Citrus Sinensis ID: 029987


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180----
MATHVDMSLDDIIKSRKKSERERGQGRARRGRGRGRGPSGSVSGGRMTGAARRGPLSNARPSSYTIAKSFRRTRNFPWQHDLFEDSLRAAGISGIEVGTKLYVSNLHPGVTNDDIRELFSEIGELKRYAIHFDKNGRPSVSSVACFATFSPLFLWVQLKWYMPEEVMHLQLLSDTIMYCWMENR
ccccccccHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccEEEEEcccccccHHHHHHHHHHHcccEEEEEEEcccccccEEEEEEEccHHHHHHHHHHHcccccccEEEEEEEccccccccccc
ccccccccHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHccccccccccccccccccccEEEEEcccccccHHHHHHHHHHHccccEEEEEEcccccccccEEEEEccHHHHHHHHHHHcccccccccEEEEEcHEEEHHHccc
MATHVDMSLDDIIKSRKKSERERgqgrarrgrgrgrgpsgsvsggrmtgaarrgplsnarpssytIAKSFrrtrnfpwqhdlfEDSLRAAGISGIEVGTKLYvsnlhpgvtndDIRELFSEIGELKRYAIhfdkngrpsvssvacfatfspLFLWVQlkwympeevMHLQLLSDTIMYCWMENR
mathvdmslddiiksrkkserergqgrarrgrgrgrgpsgsvsggrmtgaarrgplsnarpssYTIAKSFRRTRNFPWQHDLFEDSLRAAGISGIEVGTKLYVSNLHPGVTNDDIRELFSEIGELKRYAIHFDKNGRPSVSSVACFATFSPLFLWVQLKWYMPEEVMHLQLLSDTIMYCWMENR
MATHVDMSLDDIIKSRKKSErergqgrarrgrgrgrgpsgsvsggrMTGAARRGPLSNARPSSYTIAKSFRRTRNFPWQHDLFEDSLRAAGISGIEVGTKLYVSNLHPGVTNDDIRELFSEIGELKRYAIHFDKNGRPSVSSVACFATFSPLFLWVQLKWYMPEEVMHLQLLSDTIMYCWMENR
*****************************************************************IAKSFRRTRNFPWQHDLFEDSLRAAGISGIEVGTKLYVSNLHPGVTNDDIRELFSEIGELKRYAIHFDKNGRPSVSSVACFATFSPLFLWVQLKWYMPEEVMHLQLLSDTIMYCWM***
*****DMSLD******************************************************************************************LYVSNLHPGVTNDDIRELFSEIGELKRYAIHFDKNGRPSVSSVACFATFSPLFLWVQLKWYMPEEVMHLQLLSDTI********
MATHVDMSLDDIIKS***********************************ARRGPLSNARPSSYTIAKSFRRTRNFPWQHDLFEDSLRAAGISGIEVGTKLYVSNLHPGVTNDDIRELFSEIGELKRYAIHFDKNGRPSVSSVACFATFSPLFLWVQLKWYMPEEVMHLQLLSDTIMYCWMENR
*******SL**************************************************************************************EVGTKLYVSNLHPGVTNDDIRELFSEIGELKRYAIHFDKNGRPSVSSVACFATFSPLFLWVQLKWYMPEEVMHLQLLSDTIMYCWMENR
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATHVDMSLDDIIKSRKKSERERGQGRARRGRGRGRGPSGSVSGGRMTGAARRGPLSNARPSSYTIAKSFRRTRNFPWQHDLFEDSLRAAGISGIEVGTKLYVSNLHPGVTNDDIRELFSEIGELKRYAIHFDKNGRPSVSSVACFATFSPLFLWVQLKWYMPEEVMHLQLLSDTIMYCWMENR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query184 2.2.26 [Sep-21-2011]
Q9JJW6218 RNA and export factor-bin yes no 0.603 0.509 0.410 5e-16
B5FXN8254 THO complex subunit 4 OS= yes no 0.733 0.531 0.426 2e-13
Q58EA2256 THO complex subunit 4-A O N/A no 0.380 0.273 0.462 2e-12
Q6GLW1256 THO complex subunit 4-B O N/A no 0.380 0.273 0.45 5e-12
Q28FB9260 THO complex subunit 4 OS= yes no 0.380 0.269 0.45 5e-12
O08583255 THO complex subunit 4 OS= no no 0.668 0.482 0.356 7e-10
Q86V81257 THO complex subunit 4 OS= yes no 0.358 0.256 0.457 1e-08
Q3T0I4257 THO complex subunit 4 OS= yes no 0.358 0.256 0.457 1e-08
>sp|Q9JJW6|REFP2_MOUSE RNA and export factor-binding protein 2 OS=Mus musculus GN=Refbp2 PE=1 SV=1 Back     alignment and function desciption
 Score = 84.0 bits (206), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 57/139 (41%), Positives = 72/139 (51%), Gaps = 28/139 (20%)

Query: 1   MATHVDMSLDDIIKSRKKSERERGQGRARRGRGRGRGPSGSVSGGRMTGAARRGPLSNAR 60
           MA  +DMSLDDIIK        R Q R  RG G  R       GGR             R
Sbjct: 1   MADKMDMSLDDIIKL------NRNQRRVNRGGGPRRNRPAIARGGR------------NR 42

Query: 61  PSSYTIAKSFRRTRNFP--WQHDLFEDSLRAAGISGIEVGTKLYVSNLHPGVTNDDIREL 118
           P+ Y+      R +  P  WQHDLF+      G  G+E G KL VSNL  GV++ DI+EL
Sbjct: 43  PAPYS------RPKPLPDKWQHDLFDSG--CGGGEGVETGAKLLVSNLDFGVSDADIQEL 94

Query: 119 FSEIGELKRYAIHFDKNGR 137
           F+E G LK+ A+ +D++GR
Sbjct: 95  FAEFGTLKKAAVDYDRSGR 113




Acts as chaperone and promotes the dimerization of transcription factors containing basic leucine zipper (bZIP) domains and thereby promotes transcriptional activation. Plays a role in mRNA processing and export. May function as scaffold that mediates interactions between proteins and/or RNA. Integral part of the THO/TREX complex that is recruited to transcribed genes and travels with the RNA polymerase during elongation (By similarity). Is part of the exon junction complex that remains associated with spliced mRNA and plays an important role in mRNA export and nonsense-mediated RNA decay.
Mus musculus (taxid: 10090)
>sp|B5FXN8|THOC4_TAEGU THO complex subunit 4 OS=Taeniopygia guttata GN=ALYREF PE=2 SV=1 Back     alignment and function description
>sp|Q58EA2|THO4A_XENLA THO complex subunit 4-A OS=Xenopus laevis GN=alyref-a PE=2 SV=1 Back     alignment and function description
>sp|Q6GLW1|THO4B_XENLA THO complex subunit 4-B OS=Xenopus laevis GN=alyref-b PE=2 SV=1 Back     alignment and function description
>sp|Q28FB9|THOC4_XENTR THO complex subunit 4 OS=Xenopus tropicalis GN=alyref PE=2 SV=1 Back     alignment and function description
>sp|O08583|THOC4_MOUSE THO complex subunit 4 OS=Mus musculus GN=Alyref PE=1 SV=3 Back     alignment and function description
>sp|Q86V81|THOC4_HUMAN THO complex subunit 4 OS=Homo sapiens GN=ALYREF PE=1 SV=3 Back     alignment and function description
>sp|Q3T0I4|THOC4_BOVIN THO complex subunit 4 OS=Bos taurus GN=ALYREF PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query184
356537904 298 PREDICTED: uncharacterized protein LOC10 0.864 0.533 0.561 7e-42
356569696 298 PREDICTED: THO complex subunit 4-like [G 0.864 0.533 0.587 1e-41
225453197269 PREDICTED: THO complex subunit 4 [Vitis 0.826 0.565 0.666 3e-39
224077330264 predicted protein [Populus trichocarpa] 0.809 0.564 0.590 2e-38
255582255268 RNA and export factor binding protein, p 0.836 0.574 0.592 2e-38
224069282274 predicted protein [Populus trichocarpa] 0.853 0.572 0.627 5e-37
357460875 291 THO complex subunit [Medicago truncatula 0.842 0.532 0.565 4e-36
449456227 286 PREDICTED: THO complex subunit 4-like [C 0.923 0.594 0.527 4e-35
449532026 368 PREDICTED: THO complex subunit 4-like, p 0.923 0.461 0.527 4e-35
94466659275 ALY protein [Nicotiana benthamiana] 0.804 0.538 0.598 7e-34
>gi|356537904|ref|XP_003537446.1| PREDICTED: uncharacterized protein LOC100820344 [Glycine max] Back     alignment and taxonomy information
 Score =  175 bits (443), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 100/178 (56%), Positives = 115/178 (64%), Gaps = 19/178 (10%)

Query: 1   MATHVDMSLDDIIKSRKKSERERG----------------QGRARRGRGRGRGPSGSVSG 44
           MA+ +DMSLDD IK+R  +                      GR   G    R  +G+ +G
Sbjct: 1   MASSLDMSLDDRIKNRSNNRGRGRGGRGRAHSGRGPSGTLNGRRMVGAVNSRRMAGAGNG 60

Query: 45  GRMTGAARRGPL-SNARPSSYTIAKSFRRTRNFPWQHDLFEDSLRAAGISGIEVGTKLYV 103
           GR TGA RRGPL  N RPSSY IAKS RR R FPWQHDLFEDSLRAAGI G+EVGTKLYV
Sbjct: 61  GRTTGAVRRGPLMVNTRPSSYAIAKSIRRARPFPWQHDLFEDSLRAAGIQGVEVGTKLYV 120

Query: 104 SNLHPGVTNDDIRELFSEIGELKRYAIHFDKNGRPSVSSVACFATFSPLFLWVQLKWY 161
           SNL  GVTN+DIRELFSE+GELKR+A+H+DKNG PS S+   +   S  F    LK Y
Sbjct: 121 SNLDHGVTNEDIRELFSELGELKRFAVHYDKNGHPSGSAEVVYTRRSDAF--AALKRY 176




Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|356569696|ref|XP_003553032.1| PREDICTED: THO complex subunit 4-like [Glycine max] Back     alignment and taxonomy information
>gi|225453197|ref|XP_002276497.1| PREDICTED: THO complex subunit 4 [Vitis vinifera] gi|296087136|emb|CBI33510.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224077330|ref|XP_002305214.1| predicted protein [Populus trichocarpa] gi|222848178|gb|EEE85725.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255582255|ref|XP_002531919.1| RNA and export factor binding protein, putative [Ricinus communis] gi|223528429|gb|EEF30463.1| RNA and export factor binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224069282|ref|XP_002302945.1| predicted protein [Populus trichocarpa] gi|222844671|gb|EEE82218.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357460875|ref|XP_003600719.1| THO complex subunit [Medicago truncatula] gi|355489767|gb|AES70970.1| THO complex subunit [Medicago truncatula] Back     alignment and taxonomy information
>gi|449456227|ref|XP_004145851.1| PREDICTED: THO complex subunit 4-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449532026|ref|XP_004172985.1| PREDICTED: THO complex subunit 4-like, partial [Cucumis sativus] Back     alignment and taxonomy information
>gi|94466659|emb|CAJ44458.1| ALY protein [Nicotiana benthamiana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query184
TAIR|locus:2151779 288 ALY4 "ALWAYS EARLY 4" [Arabido 0.570 0.364 0.660 1.4e-32
TAIR|locus:2205293 295 AT1G66260 [Arabidopsis thalian 0.766 0.477 0.476 1.3e-29
TAIR|locus:2181763292 AT5G02530 [Arabidopsis thalian 0.777 0.489 0.362 2.5e-17
MGI|MGI:1913144218 Alyref2 "Aly/REF export factor 0.467 0.394 0.428 3.2e-16
UNIPROTKB|E1C2L5258 THOC4 "Uncharacterized protein 0.733 0.523 0.381 6e-16
ZFIN|ZDB-GENE-070928-29280 alyref "Aly/REF export factor" 0.456 0.3 0.391 8.3e-16
MGI|MGI:1341044255 Alyref "Aly/REF export factor" 0.722 0.521 0.353 1.8e-14
UNIPROTKB|Q3T0I4257 ALYREF "THO complex subunit 4" 0.722 0.517 0.344 3e-14
UNIPROTKB|F1PL92257 ALYREF "Uncharacterized protei 0.722 0.517 0.344 3e-14
UNIPROTKB|E9PB61264 ALYREF "THO complex subunit 4" 0.722 0.503 0.344 3e-14
TAIR|locus:2151779 ALY4 "ALWAYS EARLY 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 356 (130.4 bits), Expect = 1.4e-32, P = 1.4e-32
 Identities = 70/106 (66%), Positives = 84/106 (79%)

Query:    49 GAARRGPLS-NARPSSYTIAKSFRRTRNFPWQHDLFEDSLRAAGISGIEVGTKLYVSNLH 107
             G ARRGPL+ NARPSS+TI K  RR R+ PWQ  LFED LRAAG SG+EVGT+L+V+NL 
Sbjct:    42 GPARRGPLAVNARPSSFTINKPVRRVRSLPWQSGLFEDGLRAAGASGVEVGTRLHVTNLD 101

Query:   108 PGVTNDDIRELFSEIGELKRYAIHFDKNGRPSVSSVACFATFSPLF 153
              GVTN+DIRELFSEIGE++RYAIH+DKNGRPS ++   +   S  F
Sbjct:   102 QGVTNEDIRELFSEIGEVERYAIHYDKNGRPSGTAEVVYPRRSDAF 147




GO:0000166 "nucleotide binding" evidence=IEA
GO:0003676 "nucleic acid binding" evidence=IEA;ISS
GO:0008150 "biological_process" evidence=ND
GO:0005730 "nucleolus" evidence=IDA
TAIR|locus:2205293 AT1G66260 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2181763 AT5G02530 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
MGI|MGI:1913144 Alyref2 "Aly/REF export factor 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E1C2L5 THOC4 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-070928-29 alyref "Aly/REF export factor" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:1341044 Alyref "Aly/REF export factor" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q3T0I4 ALYREF "THO complex subunit 4" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1PL92 ALYREF "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E9PB61 ALYREF "THO complex subunit 4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
gw1.IV.3602.1
hypothetical protein (264 aa)
(Populus trichocarpa)
Predicted Functional Partners:
HCP902
histone deacetylase complex protein (120 aa)
       0.800
HCP901
histone deacetylase complex protein (114 aa)
       0.800
HCP903
histone deacetylase complex protein (114 aa)
       0.800
estExt_fgenesh4_pm.C_400112
hypothetical protein (697 aa)
       0.800
estExt_fgenesh4_pg.C_LG_VI1784
SubName- Full=Putative uncharacterized protein; (428 aa)
       0.800
gw1.XVIII.2163.1
hypothetical protein (198 aa)
      0.538
eugene3.01470005
hypothetical protein (187 aa)
      0.534
gw1.XII.145.1
hypothetical protein (286 aa)
      0.473
gw1.XV.140.1
hypothetical protein (219 aa)
      0.433
grail3.0004036801
hypothetical protein (179 aa)
      0.427

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query184
cd1268075 cd12680, RRM_THOC4, RNA recognition motif in THO c 1e-19
cd1241875 cd12418, RRM_Aly_REF_like, RNA recognition motif i 1e-15
cd1268169 cd12681, RRM_SKAR, RNA recognition motif in S6K1 A 5e-10
cd0059072 cd00590, RRM_SF, RNA recognition motif (RRM) super 4e-08
smart0036073 smart00360, RRM, RNA recognition motif 1e-07
pfam0007670 pfam00076, RRM_1, RNA recognition motif 2e-07
pfam1425969 pfam14259, RRM_6, RNA recognition motif (a 4e-06
cd1235272 cd12352, RRM1_TIA1_like, RNA recognition motif 1 i 4e-06
cd1228081 cd12280, RRM_FET, RNA recognition motif in the FET 1e-05
cd1234366 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 2e-05
cd1228473 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 3e-05
cd1225172 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 6e-05
TIGR01628 562 TIGR01628, PABP-1234, polyadenylate binding protei 1e-04
cd1241379 cd12413, RRM1_RBM28_like, RNA recognition motif 1 2e-04
cd1233675 cd12336, RRM_RBM7_like, RNA recognition motif in R 2e-04
COG0724 306 COG0724, COG0724, RNA-binding proteins (RRM domain 2e-04
TIGR01628 562 TIGR01628, PABP-1234, polyadenylate binding protei 3e-04
cd1237880 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in 4e-04
cd1233271 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 4e-04
cd1256476 cd12564, RRM1_RBM19, RNA recognition motif 1 in RN 4e-04
cd1225976 cd12259, RRM_SRSF11_SREK1, RNA recognition motif i 4e-04
cd1233380 cd12333, RRM2_p54nrb_like, RNA recognition motif 2 6e-04
cd1237177 cd12371, RRM2_PUF60, RNA recognition motif 2 in (U 7e-04
cd1239281 cd12392, RRM2_SART3, RNA recognition motif 2 in sq 8e-04
cd1238179 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in 0.001
cd1238476 cd12384, RRM_RBM24_RBM38_like, RNA recognition mot 0.001
cd1222678 cd12226, RRM_NOL8, RNA recognition motif in nucleo 0.001
cd1235580 cd12355, RRM_RBM18, RNA recognition motif in eukar 0.001
cd1226777 cd12267, RRM_YRA1_MLO3, RNA recognition motif in y 0.001
cd1239172 cd12391, RRM1_SART3, RNA recognition motif 1 in sq 0.002
cd1241582 cd12415, RRM3_RBM28_like, RNA recognition motif 3 0.002
cd1232975 cd12329, RRM2_hnRNPD_like, RNA recognition motif 2 0.002
cd1258871 cd12588, RRM1_p54nrb, RNA recognition motif 1 in v 0.002
cd1258980 cd12589, RRM2_PSP1, RNA recognition motif 2 in ver 0.002
cd1245077 cd12450, RRM1_NUCLs, RNA recognition motif 1 found 0.003
cd1238080 cd12380, RRM3_I_PABPs, RNA recognition motif 3 fou 0.003
cd1261474 cd12614, RRM1_PUB1, RNA recognition motif 1 in yea 0.003
cd1259275 cd12592, RRM_RBM7, RNA recognition motif in verteb 0.004
cd1262677 cd12626, RRM1_IGF2BP2, RNA recognition motif 1 in 0.004
cd1231674 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition mot 0.004
cd1259080 cd12590, RRM2_PSF, RNA recognition motif 2 in vert 0.004
cd1232488 cd12324, RRM_RBM8, RNA recognition motif in RNA-bi 0.004
>gnl|CDD|241124 cd12680, RRM_THOC4, RNA recognition motif in THO complex subunit 4 (THOC4) and similar proteins Back     alignment and domain information
 Score = 78.1 bits (193), Expect = 1e-19
 Identities = 24/41 (58%), Positives = 33/41 (80%)

Query: 99  TKLYVSNLHPGVTNDDIRELFSEIGELKRYAIHFDKNGRPS 139
           TKL VSNL  GV++DDI+ELF+E G LK+ A+H+D++GR  
Sbjct: 1   TKLLVSNLDFGVSDDDIKELFAEFGALKKAAVHYDRSGRSL 41


This subgroup corresponds to the RRM of THOC4, also termed transcriptional coactivator Aly/REF, or ally of AML-1 and LEF-1, or bZIP-enhancing factor BEF, an mRNA transporter protein with a well conserved RNA recognition motif (RRM), also termed RBD (RNA binding domain) or RNP (ribonucleoprotein domain). It is involved in RNA transportation from the nucleus. THOC4 was initially identified as a transcription coactivator of LEF-1 and AML-1 for the TCRalpha enhancer function. In addition, THOC4 specifically binds to rhesus (RH) promoter in erythroid. It might be a novel transcription cofactor for erythroid-specific genes. . Length = 75

>gnl|CDD|240864 cd12418, RRM_Aly_REF_like, RNA recognition motif in the Aly/REF family Back     alignment and domain information
>gnl|CDD|241125 cd12681, RRM_SKAR, RNA recognition motif in S6K1 Aly/REF-like target (SKAR) and similar proteins Back     alignment and domain information
>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily Back     alignment and domain information
>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information
>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a Back     alignment and domain information
>gnl|CDD|240798 cd12352, RRM1_TIA1_like, RNA recognition motif 1 in granule-associated RNA binding proteins p40-TIA-1 and TIAR Back     alignment and domain information
>gnl|CDD|240726 cd12280, RRM_FET, RNA recognition motif in the FET family of RNA-binding proteins Back     alignment and domain information
>gnl|CDD|240789 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 and 2 in RRM-containing coactivator activator/modulator (CoAA) and similar proteins Back     alignment and domain information
>gnl|CDD|240730 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 in vertebrate RNA-binding protein RBM23, RBM39 and similar proteins Back     alignment and domain information
>gnl|CDD|240697 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein R (hnRNP R) and similar proteins Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|240859 cd12413, RRM1_RBM28_like, RNA recognition motif 1 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240782 cd12336, RRM_RBM7_like, RNA recognition motif in RNA-binding protein 7 (RBM7) and similar proteins Back     alignment and domain information
>gnl|CDD|223796 COG0724, COG0724, RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|240824 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240778 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 in the p54nrb/PSF/PSP1 family Back     alignment and domain information
>gnl|CDD|241008 cd12564, RRM1_RBM19, RNA recognition motif 1 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|240705 cd12259, RRM_SRSF11_SREK1, RNA recognition motif in serine/arginine-rich splicing factor 11 (SRSF11), splicing regulatory glutamine/lysine-rich protein 1 (SREK1) and similar proteins Back     alignment and domain information
>gnl|CDD|240779 cd12333, RRM2_p54nrb_like, RNA recognition motif 2 in the p54nrb/PSF/PSP1 family Back     alignment and domain information
>gnl|CDD|240817 cd12371, RRM2_PUF60, RNA recognition motif 2 in (U)-binding-splicing factor PUF60 and similar proteins Back     alignment and domain information
>gnl|CDD|240838 cd12392, RRM2_SART3, RNA recognition motif 2 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|240827 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240830 cd12384, RRM_RBM24_RBM38_like, RNA recognition motif in eukaryotic RNA-binding protein RBM24, RBM38 and similar proteins Back     alignment and domain information
>gnl|CDD|240672 cd12226, RRM_NOL8, RNA recognition motif in nucleolar protein 8 (NOL8) and similar proteins Back     alignment and domain information
>gnl|CDD|240801 cd12355, RRM_RBM18, RNA recognition motif in eukaryotic RNA-binding protein 18 and similar proteins Back     alignment and domain information
>gnl|CDD|240713 cd12267, RRM_YRA1_MLO3, RNA recognition motif in yeast RNA annealing protein YRA1 (Yra1p), yeast mRNA export protein mlo3 and similar proteins Back     alignment and domain information
>gnl|CDD|240837 cd12391, RRM1_SART3, RNA recognition motif 1 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|240861 cd12415, RRM3_RBM28_like, RNA recognition motif 3 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240775 cd12329, RRM2_hnRNPD_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein hnRNP D0, hnRNP A/B, hnRNP DL and similar proteins Back     alignment and domain information
>gnl|CDD|241032 cd12588, RRM1_p54nrb, RNA recognition motif 1 in vertebrate 54 kDa nuclear RNA- and DNA-binding protein (p54nrb) Back     alignment and domain information
>gnl|CDD|241033 cd12589, RRM2_PSP1, RNA recognition motif 2 in vertebrate paraspeckle protein 1 (PSP1 or PSPC1) Back     alignment and domain information
>gnl|CDD|240896 cd12450, RRM1_NUCLs, RNA recognition motif 1 found in nucleolin-like proteins mainly from plants Back     alignment and domain information
>gnl|CDD|240826 cd12380, RRM3_I_PABPs, RNA recognition motif 3 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|241058 cd12614, RRM1_PUB1, RNA recognition motif 1 in yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 and similar proteins Back     alignment and domain information
>gnl|CDD|241036 cd12592, RRM_RBM7, RNA recognition motif in vertebrate RNA-binding protein 7 (RBM7) Back     alignment and domain information
>gnl|CDD|241070 cd12626, RRM1_IGF2BP2, RNA recognition motif 1 in vertebrate insulin-like growth factor 2 mRNA-binding protein 2 (IGF2BP2) Back     alignment and domain information
>gnl|CDD|240762 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and RNA recognition motif 2 found in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|241034 cd12590, RRM2_PSF, RNA recognition motif 2 in vertebrate polypyrimidine tract-binding protein (PTB)-associated-splicing factor (PSF) Back     alignment and domain information
>gnl|CDD|240770 cd12324, RRM_RBM8, RNA recognition motif in RNA-binding protein RBM8A, RBM8B nd similar proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 184
KOG0533243 consensus RRM motif-containing protein [RNA proces 99.9
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 99.78
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 99.71
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 99.7
TIGR01659 346 sex-lethal sex-lethal family splicing factor. This 99.69
TIGR01661 352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 99.68
TIGR01622 457 SF-CC1 splicing factor, CC1-like family. A homolog 99.65
KOG0121153 consensus Nuclear cap-binding protein complex, sub 99.65
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 99.63
KOG0122270 consensus Translation initiation factor 3, subunit 99.59
KOG0113 335 consensus U1 small nuclear ribonucleoprotein (RRM 99.59
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 99.59
KOG4207 256 consensus Predicted splicing factor, SR protein su 99.59
KOG0107 195 consensus Alternative splicing factor SRp20/9G8 (R 99.58
KOG0125 376 consensus Ataxin 2-binding protein (RRM superfamil 99.57
KOG0126219 consensus Predicted RNA-binding protein (RRM super 99.57
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 99.57
PLN03120 260 nucleic acid binding protein; Provisional 99.56
KOG0149 247 consensus Predicted RNA-binding protein SEB4 (RRM 99.56
smart0036272 RRM_2 RNA recognition motif. 99.55
KOG0130170 consensus RNA-binding protein RBM8/Tsunagi (RRM su 99.54
PLN03121 243 nucleic acid binding protein; Provisional 99.53
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 99.53
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 99.53
TIGR01642 509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 99.53
TIGR01622 457 SF-CC1 splicing factor, CC1-like family. A homolog 99.52
KOG0145 360 consensus RNA-binding protein ELAV/HU (RRM superfa 99.51
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 99.51
KOG0114124 consensus Predicted RNA-binding protein (RRM super 99.5
PLN03213 759 repressor of silencing 3; Provisional 99.5
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 99.49
KOG0117 506 consensus Heterogeneous nuclear ribonucleoprotein 99.49
COG0724 306 RNA-binding proteins (RRM domain) [General functio 99.49
smart0036071 RRM RNA recognition motif. 99.48
KOG4212 608 consensus RNA-binding protein hnRNP-M [RNA process 99.44
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 99.44
TIGR01649 481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 99.38
KOG0131 203 consensus Splicing factor 3b, subunit 4 [RNA proce 99.38
KOG0108 435 consensus mRNA cleavage and polyadenylation factor 99.37
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 99.36
KOG0148321 consensus Apoptosis-promoting RNA-binding protein 99.35
KOG0127 678 consensus Nucleolar protein fibrillarin NOP77 (RRM 99.35
KOG0148 321 consensus Apoptosis-promoting RNA-binding protein 99.33
TIGR01649 481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 99.33
KOG0124 544 consensus Polypyrimidine tract-binding protein PUF 99.32
KOG0127 678 consensus Nucleolar protein fibrillarin NOP77 (RRM 99.32
smart0036170 RRM_1 RNA recognition motif. 99.31
KOG0144 510 consensus RNA-binding protein CUGBP1/BRUNO (RRM su 99.31
KOG0105 241 consensus Alternative splicing factor ASF/SF2 (RRM 99.3
KOG0147 549 consensus Transcriptional coactivator CAPER (RRM s 99.28
KOG0132 894 consensus RNA polymerase II C-terminal domain-bind 99.25
KOG0117 506 consensus Heterogeneous nuclear ribonucleoprotein 99.24
KOG0144 510 consensus RNA-binding protein CUGBP1/BRUNO (RRM su 99.24
KOG0109 346 consensus RNA-binding protein LARK, contains RRM a 99.23
KOG0111 298 consensus Cyclophilin-type peptidyl-prolyl cis-tra 99.23
KOG0145360 consensus RNA-binding protein ELAV/HU (RRM superfa 99.22
KOG0123 369 consensus Polyadenylate-binding protein (RRM super 99.21
TIGR01642 509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 99.19
KOG0415 479 consensus Predicted peptidyl prolyl cis-trans isom 99.16
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 99.13
KOG0109 346 consensus RNA-binding protein LARK, contains RRM a 99.08
KOG0146371 consensus RNA-binding protein ETR-3 (RRM superfami 99.04
KOG4206 221 consensus Spliceosomal protein snRNP-U1A/U2B [RNA 99.01
KOG0131203 consensus Splicing factor 3b, subunit 4 [RNA proce 98.99
KOG4208214 consensus Nucleolar RNA-binding protein NIFK [Gene 98.97
KOG4212608 consensus RNA-binding protein hnRNP-M [RNA process 98.96
KOG0110 725 consensus RNA-binding protein (RRM superfamily) [G 98.88
KOG0146 371 consensus RNA-binding protein ETR-3 (RRM superfami 98.86
KOG0123369 consensus Polyadenylate-binding protein (RRM super 98.86
KOG0110725 consensus RNA-binding protein (RRM superfamily) [G 98.85
KOG0124 544 consensus Polypyrimidine tract-binding protein PUF 98.81
KOG0153377 consensus Predicted RNA-binding protein (RRM super 98.79
KOG1548 382 consensus Transcription elongation factor TAT-SF1 98.79
KOG4205 311 consensus RNA-binding protein musashi/mRNA cleavag 98.77
KOG4209231 consensus Splicing factor RNPS1, SR protein superf 98.75
KOG0106 216 consensus Alternative splicing factor SRp55/B52/SR 98.74
KOG4661 940 consensus Hsp27-ERE-TATA-binding protein/Scaffold 98.73
KOG0151 877 consensus Predicted splicing regulator, contains R 98.66
KOG0116419 consensus RasGAP SH3 binding protein rasputin, con 98.65
KOG4454 267 consensus RNA binding protein (RRM superfamily) [G 98.65
KOG0105241 consensus Alternative splicing factor ASF/SF2 (RRM 98.62
KOG4660 549 consensus Protein Mei2, essential for commitment t 98.61
KOG0226290 consensus RNA-binding proteins [General function p 98.58
KOG4205 311 consensus RNA-binding protein musashi/mRNA cleavag 98.57
PF0405997 RRM_2: RNA recognition motif 2; InterPro: IPR00720 98.57
KOG1995 351 consensus Conserved Zn-finger protein [General fun 98.53
KOG0147 549 consensus Transcriptional coactivator CAPER (RRM s 98.41
KOG1457 284 consensus RNA binding protein (contains RRM repeat 98.36
KOG4211 510 consensus Splicing factor hnRNP-F and related RNA- 98.31
KOG4211 510 consensus Splicing factor hnRNP-F and related RNA- 98.28
KOG0120 500 consensus Splicing factor U2AF, large subunit (RRM 98.27
KOG4307944 consensus RNA binding protein RBM12/SWAN [General 98.15
KOG0106216 consensus Alternative splicing factor SRp55/B52/SR 98.14
KOG1457284 consensus RNA binding protein (contains RRM repeat 98.14
PF08777105 RRM_3: RNA binding motif; InterPro: IPR014886 This 98.12
PF1160890 Limkain-b1: Limkain b1; InterPro: IPR024582 This e 98.05
KOG1190 492 consensus Polypyrimidine tract-binding protein [RN 97.96
KOG2314 698 consensus Translation initiation factor 3, subunit 97.78
COG5175 480 MOT2 Transcriptional repressor [Transcription] 97.75
KOG1456 494 consensus Heterogeneous nuclear ribonucleoprotein 97.74
KOG4210285 consensus Nuclear localization sequence binding pr 97.64
KOG4849 498 consensus mRNA cleavage factor I subunit/CPSF subu 97.63
KOG4206221 consensus Spliceosomal protein snRNP-U1A/U2B [RNA 97.61
KOG1365 508 consensus RNA-binding protein Fusilli, contains RR 97.61
KOG4676 479 consensus Splicing factor, arginine/serine-rich [R 97.58
PF1460553 Nup35_RRM_2: Nup53/35/40-type RNA recognition moti 97.52
KOG1456 494 consensus Heterogeneous nuclear ribonucleoprotein 97.43
KOG3152 278 consensus TBP-binding protein, activator of basal 97.39
KOG1548382 consensus Transcription elongation factor TAT-SF1 97.34
KOG0129520 consensus Predicted RNA-binding protein (RRM super 97.34
PF07078 316 FYTT: Forty-two-three protein; InterPro: IPR009782 97.16
KOG0128881 consensus RNA-binding protein SART3 (RRM superfami 97.13
KOG1855 484 consensus Predicted RNA-binding protein [General f 97.13
KOG0120500 consensus Splicing factor U2AF, large subunit (RRM 97.05
KOG0129 520 consensus Predicted RNA-binding protein (RRM super 96.93
KOG1365 508 consensus RNA-binding protein Fusilli, contains RR 96.83
KOG0128 881 consensus RNA-binding protein SART3 (RRM superfami 96.82
PF0867587 RNA_bind: RNA binding domain; InterPro: IPR014789 96.8
KOG0115 275 consensus RNA-binding protein p54nrb (RRM superfam 96.76
KOG1190492 consensus Polypyrimidine tract-binding protein [RN 96.69
KOG4307 944 consensus RNA binding protein RBM12/SWAN [General 96.67
PF08952146 DUF1866: Domain of unknown function (DUF1866) ; In 96.51
PF1030962 DUF2414: Protein of unknown function (DUF2414); In 96.45
PF15023166 DUF4523: Protein of unknown function (DUF4523) 96.34
PF03467176 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 96.18
KOG2193 584 consensus IGF-II mRNA-binding protein IMP, contain 96.09
KOG2416 718 consensus Acinus (induces apoptotic chromatin cond 96.0
PF05172100 Nup35_RRM: Nup53/35/40-type RNA recognition motif; 95.89
KOG2202 260 consensus U2 snRNP splicing factor, small subunit, 95.44
KOG1996378 consensus mRNA splicing factor [RNA processing and 95.4
KOG0112 975 consensus Large RNA-binding protein (RRM superfami 94.89
KOG2591 684 consensus c-Mpl binding protein, contains La domai 94.83
PF1176766 SET_assoc: Histone lysine methyltransferase SET as 94.79
KOG0112 975 consensus Large RNA-binding protein (RRM superfami 94.78
KOG2068 327 consensus MOT2 transcription factor [Transcription 94.13
PF07576110 BRAP2: BRCA1-associated protein 2; InterPro: IPR01 93.38
PF04847 184 Calcipressin: Calcipressin; InterPro: IPR006931 Ca 93.28
KOG4660549 consensus Protein Mei2, essential for commitment t 92.26
PF0388074 DbpA: DbpA RNA binding domain ; InterPro: IPR00558 91.28
KOG2135526 consensus Proteins containing the RNA recognition 91.26
KOG4210 285 consensus Nuclear localization sequence binding pr 90.92
KOG0804 493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 89.86
KOG2253 668 consensus U1 snRNP complex, subunit SNU71 and rela 87.51
KOG4410396 consensus 5-formyltetrahydrofolate cyclo-ligase [C 86.17
KOG4285350 consensus Mitotic phosphoprotein [Cell cycle contr 85.66
KOG4454267 consensus RNA binding protein (RRM superfamily) [G 84.98
KOG4574 1007 consensus RNA-binding protein (contains RRM and Pu 82.86
>KOG0533 consensus RRM motif-containing protein [RNA processing and modification] Back     alignment and domain information
Probab=99.90  E-value=3.4e-23  Score=166.10  Aligned_cols=155  Identities=36%  Similarity=0.490  Sum_probs=106.0

Q ss_pred             CCCCCCCCHHHHHhhcCCCCcCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCccccccccCCCCCCCCc
Q 029987            1 MATHVDMSLDDIIKSRKKSERERGQGRARRGRGRGRGPSGSVSGGRMTGAARRGPLSNARPSSYTIAKSFRRTRNFPWQH   80 (184)
Q Consensus         1 m~~~ld~sLddii~~~~~~~r~~~~~~~~~g~~~g~g~g~~~~~~~g~g~~r~~~~~~~r~~~~~~~~~~rr~~~~~~~~   80 (184)
                      |+++|||||||||++.++  +++-++  .++..++.|+     ..+++++.|+.  ...+...       +-..+..|+|
T Consensus         1 ms~~ld~sLd~iI~~~r~--r~G~g~--~r~~~r~~gg-----~~~~~~psR~~--g~~r~~~-------~~~~~~~w~~   62 (243)
T KOG0533|consen    1 MSDSLDMSLDDIIKSNRK--RGGVGG--KRGIKRRSGG-----QNRGRGPSRRT--GKPRAQT-------RGGIDGKWQH   62 (243)
T ss_pred             CcchhhhhHHHHHHhccc--cCCcCc--cccccccccC-----CccCCCCcccc--Ccccccc-------cCCCCCcccc
Confidence            899999999999995544  111111  1111111111     12233333332  1000000       0114678999


Q ss_pred             --chhhhhhhcCC-CCCCCCCcEEEEeCCCCCCCHHHHHHHhhccCCeeEEEEeeCCCCCCceEEEEEeCChHHHHHHHH
Q 029987           81 --DLFEDSLRAAG-ISGIEVGTKLYVSNLHPGVTNDDIRELFSEIGELKRYAIHFDKNGRPSVSSVACFATFSPLFLWVQ  157 (184)
Q Consensus        81 --~~~~~~~~~~~-~~~~~~~~~l~V~nL~~~vt~~~l~~~F~~~G~v~~v~i~~d~~g~~~G~afV~f~~~~~a~~A~~  157 (184)
                        +.+........ ....+..++|+|.|||+.|+++||+|||..||++..+.|++++.|.+.|+|-|.|...++|.+|  
T Consensus        63 ~~~v~~~~~~~~~~~~~~~~~~~v~v~NL~~~V~~~Dl~eLF~~~~~~~r~~vhy~~~G~s~Gta~v~~~r~~DA~~a--  140 (243)
T KOG0533|consen   63 DRDVFRSAKRLGAVGINETRSTKVNVSNLPYGVIDADLKELFAEFGELKRVAVHYDRAGRSLGTADVSFNRRDDAERA--  140 (243)
T ss_pred             hHHHHhcccccccccccCCCcceeeeecCCcCcchHHHHHHHHHhccceEEeeccCCCCCCCccceeeecchHhHHHH--
Confidence              55554443211 1234445899999999999999999999999999999999999999999999999999999999  


Q ss_pred             HHHhCCCeecCeEEeeCC
Q 029987          158 LKWYMPEEVMHLQLLSDT  175 (184)
Q Consensus       158 i~~l~g~~~~g~~l~~~~  175 (184)
                      +++|+|..+.|+.|.+.-
T Consensus       141 vk~~~gv~ldG~~mk~~~  158 (243)
T KOG0533|consen  141 VKKYNGVALDGRPMKIEI  158 (243)
T ss_pred             HHHhcCcccCCceeeeEE
Confidence            999999988888766543



>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>KOG0121 consensus Nuclear cap-binding protein complex, subunit CBP20 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>KOG0122 consensus Translation initiation factor 3, subunit g (eIF-3g) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0113 consensus U1 small nuclear ribonucleoprotein (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>KOG4207 consensus Predicted splicing factor, SR protein superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0107 consensus Alternative splicing factor SRp20/9G8 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0125 consensus Ataxin 2-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0126 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG0149 consensus Predicted RNA-binding protein SEB4 (RRM superfamily) [General function prediction only] Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>KOG0130 consensus RNA-binding protein RBM8/Tsunagi (RRM superfamily) [General function prediction only] Back     alignment and domain information
>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>KOG0145 consensus RNA-binding protein ELAV/HU (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>KOG0114 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>PLN03213 repressor of silencing 3; Provisional Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>KOG0117 consensus Heterogeneous nuclear ribonucleoprotein R (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>KOG4212 consensus RNA-binding protein hnRNP-M [RNA processing and modification] Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>KOG0131 consensus Splicing factor 3b, subunit 4 [RNA processing and modification] Back     alignment and domain information
>KOG0108 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA15 [RNA processing and modification] Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>KOG0148 consensus Apoptosis-promoting RNA-binding protein TIA-1/TIAR (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0127 consensus Nucleolar protein fibrillarin NOP77 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0148 consensus Apoptosis-promoting RNA-binding protein TIA-1/TIAR (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>KOG0124 consensus Polypyrimidine tract-binding protein PUF60 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0127 consensus Nucleolar protein fibrillarin NOP77 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>KOG0144 consensus RNA-binding protein CUGBP1/BRUNO (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0105 consensus Alternative splicing factor ASF/SF2 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0147 consensus Transcriptional coactivator CAPER (RRM superfamily) [Transcription] Back     alignment and domain information
>KOG0132 consensus RNA polymerase II C-terminal domain-binding protein RA4, contains RPR and RRM domains [RNA processing and modification; Transcription] Back     alignment and domain information
>KOG0117 consensus Heterogeneous nuclear ribonucleoprotein R (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0144 consensus RNA-binding protein CUGBP1/BRUNO (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0109 consensus RNA-binding protein LARK, contains RRM and retroviral-type Zn-finger domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG0111 consensus Cyclophilin-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0145 consensus RNA-binding protein ELAV/HU (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0123 consensus Polyadenylate-binding protein (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>KOG0415 consensus Predicted peptidyl prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>KOG0109 consensus RNA-binding protein LARK, contains RRM and retroviral-type Zn-finger domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG0146 consensus RNA-binding protein ETR-3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG4206 consensus Spliceosomal protein snRNP-U1A/U2B [RNA processing and modification] Back     alignment and domain information
>KOG0131 consensus Splicing factor 3b, subunit 4 [RNA processing and modification] Back     alignment and domain information
>KOG4208 consensus Nucleolar RNA-binding protein NIFK [General function prediction only] Back     alignment and domain information
>KOG4212 consensus RNA-binding protein hnRNP-M [RNA processing and modification] Back     alignment and domain information
>KOG0110 consensus RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0146 consensus RNA-binding protein ETR-3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0123 consensus Polyadenylate-binding protein (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0110 consensus RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0124 consensus Polypyrimidine tract-binding protein PUF60 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0153 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG1548 consensus Transcription elongation factor TAT-SF1 [Transcription] Back     alignment and domain information
>KOG4205 consensus RNA-binding protein musashi/mRNA cleavage and polyadenylation factor I complex, subunit HRP1 [RNA processing and modification] Back     alignment and domain information
>KOG4209 consensus Splicing factor RNPS1, SR protein superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0106 consensus Alternative splicing factor SRp55/B52/SRp75 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG4661 consensus Hsp27-ERE-TATA-binding protein/Scaffold attachment factor (SAF-B) [Transcription] Back     alignment and domain information
>KOG0151 consensus Predicted splicing regulator, contains RRM, SWAP and RPR domains [General function prediction only] Back     alignment and domain information
>KOG0116 consensus RasGAP SH3 binding protein rasputin, contains NTF2 and RRM domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG4454 consensus RNA binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0105 consensus Alternative splicing factor ASF/SF2 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG4660 consensus Protein Mei2, essential for commitment to meiosis, and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0226 consensus RNA-binding proteins [General function prediction only] Back     alignment and domain information
>KOG4205 consensus RNA-binding protein musashi/mRNA cleavage and polyadenylation factor I complex, subunit HRP1 [RNA processing and modification] Back     alignment and domain information
>PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2 Back     alignment and domain information
>KOG1995 consensus Conserved Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG0147 consensus Transcriptional coactivator CAPER (RRM superfamily) [Transcription] Back     alignment and domain information
>KOG1457 consensus RNA binding protein (contains RRM repeats) [General function prediction only] Back     alignment and domain information
>KOG4211 consensus Splicing factor hnRNP-F and related RNA-binding proteins [RNA processing and modification] Back     alignment and domain information
>KOG4211 consensus Splicing factor hnRNP-F and related RNA-binding proteins [RNA processing and modification] Back     alignment and domain information
>KOG0120 consensus Splicing factor U2AF, large subunit (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG4307 consensus RNA binding protein RBM12/SWAN [General function prediction only] Back     alignment and domain information
>KOG0106 consensus Alternative splicing factor SRp55/B52/SRp75 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG1457 consensus RNA binding protein (contains RRM repeats) [General function prediction only] Back     alignment and domain information
>PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation Back     alignment and domain information
>PF11608 Limkain-b1: Limkain b1; InterPro: IPR024582 This entry represents a conserved domain found in limkain b1, which is a novel human autoantigen, localised to a subset of ABCD3 and PXF marked peroxisomes Back     alignment and domain information
>KOG1190 consensus Polypyrimidine tract-binding protein [RNA processing and modification] Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG1456 consensus Heterogeneous nuclear ribonucleoprotein L (contains RRM repeats) [RNA processing and modification] Back     alignment and domain information
>KOG4210 consensus Nuclear localization sequence binding protein [Transcription] Back     alignment and domain information
>KOG4849 consensus mRNA cleavage factor I subunit/CPSF subunit [RNA processing and modification] Back     alignment and domain information
>KOG4206 consensus Spliceosomal protein snRNP-U1A/U2B [RNA processing and modification] Back     alignment and domain information
>KOG1365 consensus RNA-binding protein Fusilli, contains RRM domain [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG4676 consensus Splicing factor, arginine/serine-rich [RNA processing and modification] Back     alignment and domain information
>PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif Back     alignment and domain information
>KOG1456 consensus Heterogeneous nuclear ribonucleoprotein L (contains RRM repeats) [RNA processing and modification] Back     alignment and domain information
>KOG3152 consensus TBP-binding protein, activator of basal transcription (contains rrm motif) [Transcription] Back     alignment and domain information
>KOG1548 consensus Transcription elongation factor TAT-SF1 [Transcription] Back     alignment and domain information
>KOG0129 consensus Predicted RNA-binding protein (RRM superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF07078 FYTT: Forty-two-three protein; InterPro: IPR009782 This family consists of several hypothetical mammalian proteins of around 320 residues in length Back     alignment and domain information
>KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG1855 consensus Predicted RNA-binding protein [General function prediction only] Back     alignment and domain information
>KOG0120 consensus Splicing factor U2AF, large subunit (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0129 consensus Predicted RNA-binding protein (RRM superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1365 consensus RNA-binding protein Fusilli, contains RRM domain [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PF08675 RNA_bind: RNA binding domain; InterPro: IPR014789 This domain corresponds to the RNA binding domain of Poly(A)-specific ribonuclease (PARN) Back     alignment and domain information
>KOG0115 consensus RNA-binding protein p54nrb (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG1190 consensus Polypyrimidine tract-binding protein [RNA processing and modification] Back     alignment and domain information
>KOG4307 consensus RNA binding protein RBM12/SWAN [General function prediction only] Back     alignment and domain information
>PF08952 DUF1866: Domain of unknown function (DUF1866) ; InterPro: IPR015047 This domain, found in synaptojanin, has no known function Back     alignment and domain information
>PF10309 DUF2414: Protein of unknown function (DUF2414); InterPro: IPR019416 This entry contains proteins that have no known function Back     alignment and domain information
>PF15023 DUF4523: Protein of unknown function (DUF4523) Back     alignment and domain information
>PF03467 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 Nonsense-mediated mRNA decay (NMD) is a surveillance mechanism by which eukaryotic cells detect and degrade transcripts containing premature termination codons Back     alignment and domain information
>KOG2193 consensus IGF-II mRNA-binding protein IMP, contains RRM and KH domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG2416 consensus Acinus (induces apoptotic chromatin condensation) [Chromatin structure and dynamics] Back     alignment and domain information
>PF05172 Nup35_RRM: Nup53/35/40-type RNA recognition motif; InterPro: IPR007846 The MPPN (Mitotic PhosphoProtein N end) family is uncharacterised however it probably plays a role in the cell cycle because the family includes mitotic phosphoproteins O13026 from SWISSPROT [] Back     alignment and domain information
>KOG2202 consensus U2 snRNP splicing factor, small subunit, and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG1996 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG0112 consensus Large RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG2591 consensus c-Mpl binding protein, contains La domain [Signal transduction mechanisms] Back     alignment and domain information
>PF11767 SET_assoc: Histone lysine methyltransferase SET associated; InterPro: IPR024636 The SET domain is a protein-protein interaction domain found in protein lysine methyltransferase enzymes Back     alignment and domain information
>KOG0112 consensus Large RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG2068 consensus MOT2 transcription factor [Transcription] Back     alignment and domain information
>PF07576 BRAP2: BRCA1-associated protein 2; InterPro: IPR011422 These proteins include BRCA1-associated protein 2 (BRAP2), which binds nuclear localisation signals (NLSs) in vitro and in yeast two-hybrid screening [] Back     alignment and domain information
>PF04847 Calcipressin: Calcipressin; InterPro: IPR006931 Calcipressin 1 negatively regulates calcineurin (IPR015757 from INTERPRO) by direct binding and is essential for the survival of T helper type 1 cells Back     alignment and domain information
>KOG4660 consensus Protein Mei2, essential for commitment to meiosis, and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF03880 DbpA: DbpA RNA binding domain ; InterPro: IPR005580 This RNA binding domain is found at the C terminus of a number of DEAD helicase proteins [] Back     alignment and domain information
>KOG2135 consensus Proteins containing the RNA recognition motif [General function prediction only] Back     alignment and domain information
>KOG4210 consensus Nuclear localization sequence binding protein [Transcription] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>KOG2253 consensus U1 snRNP complex, subunit SNU71 and related PWI-motif proteins [RNA processing and modification] Back     alignment and domain information
>KOG4410 consensus 5-formyltetrahydrofolate cyclo-ligase [Coenzyme transport and metabolism] Back     alignment and domain information
>KOG4285 consensus Mitotic phosphoprotein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4454 consensus RNA binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG4574 consensus RNA-binding protein (contains RRM and Pumilio-like repeats) [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query184
2f3j_A177 The Solution Structure Of The Ref2-I Mrna Export Fa 9e-14
2kt5_A124 Rrm Domain Of Mrna Export Adaptor Ref2-I Bound To H 4e-12
2yka_A124 Rrm Domain Of Mrna Export Adaptor Ref2-I Bound To H 4e-12
1no8_A106 Solution Structure Of The Nuclear Factor Aly Rbd Do 2e-09
3ulh_A107 Crystal Structure Of A Rna Binding Domain Of Tho Co 3e-09
>pdb|2F3J|A Chain A, The Solution Structure Of The Ref2-I Mrna Export Factor (Residues 1-155) Length = 177 Back     alignment and structure

Iteration: 1

Score = 72.8 bits (177), Expect = 9e-14, Method: Compositional matrix adjust. Identities = 50/139 (35%), Positives = 66/139 (47%), Gaps = 28/139 (20%) Query: 1 MATHVDMSLDDIIKSRKKSEXXXXXXXXXXXXXXXXXXXXXXXXXXMTGAARRGPLSNAR 60 MA +DMSLDDIIK + G RR + AR Sbjct: 15 MADKMDMSLDDIIKLNRNQRRVNR-----------------------GGGPRRNRPAIAR 51 Query: 61 PSSYTIAKSFRRTRNFP--WQHDLFEDSLRAAGISGIEVGTKLYVSNLHPGVTNDDIREL 118 A + R + P WQHDLF+ G G+E G KL VSNL GV++ DI+EL Sbjct: 52 GGRNRPA-PYSRPKPLPDKWQHDLFDSG--CGGGEGVETGAKLLVSNLDFGVSDADIQEL 108 Query: 119 FSEIGELKRYAIHFDKNGR 137 F+E G LK+ A+ +D++GR Sbjct: 109 FAEFGTLKKAAVDYDRSGR 127
>pdb|2KT5|A Chain A, Rrm Domain Of Mrna Export Adaptor Ref2-I Bound To Hsv-1 Icp27 Peptide Length = 124 Back     alignment and structure
>pdb|2YKA|A Chain A, Rrm Domain Of Mrna Export Adaptor Ref2-I Bound To Hvs Orf57 Peptide Length = 124 Back     alignment and structure
>pdb|1NO8|A Chain A, Solution Structure Of The Nuclear Factor Aly Rbd Domain Length = 106 Back     alignment and structure
>pdb|3ULH|A Chain A, Crystal Structure Of A Rna Binding Domain Of Tho Complex Subunit 4 Protein (Thoc4) From Homo Sapiens At 2.54 A Resolution Length = 107 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query184
2f3j_A177 RNA and export factor binding protein 2; RRM domai 100.0
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 99.88
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 99.86
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 99.85
2kt5_A124 RNA and export factor-binding protein 2; chaperone 99.84
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 99.81
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 99.81
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 99.81
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 99.81
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 99.81
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 99.81
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 99.81
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 99.81
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 99.81
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 99.8
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 99.8
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 99.8
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 99.8
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.8
2la6_A99 RNA-binding protein FUS; structural genomics, nort 99.8
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 99.8
3p5t_L90 Cleavage and polyadenylation specificity factor S; 99.8
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.8
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 99.8
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 99.8
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 99.8
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 99.8
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 99.8
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 99.79
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 99.79
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 99.79
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 99.79
1x4e_A85 RNA binding motif, single-stranded interacting pro 99.79
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 99.79
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 99.79
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 99.79
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 99.79
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 99.79
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 99.79
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 99.79
2div_A99 TRNA selenocysteine associated protein; structural 99.79
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 99.79
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.79
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 99.78
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 99.78
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 99.78
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 99.78
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 99.78
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 99.78
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 99.78
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 99.78
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 99.78
2cph_A107 RNA binding motif protein 19; RNA recognition moti 99.78
3n9u_C156 Cleavage and polyadenylation specificity factor S; 99.78
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 99.78
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 99.78
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 99.78
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 99.78
2cqd_A116 RNA-binding region containing protein 1; RNA recog 99.78
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 99.78
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 99.78
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 99.77
2krb_A81 Eukaryotic translation initiation factor 3 subunit 99.77
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 99.77
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 99.77
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 99.77
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 99.77
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 99.77
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 99.77
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 99.77
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 99.77
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 99.76
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 99.76
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 99.76
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 99.76
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 99.76
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 99.76
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 99.76
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 99.76
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 99.76
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 99.76
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 99.76
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 99.75
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 99.75
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 99.75
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 99.75
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 99.75
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 99.75
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 99.75
1x5o_A114 RNA binding motif, single-stranded interacting pro 99.75
3q2s_C229 Cleavage and polyadenylation specificity factor S; 99.75
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 99.74
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 99.74
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 99.74
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 99.74
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 99.74
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 99.74
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 99.74
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 99.74
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 99.74
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 99.74
2dis_A109 Unnamed protein product; structural genomics, RRM 99.74
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 99.74
4f02_A 213 Polyadenylate-binding protein 1; mRNA, eukaryotic 99.74
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 99.73
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 99.73
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 99.73
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 99.73
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 99.73
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.72
2j8a_A136 Histone-lysine N-methyltransferase, H3 lysine-4 sp 99.72
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 99.72
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 99.72
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 99.72
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 99.72
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 99.72
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 99.72
2cpj_A99 Non-POU domain-containing octamer-binding protein; 99.72
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 99.72
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 99.71
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 99.71
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.71
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 99.71
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 99.71
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 99.71
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.71
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 99.71
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 99.71
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 99.71
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 99.7
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 99.7
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 99.7
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 99.7
3pgw_S 437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 99.7
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 99.7
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 99.7
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 99.7
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 99.7
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 99.69
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 99.69
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 99.53
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 99.69
2dnl_A114 Cytoplasmic polyadenylation element binding protei 99.69
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 99.69
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 99.69
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 99.69
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.69
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.69
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 99.68
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 99.68
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 99.68
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 99.68
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.68
2i2y_A150 Fusion protein consists of immunoglobin G- binding 99.67
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.67
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 99.67
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 99.66
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 99.66
1x5p_A97 Negative elongation factor E; structure genomics, 99.66
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.65
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 99.65
2qfj_A 216 FBP-interacting repressor; protein-DNA complex; HE 99.65
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 99.65
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 99.64
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 99.63
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 99.63
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 99.63
3tyt_A 205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.63
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 99.63
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 99.62
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 99.62
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 99.62
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.61
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 99.61
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.61
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 99.61
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 99.6
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 99.6
3pgw_A 282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.59
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 99.59
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 99.57
2adc_A 229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.57
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.56
3smz_A 284 Protein raver-1, ribonucleoprotein PTB-binding 1; 99.56
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.54
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 99.54
2ghp_A 292 U4/U6 snRNA-associated splicing factor PRP24; RNA 99.54
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 99.53
3sde_A 261 Paraspeckle component 1; RRM, anti parallel right 99.53
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.52
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.52
1qm9_A 198 Polypyrimidine tract-binding protein; ribonucleopr 99.51
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 99.51
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 99.51
2dit_A112 HIV TAT specific factor 1 variant; structural geno 99.5
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.5
2yh0_A 198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.47
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 99.47
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 99.45
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.45
3tht_A 345 Alkylated DNA repair protein ALKB homolog 8; struc 99.42
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 99.4
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 99.3
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 99.27
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 99.25
2dnr_A91 Synaptojanin-1; RRM domain, RBD, structural genomi 99.1
1ufw_A95 Synaptojanin 2; RNP domain, structural genomics, r 98.94
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 98.79
2l9w_A117 U4/U6 snRNA-associated-splicing factor PRP24; RRM, 98.51
2dhx_A104 Poly (ADP-ribose) polymerase family, member 10 var 98.0
1wey_A104 Calcipressin 1; structural genomics, RRM domain, r 97.85
1uw4_A91 UPF3X; nonsense mediated mRNA decay protein, RNA-b 97.83
1whv_A100 Poly(A)-specific ribonuclease; RNA recognition mot 97.52
3ctr_A101 Poly(A)-specific ribonuclease PARN; protein-RNA-co 97.14
1wwh_A119 Nucleoporin 35, nucleoporin; structural genomics, 96.96
2l08_A97 Regulator of nonsense transcripts 3A; NESG, nonsen 96.71
2kn4_A 158 Immunoglobulin G-binding protein G, splicing FACT 96.0
3pq1_A 464 Poly(A) RNA polymerase; nucleotidyl transferase, R 95.68
2i2y_A150 Fusion protein consists of immunoglobin G- binding 93.21
3p3d_A132 Nucleoporin 53; structural genomics, PSI-2, protei 93.14
3d45_A507 Poly(A)-specific ribonuclease PARN; CAP analogue, 91.86
1b34_A119 Protein (small nuclear ribonucleoprotein SM D1); s 89.76
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
Probab=100.00  E-value=9.1e-34  Score=218.40  Aligned_cols=149  Identities=36%  Similarity=0.539  Sum_probs=114.1

Q ss_pred             CCCCCCCCHHHHHhhcCCCCcCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCccccccccCCCCCCCCc
Q 029987            1 MATHVDMSLDDIIKSRKKSERERGQGRARRGRGRGRGPSGSVSGGRMTGAARRGPLSNARPSSYTIAKSFRRTRNFPWQH   80 (184)
Q Consensus         1 m~~~ld~sLddii~~~~~~~r~~~~~~~~~g~~~g~g~g~~~~~~~g~g~~r~~~~~~~r~~~~~~~~~~rr~~~~~~~~   80 (184)
                      ||++|||||||||++.++..+      ++++++++++            +.++.+.+..|+.||.+++    .....|+|
T Consensus        15 m~~~ld~sLDdii~~~r~~~r------~~r~~~~r~~------------~~~~~~~g~~r~~~y~~~~----~~~~~w~~   72 (177)
T 2f3j_A           15 MADKMDMSLDDIIKLNRNQRR------VNRGGGPRRN------------RPAIARGGRNRPAPYSRPK----PLPDKWQH   72 (177)
T ss_dssp             CCCSSSCCHHHHHHHHHTCCS------CSSSCCSSSS------------SCCCTTTSSTTTCCSSSCC----CCTTCSSC
T ss_pred             hhhhhccCHHHHHhhcccCCC------CCCCCCCCCC------------CCCCCCCCcCCCCCCCCCc----Cccccccc
Confidence            899999999999995433221      1111110000            1111112245566777543    46788999


Q ss_pred             chhhhhhhcCCCCCCCCCcEEEEeCCCCCCCHHHHHHHhhccCCeeEEEEeeCCCCCCceEEEEEeCChHHHHHHHHHHH
Q 029987           81 DLFEDSLRAAGISGIEVGTKLYVSNLHPGVTNDDIRELFSEIGELKRYAIHFDKNGRPSVSSVACFATFSPLFLWVQLKW  160 (184)
Q Consensus        81 ~~~~~~~~~~~~~~~~~~~~l~V~nL~~~vt~~~l~~~F~~~G~v~~v~i~~d~~g~~~G~afV~f~~~~~a~~A~~i~~  160 (184)
                      +.|++..  .......+.++|||+|||+.+++++|+++|++||+|..|.|+.++++.++|||||+|.+.++|++|  |+.
T Consensus        73 d~~~~~~--~~~~~~~~~~~l~V~nLp~~~te~~L~~~F~~~G~I~~v~i~~d~~g~~kG~afV~F~~~~~A~~A--i~~  148 (177)
T 2f3j_A           73 DLFDSGC--GGGEGVETGAKLLVSNLDFGVSDADIQELFAEFGTLKKAAVDYDRSGRSLGTADVHFERRADALKA--MKQ  148 (177)
T ss_dssp             SSSCSSC--CCCSSCTTCEEEEEECCCSCCCHHHHHHHHHHTSCCSEEEECCCTTSSCSCCEEEEESCHHHHHHH--HHH
T ss_pred             ccccccc--CCCCCCCCCCEEEEeCCCCCCCHHHHHHHHHhcCCeEEEEEEECCCCCEeeEEEEEeCCHHHHHHH--HHH
Confidence            9998765  334566778999999999999999999999999999999999999999999999999999999999  999


Q ss_pred             hCCCeecCeEEeeCC
Q 029987          161 YMPEEVMHLQLLSDT  175 (184)
Q Consensus       161 l~g~~~~g~~l~~~~  175 (184)
                      |||..|.++.|.|.-
T Consensus       149 lng~~l~Gr~l~V~~  163 (177)
T 2f3j_A          149 YKGVPLDGRPMDIQL  163 (177)
T ss_dssp             STTCBCSSSBCEEEE
T ss_pred             hCCCEECCEEEEEEE
Confidence            999999999887753



>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wey_A Calcipressin 1; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1uw4_A UPF3X; nonsense mediated mRNA decay protein, RNA-binding protein, N domain, MIF4G domain; 1.95A {Homo sapiens} SCOP: d.58.7.4 Back     alignment and structure
>1whv_A Poly(A)-specific ribonuclease; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, PARN, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2rok_A* Back     alignment and structure
>3ctr_A Poly(A)-specific ribonuclease PARN; protein-RNA-complex, M7G-CAP, M7GTP, RNA recognition motif, RRM, cytoplasm, exonuclease, hydrolase, magnesium; HET: MGP; 2.10A {Homo sapiens} Back     alignment and structure
>1wwh_A Nucleoporin 35, nucleoporin; structural genomics, MPPN, riken structural genomics/proteomics initiative, RSGI, protein transport; 2.70A {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2l08_A Regulator of nonsense transcripts 3A; NESG, nonsense regulator, structural genomics, PSI-2, protei structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>3pq1_A Poly(A) RNA polymerase; nucleotidyl transferase, RNP-type RNA binding domain, poly(A polymerase, mitochondria, transferase; 3.10A {Homo sapiens} Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>3p3d_A Nucleoporin 53; structural genomics, PSI-2, protein structure initiative, NE structural genomix research consortium, nysgxrc; 2.35A {Pichia guilliermondii} Back     alignment and structure
>3d45_A Poly(A)-specific ribonuclease PARN; CAP analogue, exonuclease, hydrolase, magnesium, metal nonsense-mediated mRNA decay, nucleus; HET: 7MG GDP; 3.00A {Mus musculus} Back     alignment and structure
>1b34_A Protein (small nuclear ribonucleoprotein SM D1); snRNP, splicing, spliceosome, core snRNP domain, systemi erythematosus, SLE, RNA binding protein; 2.50A {Homo sapiens} SCOP: b.38.1.1 PDB: 2y9a_B 2y9b_B 2y9c_B 2y9d_B 3cw1_B 3pgw_X* 3s6n_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 184
d1b7fa285 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophil 1e-07
d2cpha194 d.58.7.1 (A:454-547) Probable RNA-binding protein 2e-07
d1no8a_78 d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus muscu 2e-07
d1fxla285 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Ho 8e-07
d1b7fa182 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophil 9e-07
d1uawa_77 d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [Tax 1e-06
d1h2vz_93 d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding pro 1e-06
d1x0fa175 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 2e-06
d1hd0a_75 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 2e-06
d2cqga190 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TD 2e-06
d1cvja180 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human 3e-06
d2cqca183 d.58.7.1 (A:109-191) Arginine/serine-rich splicing 8e-06
d1x4ga196 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo s 1e-05
d1u1qa_183 d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 2e-05
d2disa196 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 { 2e-05
d1x5ua193 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Hu 2e-05
d2cpfa185 d.58.7.1 (A:362-446) Probable RNA-binding protein 2e-05
d1l3ka184 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RN 5e-05
d2f9da1114 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p 5e-05
d2ghpa181 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splici 7e-05
d2cq3a193 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human 8e-05
d2cq4a1101 d.58.7.1 (A:132-232) RNA binding protein 23 {Human 9e-05
d1rk8a_88 d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Dr 9e-05
d2adba1108 d.58.7.1 (A:177-284) Polypyrimidine tract-binding 9e-05
d2msta_75 d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 1e-04
d2cq0a190 d.58.7.1 (A:231-320) Eukaryotic translation initia 1e-04
d1fxla182 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Hom 1e-04
d2cqia190 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sa 1e-04
d1wf2a_98 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 2e-04
d1x4ba1103 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucle 2e-04
d2cpza1102 d.58.7.1 (A:383-484) CUG triplet repeat RNA-bindin 3e-04
d1cvja289 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human 3e-04
d1x5ta183 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Hu 4e-04
d2cpja186 d.58.7.1 (A:65-150) Non-POU domain-containing octa 4e-04
d2cqba189 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomer 5e-04
d1l3ka279 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 5e-04
d1x4aa195 d.58.7.1 (A:9-103) Splicing factor, arginine/serin 6e-04
d2cqha180 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 is 9e-04
d1whwa_99 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 9e-04
d2cpea1101 d.58.7.1 (A:353-453) RNA-binding protein EWS {Huma 0.001
d1zh5a285 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo 0.001
d1x4ha198 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse ( 0.001
d2u2fa_85 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 0.002
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 d.58.7.3 (A:) 0.003
d1fjca_96 d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocrice 0.003
d1u2fa_90 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 0.004
d2cqda1103 d.58.7.1 (A:1-103) RNA-binding region containing p 0.004
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 85 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Sex-lethal protein
species: Drosophila melanogaster [TaxId: 7227]
 Score = 45.3 bits (107), Expect = 1e-07
 Identities = 14/53 (26%), Positives = 24/53 (45%), Gaps = 2/53 (3%)

Query: 98  GTKLYVSNLHPGVTNDDIRELFSEIGELKRYAIHFDKNGRPSVSSVACFATFS 150
            T LYV+NL   +T+D +  +F + G + +  I  DK           F  ++
Sbjct: 6   DTNLYVTNLPRTITDDQLDTIFGKYGSIVQKNILRDKLTGRPRGV--AFVRYN 56


>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 82 Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 81 Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 88 Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 96 Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query184
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 99.86
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.85
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 99.85
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 99.85
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 99.85
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 99.85
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.85
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 99.84
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.83
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 99.83
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.83
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 99.83
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 99.83
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.83
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.82
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 99.82
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.82
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.82
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 99.81
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 99.81
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.81
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 99.81
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 99.81
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 99.81
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.81
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.81
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 99.81
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 99.8
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 99.8
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 99.8
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.8
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.8
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 99.79
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.79
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.79
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.79
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 99.79
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 99.79
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 99.78
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 99.78
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 99.78
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 99.78
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 99.77
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.77
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.77
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.77
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.77
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.75
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 99.75
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 99.75
d2cpja186 Non-POU domain-containing octamer-binding protein, 99.75
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.75
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 99.74
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.74
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 99.73
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.73
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 99.73
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 99.73
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 99.72
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.72
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 99.72
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 99.72
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 99.72
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 99.72
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 99.71
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.71
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 99.7
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 99.7
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 99.69
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 99.69
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 99.68
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 99.68
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.68
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 99.67
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 99.63
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.63
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.61
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 99.61
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.6
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.58
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 99.58
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 99.57
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.53
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.49
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 99.39
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 99.37
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.28
d1uw4a_91 RNA processing protein UPF3x, RRM domain {Human (H 97.89
d1ufwa_95 Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606] 97.36
d2dgxa173 Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 960 97.2
d1whva_100 Poly(A)-specific ribonuclease PARN {Mouse (Mus mus 96.63
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Arginine/serine-rich splicing factor 10
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.86  E-value=1.2e-21  Score=130.96  Aligned_cols=76  Identities=20%  Similarity=0.150  Sum_probs=72.3

Q ss_pred             CCCcEEEEeCCCCCCCHHHHHHHhhccCCeeEEEEeeCC-CCCCceEEEEEeCChHHHHHHHHHHHhCCCeecCeEEee
Q 029987           96 EVGTKLYVSNLHPGVTNDDIRELFSEIGELKRYAIHFDK-NGRPSVSSVACFATFSPLFLWVQLKWYMPEEVMHLQLLS  173 (184)
Q Consensus        96 ~~~~~l~V~nL~~~vt~~~l~~~F~~~G~v~~v~i~~d~-~g~~~G~afV~f~~~~~a~~A~~i~~l~g~~~~g~~l~~  173 (184)
                      ++.++|||+|||+++|+++|+++|++||+|.+|.|+.++ +++++|||||+|.+.++|++|  |+.|||..+.|++|.|
T Consensus         7 ~~~~~l~V~nL~~~~te~~l~~~F~~~G~i~~v~i~~~~~~~~~~g~afV~f~~~~~A~~A--i~~l~g~~~~gr~i~V   83 (83)
T d2cqca1           7 DPNCCLGVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVDDAKEA--KERANGMELDGRRIRV   83 (83)
T ss_dssp             CGGGCEEEESCCSSCCHHHHHHHHHTTSCEEEEEEEECSSSSSEEEEEEEEESSHHHHHHH--HHHHTTEEETTEEEEE
T ss_pred             CCCCEEEEeCCCCCCCHHHHHHHHHHhCCCccccccccccccccccceEEEECCHHHHHHH--HHHcCCCEECCEEeEC
Confidence            456799999999999999999999999999999999998 899999999999999999999  9999999999999876



>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uw4a_ d.58.7.4 (A:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufwa_ d.58.7.1 (A:) Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dgxa1 d.58.7.1 (A:563-635) Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whva_ d.58.7.1 (A:) Poly(A)-specific ribonuclease PARN {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure