Citrus Sinensis ID: 030014

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180----
MGTPKRRLAVLSSHLLPTGPAPCSSSSGVSASFCAQQRLSHSQESGHENDCVFCKIIRGESPAVKLYEYDTCLCILDTNPLSLGHSLIVPKSHFSCLDATPPSVVAAMCAKVPLISNAIMKATDAGMCQIFYTAVTTKLSHSHLPLFFLPSYSLGFLALSCIKSATGWGYFGIVNVISVMSHGQ
ccccHHHHHHHHHccccccccccccccccccccccccccccccccccccccHHHHHHcccccccEEEEcccEEEEEcccccccccEEEcccccccccccccHHHHHHHHHHHHHHHHHHHHHccccEEEEEEcccccccEEEEEcEEEcccccccccccccccccccccHHHHHHHHHHHHccc
ccccHHHHHHHHccccccccccccccccccccHHHHHHHHHHcccccccccHHHHHHcccccccEEEEcccEEEEEcccccccEEEEEEEccccccHHHccHHHHHHHHHHHHHHHHHHHHHcccccEEEEccccccccEEEEEEEEEEEccccccccEEEEEccccccEEEEEEEEEEEcccc
MGTPKRRLAVLSshllptgpapcssssgvsasfCAQQrlshsqesghendcVFCKiirgespavklyeydtclcildtnplslghslivpkshfscldatppsVVAAMCAKVPLISNAIMKATDAGMCQIFYTAVTTklshshlplfflpsyslgFLALSCIKSATGWGYFGIVNVISVMSHGQ
MGTPKRRLAVLSSHLLPTGPAPCSSSSGVSASFCAQQRLShsqesghenDCVFCKIIRGESPAVKLYEYDTCLCILDTNPLSLGHSLIVPKSHFSCLDATPPSVVAAMCAKVPLISNAIMKATDAGMCQIFYTAVTTKLSHSHLPLFFLPSYSLGFLALSCIKSATGWGYFGIVNVISVMSHGQ
MGTPKRRLAVLSSHLLPTGPAPCssssgvsasFCAQQRLSHSQESGHENDCVFCKIIRGESPAVKLYEYDTCLCILDTNPLSLGHSLIVPKSHFSCLDATPPSVVAAMCAKVPLISNAIMKATDAGMCQIFYTAVTTKLSHSHLPLFFLPSYSLGFLALSCIKSATGWGYFGIVNVISVMSHGQ
************************************************NDCVFCKIIRGESPAVKLYEYDTCLCILDTNPLSLGHSLIVPKSHFSCLDATPPSVVAAMCAKVPLISNAIMKATDAGMCQIFYTAVTTKLSHSHLPLFFLPSYSLGFLALSCIKSATGWGYFGIVNVISV*****
*****RR**VLSSHLLP*********************************CVFCKIIRGESPAVKLYEYDTCLCILDTNPLSLGHSLIVPKSHFSCLDATPPSVVAAMCAKVPLISNAIMKATDAGMCQIFYTAVTTKLSHSHLPLFFLPSYSLGFLALSCIKSATGWGYFGIVNVISVMS***
MGTPKRRLAVLSSHLLPT****************************HENDCVFCKIIRGESPAVKLYEYDTCLCILDTNPLSLGHSLIVPKSHFSCLDATPPSVVAAMCAKVPLISNAIMKATDAGMCQIFYTAVTTKLSHSHLPLFFLPSYSLGFLALSCIKSATGWGYFGIVNVISVMSHGQ
********AV**S*LLPT***************************GHENDCVFCKIIRGESPAVKLYEYDTCLCILDTNPLSLGHSLIVPKSHFSCLDATPPSVVAAMCAKVPLISNAIMKATDAGMCQIFYTAVTTKLSHSHLPLFFLPSYSLGFLALSCIKSATGWGYFGIVNVISVMS***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGTPKRRLAVLSSHLLPTGPAPCSSSSGVSASFCAQQRLSHSQESGHENDCVFCKIIRGESPAVKLYEYDTCLCILDTNPLSLGHSLIVPKSHFSCLDATPPSVVAAMCAKVPLISNAIMKATDAGMCQIFYTAVTTKLSHSHLPLFFLPSYSLGFLALSCIKSATGWGYFGIVNVISVMSHGQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query184 2.2.26 [Sep-21-2011]
Q11066144 Uncharacterized HIT-like yes no 0.369 0.472 0.470 2e-11
P94252139 Uncharacterized HIT-like yes no 0.375 0.496 0.453 3e-11
Q58276129 Uncharacterized HIT-like yes no 0.559 0.798 0.310 2e-10
O66536121 Uncharacterized HIT-like yes no 0.304 0.462 0.482 9e-10
Q9CPS6165 Histidine triad nucleotid yes no 0.728 0.812 0.301 8e-09
O07513145 Protein hit OS=Bacillus s yes no 0.576 0.731 0.289 1e-08
P95937139 Uncharacterized HIT-like yes no 0.440 0.582 0.320 7e-08
Q8K3P7175 Histidine triad nucleotid yes no 0.673 0.708 0.298 2e-07
O07817107 Protein HitA OS=Neisseria yes no 0.451 0.775 0.347 2e-07
O94586133 Hit family protein 1 OS=S yes no 0.233 0.323 0.511 2e-06
>sp|Q11066|YHI2_MYCTU Uncharacterized HIT-like protein Rv1262c/MT1300 OS=Mycobacterium tuberculosis GN=Rv1262c PE=4 SV=2 Back     alignment and function desciption
 Score = 68.9 bits (167), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 42/68 (61%)

Query: 51  CVFCKIIRGESPAVKLYEYDTCLCILDTNPLSLGHSLIVPKSHFSCLDATPPSVVAAMCA 110
           CVFC II GE+PA+++YE    L ILD  P + GH+L++PK H   L  TPP  +A M A
Sbjct: 3   CVFCAIIAGEAPAIRIYEDGGYLAILDIRPFTRGHTLVLPKRHTVDLTDTPPEALADMVA 62

Query: 111 KVPLISNA 118
               I+ A
Sbjct: 63  IGQRIARA 70

Mycobacterium tuberculosis (taxid: 1773)
>sp|P94252|YHIT_BORBU Uncharacterized HIT-like protein BB_0379 OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=BB_0379 PE=4 SV=1 Back     alignment and function description
>sp|Q58276|Y866_METJA Uncharacterized HIT-like protein MJ0866 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0866 PE=4 SV=2 Back     alignment and function description
>sp|O66536|YHIT_AQUAE Uncharacterized HIT-like protein aq_141 OS=Aquifex aeolicus (strain VF5) GN=aq_141 PE=4 SV=1 Back     alignment and function description
>sp|Q9CPS6|HINT3_MOUSE Histidine triad nucleotide-binding protein 3 OS=Mus musculus GN=Hint3 PE=2 SV=1 Back     alignment and function description
>sp|O07513|HIT_BACSU Protein hit OS=Bacillus subtilis (strain 168) GN=hit PE=1 SV=1 Back     alignment and function description
>sp|P95937|YHIT_SULSO Uncharacterized HIT-like protein SSO2163 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=SSO2163 PE=4 SV=1 Back     alignment and function description
>sp|Q8K3P7|HINT3_RAT Histidine triad nucleotide-binding protein 3 OS=Rattus norvegicus GN=Hint3 PE=2 SV=2 Back     alignment and function description
>sp|O07817|HITA_NEIGO Protein HitA OS=Neisseria gonorrhoeae GN=hitA PE=4 SV=1 Back     alignment and function description
>sp|O94586|HNT1_SCHPO Hit family protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hnt1 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query184
356527308207 PREDICTED: uncharacterized HIT-like prot 0.657 0.584 0.666 7e-35
217071270129 unknown [Medicago truncatula] 0.663 0.945 0.598 4e-33
388507958220 unknown [Medicago truncatula] 0.608 0.509 0.630 1e-32
42573622197 protein histidine triad nucleotide-bindi 0.641 0.598 0.638 1e-32
217071638134 unknown [Medicago truncatula] 0.608 0.835 0.630 3e-32
224069894190 predicted protein [Populus trichocarpa] 0.641 0.621 0.613 5e-32
297792041198 histidine triad family protein [Arabidop 0.641 0.595 0.633 5e-32
449458428208 PREDICTED: uncharacterized HIT-like prot 0.641 0.567 0.596 9e-32
255585620214 histidine triad (hit) protein, putative 0.657 0.565 0.583 6e-31
118488050197 unknown [Populus trichocarpa] 0.423 0.395 0.782 3e-29
>gi|356527308|ref|XP_003532253.1| PREDICTED: uncharacterized HIT-like protein BB_0379-like [Glycine max] Back     alignment and taxonomy information
 Score =  152 bits (383), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 84/126 (66%), Positives = 93/126 (73%), Gaps = 5/126 (3%)

Query: 1   MGTPKRRLAVLSSHLLPTG--PAPCSSSS-GVSASFCAQQRLSHSQESGHENDCVFCKII 57
           M    RRLAVL +HL PT   P P SS    ++ S CA    S +Q    +NDCVFCKII
Sbjct: 1   MSVEARRLAVLCAHLNPTRLLPDPPSSPRVSLTGSACASD--SDTQNHTLQNDCVFCKII 58

Query: 58  RGESPAVKLYEYDTCLCILDTNPLSLGHSLIVPKSHFSCLDATPPSVVAAMCAKVPLISN 117
           R +SPAVKLYE D CLCILDT+PLS GHSLI+PKSHF  LDATPPSVVAAMC+KVP ISN
Sbjct: 59  RDQSPAVKLYEDDMCLCILDTSPLSHGHSLIIPKSHFPSLDATPPSVVAAMCSKVPFISN 118

Query: 118 AIMKAT 123
           AIMKAT
Sbjct: 119 AIMKAT 124

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|217071270|gb|ACJ83995.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|388507958|gb|AFK42045.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|42573622|ref|NP_974907.1| protein histidine triad nucleotide-binding 3 [Arabidopsis thaliana] gi|332008302|gb|AED95685.1| protein histidine triad nucleotide-binding 3 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|217071638|gb|ACJ84179.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|224069894|ref|XP_002303075.1| predicted protein [Populus trichocarpa] gi|222844801|gb|EEE82348.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297792041|ref|XP_002863905.1| histidine triad family protein [Arabidopsis lyrata subsp. lyrata] gi|297309740|gb|EFH40164.1| histidine triad family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|449458428|ref|XP_004146949.1| PREDICTED: uncharacterized HIT-like protein Rv1262c/MT1300-like [Cucumis sativus] gi|449526732|ref|XP_004170367.1| PREDICTED: uncharacterized HIT-like protein Rv1262c/MT1300-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|255585620|ref|XP_002533497.1| histidine triad (hit) protein, putative [Ricinus communis] gi|223526641|gb|EEF28884.1| histidine triad (hit) protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|118488050|gb|ABK95845.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query184
TAIR|locus:1006230576197 HINT3 "histidine triad nucleot 0.755 0.705 0.545 7.4e-34
UNIPROTKB|Q71XE9140 LMOf2365_2249 "HIT family prot 0.559 0.735 0.333 5e-12
UNIPROTKB|G4NDS8137 MGG_00872 "Uncharacterized pro 0.565 0.759 0.333 9.4e-11
MGI|MGI:1914097165 Hint3 "histidine triad nucleot 0.673 0.751 0.305 9.4e-11
ASPGD|ASPL0000013360133 AN3708 [Emericella nidulans (t 0.565 0.781 0.323 2e-10
UNIPROTKB|Q5LTM7140 SPO1386 "HIT family protein" [ 0.423 0.557 0.4 3.2e-10
TIGR_CMR|SPO_1386140 SPO_1386 "HIT family protein" 0.423 0.557 0.4 3.2e-10
RGD|621603175 Hint3 "histidine triad nucleot 0.673 0.708 0.305 6.6e-10
UNIPROTKB|Q81U41144 BAS0978 "HIT family protein" [ 0.385 0.493 0.380 8.4e-10
TIGR_CMR|BA_1047144 BA_1047 "HIT family protein" [ 0.385 0.493 0.380 8.4e-10
TAIR|locus:1006230576 HINT3 "histidine triad nucleotide-binding 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 368 (134.6 bits), Expect = 7.4e-34, P = 7.4e-34
 Identities = 78/143 (54%), Positives = 92/143 (64%)

Query:     6 RRLAVLSSHLLPTGPAPCXXXXXXXXXFCAQQRLSHSQESGH-ENDCVFCKIIRGESPAV 64
             RRLA+L SHL P GP P            +        ES   +NDCVFCKIIRGESP +
Sbjct:     4 RRLAILCSHLNPPGPNPTRDPTLRVSDCSSGSSGDGKVESSTLQNDCVFCKIIRGESPCL 63

Query:    65 KLYEYDTCLCILDTNPLSLGHSLIVPKSHFSCLDATPPSVVAAMCAKVPLISNAIMKATD 124
             KLYE D CLCILDTNPLS GHSLI+PK H+  L+ TPPSVVAAMC+KVPLISNAI+KAT 
Sbjct:    64 KLYEDDMCLCILDTNPLSHGHSLIIPKLHYPTLEETPPSVVAAMCSKVPLISNAIVKATG 123

Query:   125 AGMCQIFYT---AVTTKLSHSHL 144
             +    +      A    + H+H+
Sbjct:   124 SDSFNLLVNNGAAAGQVIFHTHI 146
GO:0003824 "catalytic activity" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0005777 "peroxisome" evidence=IDA
GO:0006790 "sulfur compound metabolic process" evidence=IDA
GO:0009150 "purine ribonucleotide metabolic process" evidence=IDA
GO:0047627 "adenylylsulfatase activity" evidence=IDA
UNIPROTKB|Q71XE9 LMOf2365_2249 "HIT family protein" [Listeria monocytogenes serotype 4b str. F2365 (taxid:265669)] Back     alignment and assigned GO terms
UNIPROTKB|G4NDS8 MGG_00872 "Uncharacterized protein" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
MGI|MGI:1914097 Hint3 "histidine triad nucleotide binding protein 3" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ASPGD|ASPL0000013360 AN3708 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
UNIPROTKB|Q5LTM7 SPO1386 "HIT family protein" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_1386 SPO_1386 "HIT family protein" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
RGD|621603 Hint3 "histidine triad nucleotide binding protein 3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q81U41 BAS0978 "HIT family protein" [Bacillus anthracis (taxid:1392)] Back     alignment and assigned GO terms
TIGR_CMR|BA_1047 BA_1047 "HIT family protein" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00011031001
SubName- Full=Chromosome undetermined scaffold_300, whole genome shotgun sequence; (195 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query184
cd01277103 cd01277, HINT_subgroup, HINT (histidine triad nucl 1e-24
COG0537138 COG0537, Hit, Diadenosine tetraphosphate (Ap4A) hy 1e-21
cd01276104 cd01276, PKCI_related, Protein Kinase C Interactin 4e-15
pfam11969113 pfam11969, DcpS_C, Scavenger mRNA decapping enzyme 8e-10
pfam0123097 pfam01230, HIT, HIT domain 1e-07
cd01278104 cd01278, aprataxin_related, aprataxin related: Apr 5e-05
cd01275126 cd01275, FHIT, FHIT (fragile histidine family): FH 0.003
>gnl|CDD|238608 cd01277, HINT_subgroup, HINT (histidine triad nucleotide-binding protein) subgroup: Members of this CD belong to the superfamily of histidine triad hydrolases that act on alpha-phosphate of ribonucleotides Back     alignment and domain information 
 Score = 91.5 bits (228), Expect = 1e-24
 Identities = 32/73 (43%), Positives = 44/73 (60%)

Query: 50  DCVFCKIIRGESPAVKLYEYDTCLCILDTNPLSLGHSLIVPKSHFSCLDATPPSVVAAMC 109
           DC+FCKII GE P+ K+YE D  L  LD NP S GH+L++PK H+  L    P  +A + 
Sbjct: 1   DCIFCKIIAGEIPSYKVYEDDHVLAFLDINPASKGHTLVIPKKHYENLLDLDPEELAELI 60

Query: 110 AKVPLISNAIMKA 122
                ++ A+ KA
Sbjct: 61  LAAKKVARALKKA 73

This subgroup includes members from all three forms of cellular life. Although the biochemical function has not been characterised for many of the members of this subgroup, the proteins from Yeast have been shown to be involved in secretion, peroxisome formation and gene expression. Length = 103
>gnl|CDD|223611 COG0537, Hit, Diadenosine tetraphosphate (Ap4A) hydrolase and other HIT family hydrolases [Nucleotide transport and metabolism / Carbohydrate transport and metabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|238607 cd01276, PKCI_related, Protein Kinase C Interacting protein related (PKCI): PKCI and related proteins belong to the ubiquitous HIT family of hydrolases that act on alpha-phosphates of ribonucleotides Back     alignment and domain information
>gnl|CDD|221348 pfam11969, DcpS_C, Scavenger mRNA decapping enzyme C-term binding Back     alignment and domain information
>gnl|CDD|216377 pfam01230, HIT, HIT domain Back     alignment and domain information
>gnl|CDD|238609 cd01278, aprataxin_related, aprataxin related: Aprataxin, a HINT family hydrolase is mutated in ataxia oculomotor apraxia syndrome Back     alignment and domain information
>gnl|CDD|238606 cd01275, FHIT, FHIT (fragile histidine family): FHIT proteins, related to the HIT family carry a motif HxHxH/Qxx (x, is a hydrophobic amino acid), On the basis of sequence, substrate specificity, structure, evolution and mechanism, HIT proteins are classified into three branches: the Hint branch, which consists of adenosine 5' -monophosphoramide hydrolases, the Fhit branch, that consists of diadenosine polyphosphate hydrolases, and the GalT branch consisting of specific nucloside monophosphate transferases Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 184
COG0537138 Hit Diadenosine tetraphosphate (Ap4A) hydrolase an 99.97
PRK10687119 purine nucleoside phosphoramidase; Provisional 99.97
cd01277103 HINT_subgroup HINT (histidine triad nucleotide-bin 99.96
cd01275126 FHIT FHIT (fragile histidine family): FHIT protein 99.96
cd01276104 PKCI_related Protein Kinase C Interacting protein 99.95
PF0123098 HIT: HIT domain; InterPro: IPR001310 The Histidine 99.93
TIGR00209347 galT_1 galactose-1-phosphate uridylyltransferase, 99.93
cd01278104 aprataxin_related aprataxin related: Aprataxin, a 99.93
KOG3275127 consensus Zinc-binding protein of the histidine tr 99.93
PLN02643336 ADP-glucose phosphorylase 99.92
PRK11720346 galactose-1-phosphate uridylyltransferase; Provisi 99.92
cd00608329 GalT Galactose-1-phosphate uridyl transferase (Gal 99.91
cd0046886 HIT_like HIT family: HIT (Histidine triad) protein 99.89
KOG3379150 consensus Diadenosine polyphosphate hydrolase and 99.83
PF11969116 DcpS_C: Scavenger mRNA decapping enzyme C-term bin 99.78
KOG4359166 consensus Protein kinase C inhibitor-like protein 99.65
COG1085338 GalT Galactose-1-phosphate uridylyltransferase [En 99.61
PF02744166 GalP_UDP_tr_C: Galactose-1-phosphate uridyl transf 99.6
KOG2958354 consensus Galactose-1-phosphate uridylyltransferas 99.32
PF04677121 CwfJ_C_1: Protein similar to CwfJ C-terminus 1; In 99.14
KOG2476528 consensus Uncharacterized conserved protein [Funct 98.55
KOG0562184 consensus Predicted hydrolase (HIT family) [Genera 98.35
PLN03103 403 GDP-L-galactose-hexose-1-phosphate guanyltransfera 97.65
KOG2477628 consensus Uncharacterized conserved protein [Funct 97.55
cd00608 329 GalT Galactose-1-phosphate uridyl transferase (Gal 97.14
KOG2720 431 consensus Predicted hydrolase (HIT family) [Genera 97.12
KOG3969310 consensus Uncharacterized conserved protein [Funct 96.99
PLN02643 336 ADP-glucose phosphorylase 96.69
COG1085 338 GalT Galactose-1-phosphate uridylyltransferase [En 96.62
PRK11720 346 galactose-1-phosphate uridylyltransferase; Provisi 96.17
TIGR00672250 cdh CDP-diacylglycerol pyrophosphatase, bacterial 96.03
PRK05471252 CDP-diacylglycerol pyrophosphatase; Provisional 95.65
TIGR00209 347 galT_1 galactose-1-phosphate uridylyltransferase, 95.05
PF02611222 CDH: CDP-diacylglycerol pyrophosphatase; InterPro: 94.32
COG2134252 Cdh CDP-diacylglycerol pyrophosphatase [Lipid meta 91.43
COG5075305 Uncharacterized conserved protein [Function unknow 89.35
COG4360 298 APA2 ATP adenylyltransferase (5',5'''-P-1,P-4-tetr 87.64
PF0184447 HNH: HNH endonuclease; InterPro: IPR002711 HNH end 86.77
>COG0537 Hit Diadenosine tetraphosphate (Ap4A) hydrolase and other HIT family hydrolases [Nucleotide transport and metabolism / Carbohydrate transport and metabolism / General function prediction only] Back     alignment and domain information 
Probab=99.97  E-value=2.4e-31  Score=204.47  Aligned_cols=106  Identities=36%  Similarity=0.557  Sum_probs=101.5

Q ss_pred             CCCeeceeccCCCcccEEEECCeEEEEEcCCCCCceEEEEEeCCccCCCCCCCHHHHHHHHHHHHHHHHHHHHHcCCCce
Q 030014           49 NDCVFCKIIRGESPAVKLYEYDTCLCILDTNPLSLGHSLIVPKSHFSCLDATPPSVVAAMCAKVPLISNAIMKATDAGMC  128 (184)
Q Consensus        49 ~~C~FC~ii~~e~~~~iV~E~d~~~af~~~~p~~pGH~LVvPKrHv~~l~dL~~ee~~~L~~~l~~v~~~l~~~~~~~~~  128 (184)
                      +.|+||+++.+|.|+.+||||++++||+|.+|.++||+|||||+|+.++.+++++++.+|+.+++++++++++.+++++|
T Consensus         1 ~~ciFc~ii~~e~~~~~Vye~~~~~afld~~P~~~gH~LviPk~h~~~l~~l~~~~~~~l~~~~~~ia~al~~~~~~~g~   80 (138)
T COG0537           1 MMCIFCKIIRGEIPANKVYEDEHVLAFLDIYPAAPGHTLVIPKRHVSDLEDLDPEELAELFLLAQKIAKALKEAFGADGY   80 (138)
T ss_pred             CCceeeeeecCCCCceEEEeCCCEEEEecCCCCCCCeEEEEeccchhhhhhCCHHHHHHHHHHHHHHHHHHHHHhCCCce
Confidence            46999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEEEe---CCCCceeeeEecceeecCCCCCC
Q 030014          129 QIFYT---AVTTKLSHSHLPLFFLPSYSLGF  156 (184)
Q Consensus       129 ni~~n---~~gq~v~HlHlHi~iiPR~~~~~  156 (184)
                      |+++|   .+||.|+|+|+|  ||||+++|.
T Consensus        81 ni~~N~g~~agq~V~HlH~H--vIPr~~~d~  109 (138)
T COG0537          81 NIGINNGKAAGQEVFHLHIH--IIPRYKGDD  109 (138)
T ss_pred             EEEEecCcccCcCcceEEEE--EcCCcCCCC
Confidence            99998   368999999999  999999763

>PRK10687 purine nucleoside phosphoramidase; Provisional Back     alignment and domain information
>cd01277 HINT_subgroup HINT (histidine triad nucleotide-binding protein) subgroup: Members of this CD belong to the superfamily of histidine triad hydrolases that act on alpha-phosphate of ribonucleotides Back     alignment and domain information
>cd01275 FHIT FHIT (fragile histidine family): FHIT proteins, related to the HIT family carry a motif HxHxH/Qxx (x, is a hydrophobic amino acid), On the basis of sequence, substrate specificity, structure, evolution and mechanism, HIT proteins are classified into three branches: the Hint branch, which consists of adenosine 5' -monophosphoramide hydrolases, the Fhit branch, that consists of diadenosine polyphosphate hydrolases, and the GalT branch consisting of specific nucloside monophosphate transferases Back     alignment and domain information
>cd01276 PKCI_related Protein Kinase C Interacting protein related (PKCI): PKCI and related proteins belong to the ubiquitous HIT family of hydrolases that act on alpha-phosphates of ribonucleotides Back     alignment and domain information
>PF01230 HIT: HIT domain; InterPro: IPR001310 The Histidine Triad (HIT) motif, His-x-His-x-His-x-x (x, a hydrophobic amino acid) was identified as being highly conserved in a variety of organisms [] Back     alignment and domain information
>TIGR00209 galT_1 galactose-1-phosphate uridylyltransferase, family 1 Back     alignment and domain information
>cd01278 aprataxin_related aprataxin related: Aprataxin, a HINT family hydrolase is mutated in ataxia oculomotor apraxia syndrome Back     alignment and domain information
>KOG3275 consensus Zinc-binding protein of the histidine triad (HIT) family [Signal transduction mechanisms] Back     alignment and domain information
>PLN02643 ADP-glucose phosphorylase Back     alignment and domain information
>PRK11720 galactose-1-phosphate uridylyltransferase; Provisional Back     alignment and domain information
>cd00608 GalT Galactose-1-phosphate uridyl transferase (GalT): This enzyme plays a key role in galactose metabolism by catalysing the transfer of a uridine 5'-phosphoryl group from UDP-galactose 1-phosphate Back     alignment and domain information
>cd00468 HIT_like HIT family: HIT (Histidine triad) proteins, named for a motif related to the sequence HxHxH/Qxx (x, a hydrophobic amino acid), are a superfamily of nucleotide hydrolases and transferases, which act on the alpha-phosphate of ribonucleotides Back     alignment and domain information
>KOG3379 consensus Diadenosine polyphosphate hydrolase and related proteins of the histidine triad (HIT) family [Nucleotide transport and metabolism; General function prediction only] Back     alignment and domain information
>PF11969 DcpS_C: Scavenger mRNA decapping enzyme C-term binding; PDB: 1VLR_B 1XMM_D 1XML_B 1ST0_A 3BLA_B 3BL9_B 3BL7_B 1ST4_B 1XQU_B Back     alignment and domain information
>KOG4359 consensus Protein kinase C inhibitor-like protein [General function prediction only] Back     alignment and domain information
>COG1085 GalT Galactose-1-phosphate uridylyltransferase [Energy production and conversion] Back     alignment and domain information
>PF02744 GalP_UDP_tr_C: Galactose-1-phosphate uridyl transferase, C-terminal domain; InterPro: IPR005850 Galactose-1-phosphate uridyl transferase catalyses the conversion of UDP-glucose and alpha-D-galactose 1-phosphate to alpha-D-glucose 1-phosphate and UDP-galactose during galactose metabolism Back     alignment and domain information
>KOG2958 consensus Galactose-1-phosphate uridylyltransferase [Energy production and conversion] Back     alignment and domain information
>PF04677 CwfJ_C_1: Protein similar to CwfJ C-terminus 1; InterPro: IPR006768 This group of sequences contain a conserved C-terminal domain which is found in the Schizosaccharomyces pombe (Fission yeast) protein Cwf19 (Q09909 from SWISSPROT) and its homologues Back     alignment and domain information
>KOG2476 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0562 consensus Predicted hydrolase (HIT family) [General function prediction only] Back     alignment and domain information
>PLN03103 GDP-L-galactose-hexose-1-phosphate guanyltransferase; Provisional Back     alignment and domain information
>KOG2477 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd00608 GalT Galactose-1-phosphate uridyl transferase (GalT): This enzyme plays a key role in galactose metabolism by catalysing the transfer of a uridine 5'-phosphoryl group from UDP-galactose 1-phosphate Back     alignment and domain information
>KOG2720 consensus Predicted hydrolase (HIT family) [General function prediction only] Back     alignment and domain information
>KOG3969 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN02643 ADP-glucose phosphorylase Back     alignment and domain information
>COG1085 GalT Galactose-1-phosphate uridylyltransferase [Energy production and conversion] Back     alignment and domain information
>PRK11720 galactose-1-phosphate uridylyltransferase; Provisional Back     alignment and domain information
>TIGR00672 cdh CDP-diacylglycerol pyrophosphatase, bacterial type Back     alignment and domain information
>PRK05471 CDP-diacylglycerol pyrophosphatase; Provisional Back     alignment and domain information
>TIGR00209 galT_1 galactose-1-phosphate uridylyltransferase, family 1 Back     alignment and domain information
>PF02611 CDH: CDP-diacylglycerol pyrophosphatase; InterPro: IPR003763 The CDP-diacylglycerol pyrophosphatases 3 Back     alignment and domain information
>COG2134 Cdh CDP-diacylglycerol pyrophosphatase [Lipid metabolism] Back     alignment and domain information
>COG5075 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG4360 APA2 ATP adenylyltransferase (5',5'''-P-1,P-4-tetraphosphate phosphorylase II) [Nucleotide transport and metabolism] Back     alignment and domain information
>PF01844 HNH: HNH endonuclease; InterPro: IPR002711 HNH endonuclease is found in bacteria and viruses [, , ] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query184
3o0m_A149 Crystal Structure Of A Zn-Bound Histidine Triad Fam 1e-13
3l7x_A173 The Crystal Structure Of Smu.412c From Streptococcu 4e-13
3ksv_A149 Hypothetical Protein From Leishmania Major Length = 3e-10
4egu_A119 0.95a Resolution Structure Of A Histidine Triad Pro 6e-10
3lb5_A161 Crystal Structure Of Hit-Like Protein Involved In C 8e-10
1y23_A145 Crystal Structure Of A Member Of Hit Family Of Prot 1e-09
3imi_A147 2.01 Angstrom Resolution Crystal Structure Of A Hit 1e-09
2eo4_A149 Crystal Structure Of Hypothetical Histidine Triad N 8e-09
1xqu_A147 Hit Family Hydrolase From Clostridium Thermocellum 2e-07
3o1x_A126 High Resolution Crystal Structure Of Histidine Tria 1e-06
1rzy_A126 Crystal Structure Of Rabbit Hint Complexed With N- 2e-06
3rhn_A115 Histidine Triad Nucleotide-Binding Protein (Hint) F 2e-06
1kpa_A126 Pkci-1-Zinc Length = 126 5e-06
1kpb_A125 Pkci-1-Apo Length = 125 5e-06
3tw2_A126 High Resolution Structure Of Human Histidine Triad 5e-06
4eqe_A128 Crystal Structure Of Histidine Triad Nucleotide-Bin 5e-06
3o1z_A126 High Resolution Crystal Structure Of Histidine Tria 7e-06
3oj7_A117 Crystal Structure Of A Histidine Triad Family Prote 9e-06
3p0t_A138 Crystal Structure Of An Hit-Like Protein From Mycob 9e-06
3o1c_A126 High Resolution Crystal Structure Of Histidine Tria 1e-05
3r6f_A135 Crystal Structure Of A Zinc-Containing Hit Family P 8e-05
>pdb|3O0M|A Chain A, Crystal Structure Of A Zn-Bound Histidine Triad Family Protein From Mycobacterium Smegmatis Length = 149 Back     alignment and structure 
Iteration: 1

 Score = 72.8 bits (177), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 46/72 (63%)
Query: 51  CVFCKIIRGESPAVKLYEYDTCLCILDTNPLSLGHSLIVPKSHFSCLDATPPSVVAAMCA 110
           CVFC I+ G++PA+++YE +  L ILD  P + GH+L++PK+H   L  TPP  VA M A
Sbjct: 7   CVFCAIVSGDAPAIRIYEDENFLGILDIRPFTRGHTLVIPKTHTVDLTDTPPETVAGMAA 66
Query: 111 KVPLISNAIMKA 122
               I+ A  ++
Sbjct: 67  VGQRIARAARES 78
>pdb|3L7X|A Chain A, The Crystal Structure Of Smu.412c From Streptococcus Mutans Ua159 Length = 173 Back     alignment and structure
>pdb|3KSV|A Chain A, Hypothetical Protein From Leishmania Major Length = 149 Back     alignment and structure
>pdb|4EGU|A Chain A, 0.95a Resolution Structure Of A Histidine Triad Protein From Clostridium Difficile Length = 119 Back     alignment and structure
>pdb|3LB5|A Chain A, Crystal Structure Of Hit-Like Protein Involved In Cell-Cycle Regulation From Bartonella Henselae With Unknown Ligand Length = 161 Back     alignment and structure
>pdb|1Y23|A Chain A, Crystal Structure Of A Member Of Hit Family Of Proteins From Bacillus Subtilis Length = 145 Back     alignment and structure
>pdb|3IMI|A Chain A, 2.01 Angstrom Resolution Crystal Structure Of A Hit Family Protein From Bacillus Anthracis Str. 'ames Ancestor' Length = 147 Back     alignment and structure
>pdb|2EO4|A Chain A, Crystal Structure Of Hypothetical Histidine Triad Nucleotide-Binding Protein St2152 From Sulfolobus Tokodaii Strain7 Length = 149 Back     alignment and structure
>pdb|1XQU|A Chain A, Hit Family Hydrolase From Clostridium Thermocellum Cth-393 Length = 147 Back     alignment and structure
>pdb|3O1X|A Chain A, High Resolution Crystal Structure Of Histidine Triad Nucleotide- Binding Protein 1 (Hint1) C84a Mutant From Rabbit Complexed With Adenosine Length = 126 Back     alignment and structure
>pdb|1RZY|A Chain A, Crystal Structure Of Rabbit Hint Complexed With N- Ethylsulfamoyladenosine Length = 126 Back     alignment and structure
>pdb|3RHN|A Chain A, Histidine Triad Nucleotide-Binding Protein (Hint) From Rabbit Complexed With Gmp Length = 115 Back     alignment and structure
>pdb|1KPA|A Chain A, Pkci-1-Zinc Length = 126 Back     alignment and structure
>pdb|1KPB|A Chain A, Pkci-1-Apo Length = 125 Back     alignment and structure
>pdb|3TW2|A Chain A, High Resolution Structure Of Human Histidine Triad Nucleotide-binding Protein 1 (hhint1)/amp Complex In A Monoclinic Space Group Length = 126 Back     alignment and structure
>pdb|4EQE|A Chain A, Crystal Structure Of Histidine Triad Nucleotide-Binding Protein 1 (Hint1) From Human Complexed With Lys-Ams Length = 128 Back     alignment and structure
>pdb|3O1Z|A Chain A, High Resolution Crystal Structure Of Histidine Triad Nucleotide- Binding Protein 1 (Hint1) Double Cysteine Mutant From Rabbit Length = 126 Back     alignment and structure
>pdb|3OJ7|A Chain A, Crystal Structure Of A Histidine Triad Family Protein From Entamoeba Histolytica, Bound To Sulfate Length = 117 Back     alignment and structure
>pdb|3P0T|A Chain A, Crystal Structure Of An Hit-Like Protein From Mycobacterium Paratuberculosis Length = 138 Back     alignment and structure
>pdb|3O1C|A Chain A, High Resolution Crystal Structure Of Histidine Triad Nucleotide- Binding Protein 1 (Hint1) C38a Mutant From Rabbit Complexed With Adenosine Length = 126 Back     alignment and structure
>pdb|3R6F|A Chain A, Crystal Structure Of A Zinc-Containing Hit Family Protein From Encephalitozoon Cuniculi Length = 135 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query184
3l7x_A173 SMU.412C, putative HIT-like protein involved in ce 4e-26
3imi_A147 HIT family protein; structural genomics, infectiou 5e-26
1y23_A145 HIT, histidine triad protein; HIT protein, PKCI-1, 6e-26
3lb5_A161 HIT-like protein involved in cell-cycle regulatio; 2e-25
2eo4_A149 150AA long hypothetical histidine triad nucleotid 2e-24
3ksv_A149 Uncharacterized protein; HIT family, structural ge 6e-24
3o0m_A149 HIT family protein; ssgcid, NIH, niaid, SBRI, UW, 9e-24
3p0t_A138 Uncharacterized protein; ssgcid, HIT-like protein, 2e-22
3r6f_A135 HIT family protein; structural genomics, seattle s 8e-21
3o1c_A126 Histidine triad nucleotide-binding protein 1; hydr 5e-16
4egu_A119 Histidine triad (HIT) protein; structural genomics 1e-15
3oj7_A117 Putative histidine triad family protein; hydrolase 3e-15
2oik_A154 Histidine triad (HIT) protein; HIT-like fold, stru 6e-15
3n1s_A119 HIT-like protein HINT; histidine triad nucleotide 6e-15
1xqu_A147 HIT family hydrolase; protein STRU initiative, PSI 9e-15
3ano_A218 AP-4-A phosphorylase; diadenosine polyphosphate, H 6e-14
1fit_A147 FragIle histidine protein; FHIT, fragIle histidine 5e-13
3sp4_A204 Aprataxin-like protein; HIT domain, zinc finger, D 8e-08
>3l7x_A SMU.412C, putative HIT-like protein involved in cell-cycle regulation; 1.70A {Streptococcus mutans} Length = 173 Back     alignment and structure
 Score = 97.1 bits (242), Expect = 4e-26
 Identities = 35/104 (33%), Positives = 56/104 (53%), Gaps = 2/104 (1%)

Query: 24  SSSSGVSASFCAQQRLSHSQESG--HENDCVFCKIIRGESPAVKLYEYDTCLCILDTNPL 81
             SSG+         ++  Q+ G    NDC+FCKI+ G+ P+ K+YE +  L  LD +  
Sbjct: 9   HHSSGLVPRGSHMASMTGGQQMGRGSMNDCLFCKIVAGDIPSSKVYEDEDVLAFLDISQA 68

Query: 82  SLGHSLIVPKSHFSCLDATPPSVVAAMCAKVPLISNAIMKATDA 125
           + GH+L++PK H         +  A + A++P I+ A+ KAT A
Sbjct: 69  TKGHTLVIPKEHVRNALEMTQTQAANLFARIPKIARALQKATKA 112
>3imi_A HIT family protein; structural genomics, infectious diseases for structural genomics of infectious diseases, unknown FUN csgid; 2.01A {Bacillus anthracis str} Length = 147 Back     alignment and structure
>1y23_A HIT, histidine triad protein; HIT protein, PKCI-1, cell-cycle regulation, NYSGXRC, structural genomics, protein structure initiative; 2.30A {Bacillus subtilis} SCOP: d.13.1.1 Length = 145 Back     alignment and structure
>3lb5_A HIT-like protein involved in cell-cycle regulatio; niaid, seattle structural genomics center for infectious DIS ssgcid, histidine triad; 1.90A {Bartonella henselae} Length = 161 Back     alignment and structure
>2eo4_A 150AA long hypothetical histidine triad nucleotid protein; HIT family, structural genomics, NPPSFA; 1.80A {Sulfolobus tokodaii} Length = 149 Back     alignment and structure
>3ksv_A Uncharacterized protein; HIT family, structural genomics, structural genomics of PATH protozoa consortium, SGPP, unknown function; 1.90A {Leishmania major} Length = 149 Back     alignment and structure
>3o0m_A HIT family protein; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, hydrola structural genomics; HET: AMP; 1.90A {Mycobacterium smegmatis str} Length = 149 Back     alignment and structure
>3p0t_A Uncharacterized protein; ssgcid, HIT-like protein, mycobacerium paratuberculosis, STR genomics; 1.90A {Mycobacterium avium subsp} Length = 138 Back     alignment and structure
>3r6f_A HIT family protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, protozoan parasite; 1.85A {Encephalitozoon cuniculi} Length = 135 Back     alignment and structure
>3o1c_A Histidine triad nucleotide-binding protein 1; hydrolase, HINT protein, HIT protein, adenosine 5'- monophosphoramidase; HET: ADN; 1.08A {Oryctolagus cuniculus} PDB: 3llj_A* 1rzy_A* 3qgz_A* 3o1z_A 3o1x_A* 4eqe_A* 4eqg_A* 4eqh_A* 3tw2_A* 1kpb_A 1kpf_A* 1kpa_A 1kpc_A 1av5_A* 1kpe_A* 4rhn_A* 3rhn_A* 5rhn_A* 6rhn_A Length = 126 Back     alignment and structure
>4egu_A Histidine triad (HIT) protein; structural genomics, center for structural genomics of infec diseases, csgid, HIT domain, unknown function; HET: 5GP; 0.95A {Clostridium difficile} Length = 119 Back     alignment and structure
>3oj7_A Putative histidine triad family protein; hydrolase, structural genomics, seattle structural genomics for infectious disease, ssgcid; 1.40A {Entamoeba histolytica} PDB: 3omf_A* 3oxk_A* Length = 117 Back     alignment and structure
>2oik_A Histidine triad (HIT) protein; HIT-like fold, structural genomics, joint center for structu genomics, JCSG; HET: MSE; 1.65A {Methylobacillus flagellatus} SCOP: d.13.1.1 Length = 154 Back     alignment and structure
>3n1s_A HIT-like protein HINT; histidine triad nucleotide binding protein, GMP, hydro; HET: 5GP; 1.45A {Escherichia coli} PDB: 3n1t_A* Length = 119 Back     alignment and structure
>1xqu_A HIT family hydrolase; protein STRU initiative, PSI, southeast collaboratory for structural GEN secsg; 2.30A {Clostridium thermocellum} SCOP: d.13.1.1 Length = 147 Back     alignment and structure
>3ano_A AP-4-A phosphorylase; diadenosine polyphosphate, HIT transferase; HET: PG4; 1.89A {Mycobacterium tuberculosis} Length = 218 Back     alignment and structure
>1fit_A FragIle histidine protein; FHIT, fragIle histidine triad protein, putative human tumor suppressor, advanced photon source, APS; HET: FRU; 1.85A {Homo sapiens} SCOP: d.13.1.1 PDB: 1fhi_A* 2fit_A* 3fit_A* 4fit_A 5fit_A* 6fit_A* 2fhi_A* Length = 147 Back     alignment and structure
>3sp4_A Aprataxin-like protein; HIT domain, zinc finger, DNA-binding protein, DNA deadenylas hydrolase; 1.80A {Schizosaccharomyces pombe} PDB: 3spd_A* 3spl_A* 3szq_A* Length = 204 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query184
3l7x_A173 SMU.412C, putative HIT-like protein involved in ce 100.0
3o0m_A149 HIT family protein; ssgcid, NIH, niaid, SBRI, UW, 100.0
3ksv_A149 Uncharacterized protein; HIT family, structural ge 99.98
3imi_A147 HIT family protein; structural genomics, infectiou 99.98
3lb5_A161 HIT-like protein involved in cell-cycle regulatio; 99.98
3p0t_A138 Uncharacterized protein; ssgcid, HIT-like protein, 99.97
3n1s_A119 HIT-like protein HINT; histidine triad nucleotide 99.97
1y23_A145 HIT, histidine triad protein; HIT protein, PKCI-1, 99.97
4egu_A119 Histidine triad (HIT) protein; structural genomics 99.97
2eo4_A149 150AA long hypothetical histidine triad nucleotid 99.97
3oj7_A117 Putative histidine triad family protein; hydrolase 99.97
3o1c_A126 Histidine triad nucleotide-binding protein 1; hydr 99.97
3r6f_A135 HIT family protein; structural genomics, seattle s 99.96
1xqu_A147 HIT family hydrolase; protein STRU initiative, PSI 99.96
3ano_A218 AP-4-A phosphorylase; diadenosine polyphosphate, H 99.95
2oik_A154 Histidine triad (HIT) protein; HIT-like fold, stru 99.95
1fit_A147 FragIle histidine protein; FHIT, fragIle histidine 99.93
1ems_A440 Nitfhit, NIT-fragIle histidine triad fusion protei 99.91
1gup_A348 Galactose-1-phosphate uridylyltransferase; nucleot 99.9
1z84_A351 Galactose-1-phosphate uridyl transferase-like prot 99.9
3ohe_A137 Histidine triad (HIT) protein; structural genomics 99.89
3i24_A149 HIT family hydrolase; structural genomics, PSI-2, 99.89
3nrd_A135 Histidine triad (HIT) protein; structural genomics 99.85
3i4s_A149 Histidine triad protein; hydrolase, phosphatase, H 99.82
3sp4_A204 Aprataxin-like protein; HIT domain, zinc finger, D 99.53
3bl9_A301 Scavenger mRNA-decapping enzyme DCPS; ligand compl 98.82
1vlr_A350 MRNA decapping enzyme; 16740816, structural genomi 98.77
1z84_A 351 Galactose-1-phosphate uridyl transferase-like prot 98.69
1gup_A 348 Galactose-1-phosphate uridylyltransferase; nucleot 96.42
2pof_A227 CDP-diacylglycerol pyrophosphatase; NYSGXRC, PFAM0 94.95
2qgp_A112 HNH endonuclease; Q39X46, GMR87, X-RAY, NESG, stru 89.74
>3l7x_A SMU.412C, putative HIT-like protein involved in cell-cycle regulation; 1.70A {Streptococcus mutans} Back     alignment and structure
Probab=100.00  E-value=2.8e-33  Score=221.44  Aligned_cols=136  Identities=30%  Similarity=0.556  Sum_probs=118.1

Q ss_pred             cccccCCCCCCCCCCCccchhhhhhccCCcccCCCCCCCeeceeccCCCcccEEEECCeEEEEEcCCCCCceEEEEEeCC
Q 030014           13 SHLLPTGPAPCSSSSGVSASFCAQQRLSHSQESGHENDCVFCKIIRGESPAVKLYEYDTCLCILDTNPLSLGHSLIVPKS   92 (184)
Q Consensus        13 ~~~~~~~~~~~~~~~~~~~~~c~~~~~~~~~~~~~~~~C~FC~ii~~e~~~~iV~E~d~~~af~~~~p~~pGH~LVvPKr   92 (184)
                      |=|.|+.+-|++......-.            ...|++|+||+|+++|.|.++||||++++||+|++|.+|||+||+||+
T Consensus        12 ~~~~~~~~~~~~~~~~~~~~------------~~~m~~CiFC~Ii~~e~p~~iV~e~e~~~afld~~P~~pgH~LVIPkr   79 (173)
T 3l7x_A           12 SGLVPRGSHMASMTGGQQMG------------RGSMNDCLFCKIVAGDIPSSKVYEDEDVLAFLDISQATKGHTLVIPKE   79 (173)
T ss_dssp             --CCCCCCTTBCTTSSBCCC-------------CCCTTCHHHHHHHTSSCCCEEEECSSEEEEECTTCSSTTCEEEEESS
T ss_pred             ccceehhhhhhhhccccccc------------CCCCCCCcccccccCCCCceEEEECCCEEEEEcCCCCCCcEEEEEecc
Confidence            44567777777776654422            356789999999999999999999999999999999999999999999


Q ss_pred             ccCCCCCCCHHHHHHHHHHHHHHHHHHHHHcCCCceEEEEe---CCCCceeeeEecceeecCCC-CCCcccccc
Q 030014           93 HFSCLDATPPSVVAAMCAKVPLISNAIMKATDAGMCQIFYT---AVTTKLSHSHLPLFFLPSYS-LGFLALSCI  162 (184)
Q Consensus        93 Hv~~l~dL~~ee~~~L~~~l~~v~~~l~~~~~~~~~ni~~n---~~gq~v~HlHlHi~iiPR~~-~~~~~~~~~  162 (184)
                      |+.++.||+++++.+|+.+++++++++++.+++++||+++|   .+||+|+|+|+|  ||||+. +++|.+.|.
T Consensus        80 Hv~~l~dL~~ee~~~L~~~~~~v~~~l~~~~~~~g~ni~~n~g~~aGq~V~HlHiH--iIPR~~~d~gf~~~~~  151 (173)
T 3l7x_A           80 HVRNALEMTQTQAANLFARIPKIARALQKATKADGLNIINNNEETAGQTVFHAHVH--LVPRFADSDEFDIRFV  151 (173)
T ss_dssp             CCSCGGGCCHHHHHHHHHTHHHHHHHHHHHHTCSEEEEEECCSGGGTCCSCSCCEE--EEEECC-CCSCCCCCC
T ss_pred             ccCChhhCCHHHHHHHHHHHHHHHHHHHHhcCCCCEEEEEecCcccCCCcCEEEEE--EEecccCCCCcccccC
Confidence            99999999999999999999999999999999999999998   368999999998  999999 566665554
>3o0m_A HIT family protein; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, hydrola structural genomics; HET: AMP; 1.90A {Mycobacterium smegmatis str} Back     alignment and structure
>3ksv_A Uncharacterized protein; HIT family, structural genomics, structural genomics of PATH protozoa consortium, SGPP, unknown function; 1.90A {Leishmania major} SCOP: d.13.1.0 Back     alignment and structure
>3imi_A HIT family protein; structural genomics, infectious diseases for structural genomics of infectious diseases, unknown FUN csgid; 2.01A {Bacillus anthracis str} SCOP: d.13.1.1 Back     alignment and structure
>3lb5_A HIT-like protein involved in cell-cycle regulatio; niaid, seattle structural genomics center for infectious DIS ssgcid, histidine triad; 1.90A {Bartonella henselae} Back     alignment and structure
>3p0t_A Uncharacterized protein; ssgcid, HIT-like protein, mycobacerium paratuberculosis, STR genomics; 1.90A {Mycobacterium avium subsp} Back     alignment and structure
>3n1s_A HIT-like protein HINT; histidine triad nucleotide binding protein, GMP, hydro; HET: 5GP; 1.45A {Escherichia coli} SCOP: d.13.1.0 PDB: 3n1t_A* Back     alignment and structure
>1y23_A HIT, histidine triad protein; HIT protein, PKCI-1, cell-cycle regulation, NYSGXRC, structural genomics, protein structure initiative; 2.30A {Bacillus subtilis} SCOP: d.13.1.1 Back     alignment and structure
>4egu_A Histidine triad (HIT) protein; structural genomics, center for structural genomics of infec diseases, csgid, HIT domain, unknown function; HET: 5GP; 0.95A {Clostridium difficile} Back     alignment and structure
>2eo4_A 150AA long hypothetical histidine triad nucleotid protein; HIT family, structural genomics, NPPSFA; 1.80A {Sulfolobus tokodaii} Back     alignment and structure
>3oj7_A Putative histidine triad family protein; hydrolase, structural genomics, seattle structural genomics for infectious disease, ssgcid; 1.40A {Entamoeba histolytica} SCOP: d.13.1.0 PDB: 3omf_A* 3oxk_A* Back     alignment and structure
>3o1c_A Histidine triad nucleotide-binding protein 1; hydrolase, HINT protein, HIT protein, adenosine 5'- monophosphoramidase; HET: ADN; 1.08A {Oryctolagus cuniculus} SCOP: d.13.1.1 PDB: 3llj_A* 1rzy_A* 3qgz_A* 3o1z_A 3o1x_A* 4eqe_A* 4eqg_A* 4eqh_A* 3tw2_A* 1kpb_A 1kpf_A* 1kpa_A 1kpc_A 1av5_A* 1kpe_A* 4rhn_A* 3rhn_A* 5rhn_A* 6rhn_A Back     alignment and structure
>3r6f_A HIT family protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, protozoan parasite; 1.85A {Encephalitozoon cuniculi} Back     alignment and structure
>1xqu_A HIT family hydrolase; protein STRU initiative, PSI, southeast collaboratory for structural GEN secsg; 2.30A {Clostridium thermocellum} SCOP: d.13.1.1 Back     alignment and structure
>3ano_A AP-4-A phosphorylase; diadenosine polyphosphate, HIT transferase; HET: PG4; 1.89A {Mycobacterium tuberculosis} Back     alignment and structure
>2oik_A Histidine triad (HIT) protein; HIT-like fold, structural genomics, joint center for structu genomics, JCSG; HET: MSE; 1.65A {Methylobacillus flagellatus} SCOP: d.13.1.1 Back     alignment and structure
>1fit_A FragIle histidine protein; FHIT, fragIle histidine triad protein, putative human tumor suppressor, advanced photon source, APS; HET: FRU; 1.85A {Homo sapiens} SCOP: d.13.1.1 PDB: 1fhi_A* 2fit_A* 3fit_A* 4fit_A 5fit_A* 6fit_A* 2fhi_A* Back     alignment and structure
>1ems_A Nitfhit, NIT-fragIle histidine triad fusion protein; WORM, nitrilase, nucleotide-binding protein, cancer; 2.80A {Caenorhabditis elegans} SCOP: d.13.1.1 d.160.1.1 Back     alignment and structure
>1gup_A Galactose-1-phosphate uridylyltransferase; nucleotidyltransferase, galactose metabolism; HET: GDU; 1.80A {Escherichia coli} SCOP: d.13.1.2 d.13.1.2 PDB: 1guq_A* 1hxq_A* 1hxp_A* Back     alignment and structure
>1z84_A Galactose-1-phosphate uridyl transferase-like protein; GALT, zinc, AMP, structural genomics, protein structure initiative, CESG; HET: AMP; 1.83A {Arabidopsis thaliana} SCOP: d.13.1.2 d.13.1.2 PDB: 1zwj_A 2q4h_A* 2q4l_A 2h39_A* Back     alignment and structure
>3ohe_A Histidine triad (HIT) protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology; HET: MSE; 1.20A {Marinobacter aquaeolei} Back     alignment and structure
>3i24_A HIT family hydrolase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 1.50A {Vibrio fischeri ES114} Back     alignment and structure
>3nrd_A Histidine triad (HIT) protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 2.06A {Sinorhizobium meliloti} Back     alignment and structure
>3i4s_A Histidine triad protein; hydrolase, phosphatase, HIT superfamily, PSI-2, NYSGXRC, STR genomics, protein structure initiative; 1.75A {Bradyrhizobium japonicum} Back     alignment and structure
>3sp4_A Aprataxin-like protein; HIT domain, zinc finger, DNA-binding protein, DNA deadenylas hydrolase; 1.80A {Schizosaccharomyces pombe} PDB: 3spd_A* 3spl_A* 3szq_A* Back     alignment and structure
>3bl9_A Scavenger mRNA-decapping enzyme DCPS; ligand complex, cytoplasm, hydrolase, nonsense-mediated mRNA decay, nucleus, polymorphism, structural genomics; HET: DD2; 1.80A {Homo sapiens} SCOP: d.13.1.3 d.246.1.1 PDB: 3bl7_A* 3bla_A* Back     alignment and structure
>1vlr_A MRNA decapping enzyme; 16740816, structural genomics, JCSG, protein structure initiative, PSI, joint center for structural genomics; 1.83A {Mus musculus} SCOP: d.13.1.3 d.246.1.1 PDB: 1xmm_B* 1xml_B 1st0_B* 1st4_B* Back     alignment and structure
>1z84_A Galactose-1-phosphate uridyl transferase-like protein; GALT, zinc, AMP, structural genomics, protein structure initiative, CESG; HET: AMP; 1.83A {Arabidopsis thaliana} SCOP: d.13.1.2 d.13.1.2 PDB: 1zwj_A 2q4h_A* 2q4l_A 2h39_A* Back     alignment and structure
>1gup_A Galactose-1-phosphate uridylyltransferase; nucleotidyltransferase, galactose metabolism; HET: GDU; 1.80A {Escherichia coli} SCOP: d.13.1.2 d.13.1.2 PDB: 1guq_A* 1hxq_A* 1hxp_A* Back     alignment and structure
>2pof_A CDP-diacylglycerol pyrophosphatase; NYSGXRC, PFAM02611, PSI-2, phospholipid biosynthesis structural genomics, protein structure initiative; 1.40A {Escherichia coli} SCOP: d.13.1.4 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 184
d1kpfa_111 d.13.1.1 (A:) Protein kinase C inhibitor-1, PKCI-1 9e-16
d1xqua_113 d.13.1.1 (A:) Putative hydrolase {Clostridium ther 8e-15
d1y23a_139 d.13.1.1 (A:) Hit {Bacillus subtilis [TaxId: 1423] 1e-13
d1z84a2156 d.13.1.2 (A:196-351) Galactose-1-phosphate uridyly 2e-12
d2oika1139 d.13.1.1 (A:6-144) Histidine triad protein Mfla250 2e-11
d1emsa1160 d.13.1.1 (A:281-440) NIT-FHIT fusion protein, C-te 4e-11
d1guqa2171 d.13.1.2 (A:178-348) Galactose-1-phosphate uridyly 5e-09
d1fita_146 d.13.1.1 (A:) FHIT (fragile histidine triad protei 4e-07
>d1kpfa_ d.13.1.1 (A:) Protein kinase C inhibitor-1, PKCI-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: HIT-like
superfamily: HIT-like
family: HIT (HINT, histidine triad) family of protein kinase-interacting proteins
domain: Protein kinase C inhibitor-1, PKCI-1
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 67.4 bits (164), Expect = 9e-16
 Identities = 26/107 (24%), Positives = 42/107 (39%), Gaps = 1/107 (0%)

Query: 50  DCVFCKIIRGESPAVKLYEYDTCLCILDTNPLSLGHSLIVPKSHFSCLDATPPSVVAAMC 109
           D +F KIIR E PA  ++E D CL   D +P +  H L++PK H S +        + + 
Sbjct: 1   DTIFGKIIRKEIPAKIIFEDDRCLAFHDISPQAPTHFLVIPKKHISQISVAEDDDESLLG 60

Query: 110 AKVPLISNAIMK-ATDAGMCQIFYTAVTTKLSHSHLPLFFLPSYSLG 155
             + +          + G   +         S  H+ L  L    + 
Sbjct: 61  HLMIVGKKCAADLGLNKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMH 107
>d1xqua_ d.13.1.1 (A:) Putative hydrolase {Clostridium thermocellum [TaxId: 1515]} Length = 113 Back     information, alignment and structure
>d1y23a_ d.13.1.1 (A:) Hit {Bacillus subtilis [TaxId: 1423]} Length = 139 Back     information, alignment and structure
>d1z84a2 d.13.1.2 (A:196-351) Galactose-1-phosphate uridylyltransferase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 156 Back     information, alignment and structure
>d2oika1 d.13.1.1 (A:6-144) Histidine triad protein Mfla2506 {Methylobacillus flagellatus [TaxId: 405]} Length = 139 Back     information, alignment and structure
>d1emsa1 d.13.1.1 (A:281-440) NIT-FHIT fusion protein, C-terminal domain {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 160 Back     information, alignment and structure
>d1guqa2 d.13.1.2 (A:178-348) Galactose-1-phosphate uridylyltransferase {Escherichia coli [TaxId: 562]} Length = 171 Back     information, alignment and structure
>d1fita_ d.13.1.1 (A:) FHIT (fragile histidine triad protein) {Human (Homo sapiens) [TaxId: 9606]} Length = 146 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query184
d1y23a_139 Hit {Bacillus subtilis [TaxId: 1423]} 99.98
d1kpfa_111 Protein kinase C inhibitor-1, PKCI-1 {Human (Homo 99.97
d1xqua_113 Putative hydrolase {Clostridium thermocellum [TaxI 99.97
d1emsa1160 NIT-FHIT fusion protein, C-terminal domain {Nemato 99.96
d2oika1139 Histidine triad protein Mfla2506 {Methylobacillus 99.96
d1z84a2156 Galactose-1-phosphate uridylyltransferase {Thale c 99.94
d1fita_146 FHIT (fragile histidine triad protein) {Human (Hom 99.93
d1guqa2171 Galactose-1-phosphate uridylyltransferase {Escheri 99.93
d1vlra1192 mRNA decapping enzyme DcpS C-terminal domain {Mous 99.25
d1z84a1173 Galactose-1-phosphate uridylyltransferase {Thale c 97.58
d1guqa1176 Galactose-1-phosphate uridylyltransferase {Escheri 97.05
d2pofa1220 CDP-diacylglycerol pyrophosphatase CDH {Escherichi 96.04
>d1y23a_ d.13.1.1 (A:) Hit {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: HIT-like
superfamily: HIT-like
family: HIT (HINT, histidine triad) family of protein kinase-interacting proteins
domain: Hit
species: Bacillus subtilis [TaxId: 1423]

Probab=99.98  E-value=1.9e-33  Score=212.02  Aligned_cols=112  Identities=26%  Similarity=0.479  Sum_probs=104.1

Q ss_pred             CCCeeceeccCCCcccEEEECCeEEEEEcCCCCCceEEEEEeCCccCCCCCCCHHHHHHHHHHHHHHHHHHHHHcCCCce
Q 030014           49 NDCVFCKIIRGESPAVKLYEYDTCLCILDTNPLSLGHSLIVPKSHFSCLDATPPSVVAAMCAKVPLISNAIMKATDAGMC  128 (184)
Q Consensus        49 ~~C~FC~ii~~e~~~~iV~E~d~~~af~~~~p~~pGH~LVvPKrHv~~l~dL~~ee~~~L~~~l~~v~~~l~~~~~~~~~  128 (184)
                      ++|+||+|++||.|+++|||||+++||+|.+|.++||+||+||+|+.++.+|+++++.+++.+++++++++++.+++++|
T Consensus         1 e~CiFC~I~~~e~p~~~i~ede~~~af~d~~P~~~GH~LViPk~H~~~~~dL~~~~~~~l~~~~~~~~~~l~~~~~~~g~   80 (139)
T d1y23a_           1 ENCIFCKIIAGDIPSAKVYEDEHVLAFLDISQVTKGHTLVIPKTHIENVYEFTDELAKQYFHAVPKIARAIRDEFEPIGL   80 (139)
T ss_dssp             CCCHHHHHHHTSSCCCEEEECSSEEEEECTTCSSTTCEEEEESSCCSSGGGCCHHHHHTTTTHHHHHHHHHHHHHCCSEE
T ss_pred             CcCccCccccCCCCccEEEECCCEEEEecCCCCCCcEEEEEEecccccccccchHHHHHHHHHHHHHHHHHhhhcccCCc
Confidence            47999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEEEe---CCCCceeeeEecceeecCCC-CCCcccccc
Q 030014          129 QIFYT---AVTTKLSHSHLPLFFLPSYS-LGFLALSCI  162 (184)
Q Consensus       129 ni~~n---~~gq~v~HlHlHi~iiPR~~-~~~~~~~~~  162 (184)
                      |+++|   .+||+|+|+|+|  ||||+. ++++...|.
T Consensus        81 ~i~~n~g~~agq~v~H~H~H--viPR~~~~~~~~~~~~  116 (139)
T d1y23a_          81 NTLNNNGEKAGQSVFHYHMH--IIPRYGKGDGFGAVWK  116 (139)
T ss_dssp             EEEEEESGGGTCCSSSCCEE--EEEECSTTCSEEEEEC
T ss_pred             EEEeCCCccccEecCEEEEE--EEccccCCCCcccccc
Confidence            99998   369999999998  999986 555555554
>d1kpfa_ d.13.1.1 (A:) Protein kinase C inhibitor-1, PKCI-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xqua_ d.13.1.1 (A:) Putative hydrolase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1emsa1 d.13.1.1 (A:281-440) NIT-FHIT fusion protein, C-terminal domain {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2oika1 d.13.1.1 (A:6-144) Histidine triad protein Mfla2506 {Methylobacillus flagellatus [TaxId: 405]} Back     information, alignment and structure
>d1z84a2 d.13.1.2 (A:196-351) Galactose-1-phosphate uridylyltransferase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1fita_ d.13.1.1 (A:) FHIT (fragile histidine triad protein) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1guqa2 d.13.1.2 (A:178-348) Galactose-1-phosphate uridylyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vlra1 d.13.1.3 (A:146-337) mRNA decapping enzyme DcpS C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z84a1 d.13.1.2 (A:23-195) Galactose-1-phosphate uridylyltransferase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1guqa1 d.13.1.2 (A:2-177) Galactose-1-phosphate uridylyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pofa1 d.13.1.4 (A:31-250) CDP-diacylglycerol pyrophosphatase CDH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure