl~aa~~a~~~gi~v~I~~g~~~~~l-  156 (184)
                      ++|| .+|++++|+++++.|+      ...+..        +.+.+++|||.+|+++|..++++|++++|++++.++.+ 
T Consensus       187 ~~dp~~~~~a~~i~~i~~~e~------~~~l~~--------~~~~~~tgGM~~Kl~aa~~a~~~Gv~v~I~~g~~~~~l~  252 (269)
T 3ll9_A          187 TRNPKKHPDARLLDVIGSLDD------LESLDG--------TLNTDVTGGMVGKIRELLLLAEKGVESEIINAAVPGNIE  252 (269)
T ss_dssp             SSCTTTCTTCCBCSBCCC---------------------------------SHHHHHHHHHHHTTCCEEEEESSSTTHHH
T ss_pred             cCCCCcCCcceEccccCHHHH------HHHhcc--------cCCCcCcCCcHHHHHHHHHHHhCCCeEEEEeCCCchHHH
Confidence            9999 6899999999999874      112211        12468999999999999999999999999999999986 


Q ss_pred             hhhcCCcccCCCCCccccEEE
Q 029969          157 KALSGELREKIPDDWLGTVIH  177 (184)
Q Consensus       157 ~~l~Ge~~~~~~~~~~GT~i~  177 (184)
                      ++|+|+..       .||.|.
T Consensus       253 ~~~~g~~~-------~GT~i~  266 (269)
T 3ll9_A          253 RALLGEEV-------RGTRIT  266 (269)
T ss_dssp             HHHHTCCC-------SSEEC-
T ss_pred             HHHCCCCC-------CcEEEE
Confidence            78999872       299987

PyMOL of 3ll9

>3ll5_A Gamma-glutamyl kinase related protein; alternate mevalonate pathway, isopentenyl phsophate kinase, beta-alpha sandwich fold; HET: MSE ADP IPE ATP IP8; 1.99A {Thermoplasma acidophilum} PDB: 3lkk_A*	Back alignment and structure

>3d40_A FOMA protein; fosfomycin, antibiotic resistance, kinase, phosphoryl transfer, transferase; 1.53A {Streptomyces wedmorensis} PDB: 3d41_A* 3qun_A* 3quo_A* 3qur_A* 3qvf_A* 3qvh_A*	Back alignment and structure

>2ap9_A NAG kinase, acetylglutamate kinase, AGK; structural genomics, protein structure initiative, NYSGXRC, PSI; 2.80A {Mycobacterium tuberculosis} SCOP: c.73.1.2	Back alignment and structure

>2rd5_A Acetylglutamate kinase-like protein; protein-protein complex, regulation of arginine biosynthesis nitrogen metabolism, kinase, transferase, transcription; HET: ARG ADP NLG ATP; 2.51A {Arabidopsis thaliana}	Back alignment and structure

>2v5h_A Acetylglutamate kinase; amino-acid biosynthesis, transcription regulation, transfera cyanobacteria, transcription; HET: NLG; 2.75A {Synechococcus elongatus} PDB: 2jj4_A*	Back alignment and structure

>2ako_A Glutamate 5-kinase; structural genomics, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics, nysgxrc; HET: ADP; 2.20A {Campylobacter jejuni} SCOP: c.73.1.3	Back alignment and structure

>2j5v_A Glutamate 5-kinase; proline biosynthesis, gamma glutamyl kinase, amino-acid biosynthesis, transferase, feedback regulation, PUA domain; HET: RGP; 2.5A {Escherichia coli} PDB: 2j5t_A* 2w21_A	Back alignment and structure

>3k4o_A Isopentenyl phosphate kinase; small molecule kinase, ATP-binding, transferase, methanocald jannaschii, isopentenyl monophosphate; 2.05A {Methanocaldococcus jannaschii} PDB: 3k4y_A* 3k52_A* 3k56_A*	Back alignment and structure

>2buf_A Acetylglutamate kinase; acetyglutamate kinase, ADP, arginine biosynthesis, FEED-BACK inhibition, hexamer, transferase; HET: NLG ADP; 2.95A {Pseudomonas aeruginosa} SCOP: c.73.1.2	Back alignment and structure

>2bty_A Acetylglutamate kinase; N-acetyl-L-glutamate kinase, amino acid kinase, phosphoryl group transfer, arginine metabolism, transferase; HET: ARG NLG; 2.75A {Thermotoga maritima} SCOP: c.73.1.2	Back alignment and structure

>2j4j_A Uridylate kinase; transferase, nucleoside monophosphate kinase, UMP kinase, aspartokinase fold, pyrimidine nucleotide synthesis; HET: U5P ACP 4TC; 2.1A {Sulfolobus solfataricus} PDB: 2j4k_A* 2j4l_A*	Back alignment and structure

>2e9y_A Carbamate kinase; transferase, structural genomics, NPPSFA, national project O structural and functional analyses; 1.80A {Aeropyrum pernix}	Back alignment and structure

>2we5_A Carbamate kinase 1; arginine catabolism, arginine metabolism, ATP synthesys, open alpha/beta sheet, phosphotransferase, transferase; HET: ADP; 1.39A {Enterococcus faecalis} PDB: 1b7b_A 2we4_A*	Back alignment and structure

>1gs5_A Acetylglutamate kinase; carbamate kinase, amino acid kinase, arginine biosynthesis, phosphoryl group transfer, protein crystallography; HET: NLG ANP; 1.5A {Escherichia coli} SCOP: c.73.1.2 PDB: 1gsj_A* 1oh9_A* 1oha_A* 1ohb_A* 2wxb_A 2x2w_A* 3t7b_A*	Back alignment and structure

>3l86_A Acetylglutamate kinase; ARGB, amino-acid biosynthesis, arginine biosynthesi binding, nucleotide-binding, transferase; HET: ADP NLG; 2.06A {Streptococcus mutans}	Back alignment and structure

>3zzh_A Acetylglutamate kinase; transferase, arginine biosynthesis; HET: ARG NLG; 2.10A {Saccharomyces cerevisiae} PDB: 3zzg_A 3zzf_A*	Back alignment and structure

>1e19_A Carbamate kinase-like carbamoylphosphate synthetase; transferase, hyperthermophiles, ADP site, phosphoryl group transfer; HET: ADP; 1.5A {Pyrococcus furiosus} SCOP: c.73.1.1	Back alignment and structure

>3d2m_A Putative acetylglutamate synthase; protein-COA-Glu ternary complex, transferase; HET: COA GLU; 2.21A {Neisseria gonorrhoeae} PDB: 2r8v_A* 3b8g_A* 2r98_A* 3d2p_A*	Back alignment and structure

>2ogx_A Molybdenum storage protein subunit alpha; open alpha/beta structure, metal binding protein; HET: ATP; 1.60A {Azotobacter vinelandii}	Back alignment and structure

>3kzf_A Carbamate kinase; arginine dihydrolase pathway, giardia LAMB target, transferase; 3.00A {Giardia lamblia atcc 50803}	Back alignment and structure

>2ogx_B Molybdenum storage protein subunit beta; open alpha/beta structure, metal binding protein; HET: ATP; 1.60A {Azotobacter vinelandii}	Back alignment and structure

>3ek6_A Uridylate kinase; UMPK unique GTP B site, allosteric regulation, ATP-binding, nucleotid binding, pyrimidine biosynthesis, transferase; 2.34A {Xanthomonas campestris PV} SCOP: c.73.1.0 PDB: 3ek5_A	Back alignment and structure

>1z9d_A Uridylate kinase, UK, UMP kinase; structural genomics, protein structure initiative, NYSGXRC, PYRH, putative uridylate kinase, PSI; 2.80A {Streptococcus pyogenes} SCOP: c.73.1.3	Back alignment and structure

>3s6g_A N-acetylglutamate kinase / N-acetylglutamate SYNT; synthase, transferase; HET: COA; 2.67A {Maricaulis maris} PDB: 3s7y_A 3s6h_A*	Back alignment and structure

>2brx_A Uridylate kinase; UMP kinase, amino acid kinase, phosphoryl group transfer, pyrimidine biosynthesis, transferase; 2.40A {Pyrococcus furiosus} SCOP: c.73.1.3 PDB: 2ji5_A* 2bmu_A* 2bri_A*	Back alignment and structure

>2va1_A Uridylate kinase; UMPK, transferase, pyrimidine biosynthesis, amino acid kinase family; 2.50A {Ureaplasma parvum}	Back alignment and structure

>4ab7_A Protein Arg5,6, mitochondrial; transferase, arginine biosynthesis, amino acid kinase domain GCN5-related acetyltransferase, GNAT; HET: NLG; 3.25A {Saccharomyces cerevisiae} PDB: 3zzi_A*	Back alignment and structure

>4a7w_A Uridylate kinase; transferase; HET: GTP; 1.80A {Helicobacter pylori} PDB: 4a7x_A*	Back alignment and structure

>2ij9_A Uridylate kinase; structural genomics, protein structure initiative, P nysgxrc; 2.90A {Archaeoglobus fulgidus} SCOP: c.73.1.3	Back alignment and structure

>1ybd_A Uridylate kinase; alpha/beta/alpha fold, hexamer, structural genomics, structure initiative, PSI; 2.60A {Neisseria meningitidis} SCOP: c.73.1.3	Back alignment and structure

>2a1f_A Uridylate kinase; PYRH, structural genomics, PSI, protein ST initiative, NEW YORK SGX research center for structural GEN nysgxrc; 2.10A {Haemophilus influenzae} SCOP: c.73.1.3 PDB: 2bne_A* 2bnf_A* 2v4y_A* 2bnd_A*	Back alignment and structure

>3nwy_A Uridylate kinase; allosterically activated form, AAK fold, UMP kinase, transfe; HET: GTP UDP; 2.54A {Mycobacterium tuberculosis}	Back alignment and structure

>3s6k_A Acetylglutamate kinase; synthase, transferase; 2.80A {Xanthomonas campestris PV}	Back alignment and structure

>2jjx_A Uridylate kinase, UMP kinase; structural genomics, pyrimidine biosynthesis, ATP-binding, nucleotide-binding, OPPF, PYRH, cytoplasm; HET: ATP; 2.82A {Bacillus anthracis}	Back alignment and structure

>4axs_A Carbamate kinase; oxidoreductase; 2.50A {Mycoplasma penetrans}	Back alignment and structure

>3ab4_A Aspartokinase; aspartate kinase, concerted inhibition, alternative initiati amino-acid biosynthesis, ATP-binding; HET: LYS; 2.47A {Corynebacterium glutamicum} PDB: 3aaw_A* 3ab2_A	Back alignment and structure

>3l76_A Aspartokinase; allostery, ACT domains, kinase transferase; HET: LYS; 2.54A {Synechocystis}	Back alignment and structure

>2cdq_A Aspartokinase; aspartate kinase, amino acid metabolism, ACT domain, alloste S-adenosylmethionine, lysine, allosteric effector, plant; HET: TAR SAM LYS; 2.85A {Arabidopsis thaliana} SCOP: c.73.1.3 d.58.18.10 d.58.18.10	Back alignment and structure

>3tvi_A Aspartokinase; structural genomics, ACT domains, regulatory domains, kinase transferase, PSI-2, protein structure initiative; HET: LYS; 3.00A {Clostridium acetobutylicum}	Back alignment and structure

>2j0w_A Lysine-sensitive aspartokinase 3; feedback inhibition, allosteric regulation, ACT domain, transferase, amino acid biosynthesis; HET: ADP; 2.5A {Escherichia coli} SCOP: c.73.1.3 d.58.18.10 d.58.18.10 PDB: 2j0x_A*	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		184
d2akoa1		250	c.73.1.3 (A:2-251) Glutamate 5-kinase {Campylobact	3e-06
d2ij9a1		219	c.73.1.3 (A:1-219) Uridylate kinase PyrH {Archaeog	2e-04

>d2akoa1 c.73.1.3 (A:2-251) Glutamate 5-kinase {Campylobacter jejuni [TaxId: 197]} Length = 250	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: Carbamate kinase-like
superfamily: Carbamate kinase-like
family: PyrH-like
domain: Glutamate 5-kinase
species: Campylobacter jejuni [TaxId: 197]

 Score = 43.9 bits (102), Expect = 3e-06
 Identities = 23/145 (15%), Positives = 47/145 (32%), Gaps = 16/145 (11%)

Query: 32  VPVLHGDAVLDDVQGCAILSGDVIIRHLAAYMKPDYVVFLTDVLGVYSHPPTEPNAVLLR 91
           +  +  +     ++       D +  +   +   D +V L+D+ G Y   P+E +     
Sbjct: 121 ILPIINENDATAIEEIVFGDNDSLSAYATHFFDADLLVILSDIDGFYDKNPSEFSDAKRL 180

Query: 92  EIAVGEDGSWSITKPTLQHMNNQVEITVAAHDTTGGMVTKISEAAMIAKLGIDVYIVKAA 151
           E                     Q  I   +   TGG+VTK+  A  + +    +++    
Sbjct: 181 EKITHIK-----------EEWLQATIKTGSEHGTGGIVTKLKAAKFLLEHNKKMFLASGF 229

Query: 152 SSHSVKALSGELREKIPDDWLGTVI 176
                K    E ++       GT+ 
Sbjct: 230 DLSVAKTFLLEDKQIG-----GTLF 249

PyMOL of d2akoa1

>d2ij9a1 c.73.1.3 (A:1-219) Uridylate kinase PyrH {Archaeoglobus fulgidus [TaxId: 2234]} Length = 219	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		184
d2bufa1		300	N-acetyl-l-glutamate kinase {Pseudomonas aeruginos	99.93
d2btya1		282	N-acetyl-l-glutamate kinase {Thermotoga maritima [	99.93
d2akoa1		250	Glutamate 5-kinase {Campylobacter jejuni [TaxId: 1	99.92
d2ap9a1		291	N-acetyl-l-glutamate kinase {Mycobacterium tubercu	99.92
d2brxa1		225	Uridylate kinase PyrH {Pyrococcus furiosus [TaxId:	99.91
d2ij9a1		219	Uridylate kinase PyrH {Archaeoglobus fulgidus [Tax	99.9
d1e19a_		313	Carbamate kinase {Archaeon Pyrococcus furiosus [Ta	99.89
d1b7ba_		307	Carbamate kinase {Enterococcus faecium [TaxId: 135	99.85
d2a1fa1		236	Uridylate kinase PyrH {Haemophilus influenzae [Tax	99.84
d1ybda1		236	Uridylate kinase PyrH {Neisseria meningitidis [Tax	99.8
d1gs5a_		258	N-acetyl-l-glutamate kinase {Escherichia coli [Tax	99.71
d1z9da1		238	Uridylate kinase PyrH {Streptococcus pyogenes [Tax	99.7
d2hmfa1		302	Aspartokinase {Methanococcus jannaschii [TaxId: 21	99.43
d2cdqa1		304	Aspartokinase {Thale cress (Arabidopsis thaliana)	99.43
d2j0wa1		292	Aspartokinase {Escherichia coli [TaxId: 562]}	99.37

>d2bufa1 c.73.1.2 (A:2-301) N-acetyl-l-glutamate kinase {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Carbamate kinase-like
superfamily: Carbamate kinase-like
family: N-acetyl-l-glutamate kinase
domain: N-acetyl-l-glutamate kinase
species: Pseudomonas aeruginosa [TaxId: 287]

Probab=99.93  E-value=5e-26  Score=190.48  Aligned_cols=138  Identities=19%  Similarity=0.309  Sum_probs=118.0

Q ss_pred             CCCcceechHHHHHHHHcCCeeEEcCceEeeCCCceeeechhHHHHHHHHhcCCCEEEEeecccceecCCCcCCCceeee
Q 029969           12 GGNLPVADLSVVAKTIKSGFVPVLHGDAVLDDVQGCAILSGDVIIRHLAAYMKPDYVVFLTDVLGVYSHPPTEPNAVLLR   91 (184)
Q Consensus        12 ~g~v~~~~~~~I~~lL~~G~IPIv~gd~~~~e~~~~~~~s~D~iA~~lA~~l~Ad~li~ltdVdGVy~~dp~~p~~~li~   91 (184)
                      .|+++.+|.+.|+.+|++|+|||+++.++.. .+..+|+++|.+|+.+|.+|+||+|||||||+|||+.     ++++++
T Consensus       158 ~G~v~~v~~~~i~~ll~~g~Ipvis~~~~~~-~G~~~nin~D~~Aa~lA~~L~AdkLI~Ltdv~Gv~~~-----~g~~~~  231 (300)
T d2bufa1         158 VGEVTGVNVGLLNMLVKGDFIPVIAPIGVGS-NGESYNINADLVAGKVAEALKAEKLMLLTNIAGLMDK-----QGQVLT  231 (300)
T ss_dssp             BEEEEEECHHHHHHHHHTTCEEEEEEEEECT-TSCEEECCHHHHHHHHHHHHTCSEEEEEESSSCCBCT-----TSCBCC
T ss_pred             ccceeecchhHHHHHhcCCCeEEecccccCc-ccchhcccHHHHHHHHHHHcCCCeEEEEcCCCccccC-----CCcchh
Confidence            3899999999999999999999999877753 3457899999999999999999999999999999975     467888


Q ss_pred             eeeccCCCCcccchhHHHhhccchhhhcccccccCchHHHHHHHHHHHHCCCe-EEEEcCCCcChh--hhhcCCcccCCC
Q 029969           92 EIAVGEDGSWSITKPTLQHMNNQVEITVAAHDTTGGMVTKISEAAMIAKLGID-VYIVKAASSHSV--KALSGELREKIP  168 (184)
Q Consensus        92 ~I~~~e~~~~~~~~~~l~~~~~~~~~~~~~~~vtGgm~~Kl~aa~~a~~~gi~-v~I~~g~~~~~l--~~l~Ge~~~~~~  168 (184)
                      +++.+++          +++.       ....++|||.+|+++|..|++.|++ |||+||+.++.+  ++|+++..    
T Consensus       232 ~l~~~~~----------~~li-------~~~~i~gGM~~Kl~aa~~a~~~Gv~rv~Ii~g~~~~~ll~eLft~~g~----  290 (300)
T d2bufa1         232 GLSTEQV----------NELI-------ADGTIYGGMLPKIRCALEAVQGGVTSAHIIDGRVPNAVLLEIFTDSGV----  290 (300)
T ss_dssp             EECHHHH----------HHHH-------HTTCSCTTHHHHHHHHHHHHHTTCSEEEEEETTSTTHHHHHHSSTTCC----
T ss_pred             hccHHHH----------HHHH-------HcCCcCchHHHHHHHHHHHHHcCCCEEEEecCCCCCHHHHHHcCCCCc----
Confidence            8888663          3321       1356899999999999999999996 999999999974  57888773    


Q ss_pred             CCccccEEEcCc
Q 029969          169 DDWLGTVIHFSR  180 (184)
Q Consensus       169 ~~~~GT~i~~~~  180 (184)
                          ||.|..++
T Consensus       291 ----GT~I~~~~  298 (300)
T d2bufa1         291 ----GTLISNRK  298 (300)
T ss_dssp             ----SEEEECCC
T ss_pred             ----eeEEecCC
Confidence                99998764

PyMOL of d2bufa1

>d2btya1 c.73.1.2 (A:1-282) N-acetyl-l-glutamate kinase {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d2akoa1 c.73.1.3 (A:2-251) Glutamate 5-kinase {Campylobacter jejuni [TaxId: 197]}	Back information, alignment and structure

>d2ap9a1 c.73.1.2 (A:6-296) N-acetyl-l-glutamate kinase {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d2brxa1 c.73.1.3 (A:1-225) Uridylate kinase PyrH {Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d2ij9a1 c.73.1.3 (A:1-219) Uridylate kinase PyrH {Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d1e19a_ c.73.1.1 (A:) Carbamate kinase {Archaeon Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d1b7ba_ c.73.1.1 (A:) Carbamate kinase {Enterococcus faecium [TaxId: 1352]}	Back information, alignment and structure

>d2a1fa1 c.73.1.3 (A:2-237) Uridylate kinase PyrH {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1ybda1 c.73.1.3 (A:6-241) Uridylate kinase PyrH {Neisseria meningitidis [TaxId: 487]}	Back information, alignment and structure

>d1gs5a_ c.73.1.2 (A:) N-acetyl-l-glutamate kinase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1z9da1 c.73.1.3 (A:4-241) Uridylate kinase PyrH {Streptococcus pyogenes [TaxId: 1314]}	Back information, alignment and structure

>d2hmfa1 c.73.1.3 (A:2-303) Aspartokinase {Methanococcus jannaschii [TaxId: 2190]}	Back information, alignment and structure

>d2cdqa1 c.73.1.3 (A:25-328) Aspartokinase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d2j0wa1 c.73.1.3 (A:3-294) Aspartokinase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure