Citrus Sinensis ID: 030169

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180--
MARQALAKLIGSIGSRRPSTASSVSHYRLSSSAAPAAHSRNYGSSAAASHPAVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVVGGVTPKKGGTEHLGLPVFNSVAEAKAETKANASVIYVPPPFAAAAIMEAMEAELDLVVCITEGIPQHDMVINFTRVNILLVAFLNFIMKLTRNWR
cHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccEEEEcccccEEEEcccccHHHHHHHHHHHHccccEEcccccccccEEEccccccccHHHHHHHHcccEEEEEEcccccHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHHcccEEEEEEEEEccccc
cHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHcccccccHHHHHHccccccccEEEEEccccHHHHHHHHHHHHcccEEEEEEEcccccccEEccEEEEccHHHHHHHHcccEEEEcccHHHHHHHHHHHHHccccEEEEccccccHHHHHHHHHHHHccccEEEEEEHHcccccc
MARQALAKLIGsigsrrpstassvshyrlsssaapaahsrnygssaaashpavfvdknTRVICQgitgkngtfhtEQAIEYgtkmvvggvtpkkggtehlglpvfNSVAEAKAETKANasviyvpppFAAAAIMEAMEAELDLVVCItegipqhdmVINFTRVNILLVAFLNFIMKLTRNWR
MARQALAKLigsigsrrpstaSSVSHYRLSSSAAPAAHSRNYGSSAAASHPAVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVVGGVTPKKGGTEHLGLPVFNSVAEAKAETKANASVIYVPPPFAAAAIMEAMEAELDLVVCITEGIPQHDMVINFTRVNILLVAFLNFImkltrnwr
MARQALAKLIGSIGSRRPSTASSVSHYRLSSSAAPAAHSRNYGSSAAASHPAVFVDKNTRVICQGITGKNGTFHTEQAIEYgtkmvvggvtpkkggtEHLGLPVFNSVAEAKAETKANASVIYVPPPFaaaaimeameaeLDLVVCITEGIPQHDMVINFTRVNILLVAFLNFIMKLTRNWR
***************************************************AVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVVGGVTPKKGGTEHLGLPVFNSVAEAKAETKANASVIYVPPPFAAAAIMEAMEAELDLVVCITEGIPQHDMVINFTRVNILLVAFLNFIMKLTR***
************************************************SHPAVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVVGGVTPKKGGTEHLGLPVFNSVAEAKAETKANASVIYVPPPFAAAAIMEAMEAELDLVVCITEGIPQHDMVINFTRVNILLVAFLNFIMKLTRN**
MARQALAKLIGSIG**********************************SHPAVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVVGGVTPKKGGTEHLGLPVFNSVAEAKAETKANASVIYVPPPFAAAAIMEAMEAELDLVVCITEGIPQHDMVINFTRVNILLVAFLNFIMKLTRNWR
************I*SRRPSTASSVS**R**S*AAPAAHSRNYGSSAAASHPAVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVVGGVTPKKGGTEHLGLPVFNSVAEAKAETKANASVIYVPPPFAAAAIMEAMEAELDLVVCITEGIPQHDMVINFTRVNILLVAFLNFIMKLTRN**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MARQALAKLIGSIGSRRPSTASSVSHYRLSSSAAPAAHSRNYGSSAAASHPAVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVVGGVTPKKGGTEHLGLPVFNSVAEAKAETKANASVIYVPPPFAAAAIMEAMEAELDLVVCITEGIPQHDMVINFTRVNILLVAFLNFIMKLTRNWR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query182 2.2.26 [Sep-21-2011]
P68209 347 Succinyl-CoA ligase [ADP- yes no 0.829 0.435 0.732 3e-56
Q8GTQ9 332 Succinyl-CoA ligase [ADP- N/A no 0.780 0.427 0.732 4e-56
Q8LAD2 341 Succinyl-CoA ligase [ADP- no no 0.824 0.439 0.700 7e-53
Q6DQL1 337 Succinyl-CoA ligase [ADP- N/A no 0.802 0.433 0.746 7e-50
Q6ZL94 331 Probable succinyl-CoA lig yes no 0.703 0.386 0.861 5e-49
Q9WUM5 346 Succinyl-CoA ligase [ADP/ yes no 0.615 0.323 0.707 3e-42
P36967 315 Succinyl-CoA ligase [ADP/ yes no 0.648 0.374 0.663 2e-41
Q9YGD2 306 Succinyl-CoA ligase subun N/A no 0.615 0.366 0.681 3e-40
Q1RH56 291 Succinyl-CoA ligase [ADP- yes no 0.576 0.360 0.698 1e-37
Q4ULQ8 292 Succinyl-CoA ligase [ADP- yes no 0.576 0.359 0.688 2e-36
>sp|P68209|SUCA1_ARATH Succinyl-CoA ligase [ADP-forming] subunit alpha-1, mitochondrial OS=Arabidopsis thaliana GN=At5g08300 PE=1 SV=1 Back     alignment and function desciption
 Score =  217 bits (553), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 118/161 (73%), Positives = 130/161 (80%), Gaps = 10/161 (6%)

Query: 1   MARQALAKLIGSIGS--RRPSTASSVSHYRLSSSAAPAAHSRNYGSSAAASHP--AVFVD 56
           M+RQ +A+LIGS+ S  RR ST  S   +    S      SR++   A+  HP  AVFVD
Sbjct: 1   MSRQ-VARLIGSLSSKARRCSTGGS-EVFPSCQSLTSLTQSRSF---ASDPHPPAAVFVD 55

Query: 57  KNTRVICQGITGKNGTFHTEQAIEYGTKMVVGGVTPKKGGTEHLGLPVFNSVAEAKAETK 116
           KNTRV+CQGITGKNGTFHTEQAIEYGTKMV G VTPKKGGTEHLGLPVFNSVAEAKA+TK
Sbjct: 56  KNTRVLCQGITGKNGTFHTEQAIEYGTKMVAG-VTPKKGGTEHLGLPVFNSVAEAKADTK 114

Query: 117 ANASVIYVPPPFAAAAIMEAMEAELDLVVCITEGIPQHDMV 157
           ANASVIYVP PFAAAAIME +EAELDL+VCITEGIPQHDMV
Sbjct: 115 ANASVIYVPAPFAAAAIMEGIEAELDLIVCITEGIPQHDMV 155

Arabidopsis thaliana (taxid: 3702)
EC: 6EC: .EC: 2EC: .EC: 1EC: .EC: 5
>sp|Q8GTQ9|SUCA1_SOLLC Succinyl-CoA ligase [ADP-forming] subunit alpha-1, mitochondrial OS=Solanum lycopersicum GN=SCOA PE=1 SV=1 Back     alignment and function description
>sp|Q8LAD2|SUCA2_ARATH Succinyl-CoA ligase [ADP-forming] subunit alpha-2, mitochondrial OS=Arabidopsis thaliana GN=At5g23250 PE=1 SV=2 Back     alignment and function description
>sp|Q6DQL1|SUCA2_SOLLC Succinyl-CoA ligase [ADP-forming] subunit alpha-2, mitochondrial OS=Solanum lycopersicum PE=1 SV=1 Back     alignment and function description
>sp|Q6ZL94|SUCA_ORYSJ Probable succinyl-CoA ligase [ADP-forming] subunit alpha, mitochondrial OS=Oryza sativa subsp. japonica GN=Os07g0577700 PE=1 SV=1 Back     alignment and function description
>sp|Q9WUM5|SUCA_MOUSE Succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial OS=Mus musculus GN=Suclg1 PE=1 SV=4 Back     alignment and function description
>sp|P36967|SUCA_DICDI Succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial OS=Dictyostelium discoideum GN=scsA PE=1 SV=3 Back     alignment and function description
>sp|Q9YGD2|SUCA_COLLI Succinyl-CoA ligase subunit alpha, mitochondrial (Fragment) OS=Columba livia GN=SUCLG1 PE=1 SV=1 Back     alignment and function description
>sp|Q1RH56|SUCD_RICBR Succinyl-CoA ligase [ADP-forming] subunit alpha OS=Rickettsia bellii (strain RML369-C) GN=sucD PE=3 SV=1 Back     alignment and function description
>sp|Q4ULQ8|SUCD_RICFE Succinyl-CoA ligase [ADP-forming] subunit alpha OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=sucD PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query182
409972123 362 uncharacterized protein, partial [Phleum 0.703 0.353 0.875 1e-54
409972239 357 uncharacterized protein, partial [Phleum 0.703 0.358 0.875 1e-54
297806865 347 hypothetical protein ARALYDRAFT_487662 [ 0.829 0.435 0.732 1e-54
15241592 347 Succinyl-CoA ligase [GDP-forming] subuni 0.829 0.435 0.732 1e-54
225465670 329 PREDICTED: succinyl-CoA ligase [ADP-form 0.681 0.376 0.838 2e-54
302761178150 hypothetical protein SELMODRAFT_405593 [ 0.670 0.813 0.856 2e-54
350537045 332 succinyl-CoA ligase [ADP-forming] subuni 0.780 0.427 0.732 2e-54
242046092 332 hypothetical protein SORBIDRAFT_02g03742 0.703 0.385 0.853 2e-54
409972341 302 uncharacterized protein, partial [Phleum 0.609 0.367 0.946 3e-54
302768983150 hypothetical protein SELMODRAFT_408824 [ 0.670 0.813 0.856 4e-54
>gi|409972123|gb|JAA00265.1| uncharacterized protein, partial [Phleum pratense] Back     alignment and taxonomy information
 Score =  218 bits (554), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 113/129 (87%), Positives = 119/129 (92%), Gaps = 1/129 (0%)

Query: 29  LSSSAAPAAHSRNYGSSAAASHPAVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVVG 88
           L S+A+   HSR Y ++AAA  PAVFVDK+TRVICQGITGKNGTFHTEQAIEYGT MV G
Sbjct: 44  LGSAASRFLHSRGYAAAAAAPSPAVFVDKSTRVICQGITGKNGTFHTEQAIEYGTNMV-G 102

Query: 89  GVTPKKGGTEHLGLPVFNSVAEAKAETKANASVIYVPPPFAAAAIMEAMEAELDLVVCIT 148
           GVTPKKGGTEHLGLPVFNSVAEAKAETKANASVIYVPPPFAAAAIMEA+EAELDLVVCIT
Sbjct: 103 GVTPKKGGTEHLGLPVFNSVAEAKAETKANASVIYVPPPFAAAAIMEALEAELDLVVCIT 162

Query: 149 EGIPQHDMV 157
           EGIPQHDMV
Sbjct: 163 EGIPQHDMV 171

Source: Phleum pratense

Species: Phleum pratense

Genus: Phleum

Family: Poaceae

Order: Poales

Class: Liliopsida

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|409972239|gb|JAA00323.1| uncharacterized protein, partial [Phleum pratense] Back     alignment and taxonomy information
>gi|297806865|ref|XP_002871316.1| hypothetical protein ARALYDRAFT_487662 [Arabidopsis lyrata subsp. lyrata] gi|297317153|gb|EFH47575.1| hypothetical protein ARALYDRAFT_487662 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15241592|ref|NP_196447.1| Succinyl-CoA ligase [GDP-forming] subunit alpha-1 [Arabidopsis thaliana] gi|57014135|sp|P68209.1|SUCA1_ARATH RecName: Full=Succinyl-CoA ligase [ADP-forming] subunit alpha-1, mitochondrial; AltName: Full=Succinyl-CoA synthetase subunit alpha-1; Short=SCS-alpha-1; Flags: Precursor gi|3660467|emb|CAA05023.1| succinyl-CoA-ligase alpha subunit [Arabidopsis thaliana] gi|10178272|emb|CAC08330.1| succinyl-CoA-ligase alpha subunit [Arabidopsis thaliana] gi|18252215|gb|AAL61940.1| succinyl-CoA-ligase alpha subunit [Arabidopsis thaliana] gi|21387057|gb|AAM47932.1| succinyl-CoA-ligase alpha subunit [Arabidopsis thaliana] gi|21536557|gb|AAM60889.1| succinyl-CoA-ligase alpha subunit [Arabidopsis thaliana] gi|332003896|gb|AED91279.1| Succinyl-CoA ligase [GDP-forming] subunit alpha-1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|225465670|ref|XP_002271746.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-1, mitochondrial [Vitis vinifera] gi|296085314|emb|CBI29046.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|302761178|ref|XP_002964011.1| hypothetical protein SELMODRAFT_405593 [Selaginella moellendorffii] gi|300167740|gb|EFJ34344.1| hypothetical protein SELMODRAFT_405593 [Selaginella moellendorffii] Back     alignment and taxonomy information
>gi|350537045|ref|NP_001234277.1| succinyl-CoA ligase [ADP-forming] subunit alpha-1, mitochondrial [Solanum lycopersicum] gi|75150501|sp|Q8GTQ9.1|SUCA1_SOLLC RecName: Full=Succinyl-CoA ligase [ADP-forming] subunit alpha-1, mitochondrial; Short=SlSCoALalpha1; Flags: Precursor gi|27357175|gb|AAN86619.1| succinyl-CoA ligase alpha 1 subunit [Solanum lycopersicum] Back     alignment and taxonomy information
>gi|242046092|ref|XP_002460917.1| hypothetical protein SORBIDRAFT_02g037420 [Sorghum bicolor] gi|241924294|gb|EER97438.1| hypothetical protein SORBIDRAFT_02g037420 [Sorghum bicolor] Back     alignment and taxonomy information
>gi|409972341|gb|JAA00374.1| uncharacterized protein, partial [Phleum pratense] Back     alignment and taxonomy information
>gi|302768983|ref|XP_002967911.1| hypothetical protein SELMODRAFT_408824 [Selaginella moellendorffii] gi|300164649|gb|EFJ31258.1| hypothetical protein SELMODRAFT_408824 [Selaginella moellendorffii] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query182
TAIR|locus:2150773 347 AT5G08300 [Arabidopsis thalian 0.829 0.435 0.583 5.5e-38
UNIPROTKB|Q6DQL1 337 Q6DQL1 "Succinyl-CoA ligase [A 0.802 0.433 0.575 2.4e-37
UNIPROTKB|Q8GTQ9 332 SCOA "Succinyl-CoA ligase [ADP 0.780 0.427 0.573 9.2e-36
TAIR|locus:2166756 341 AT5G23250 [Arabidopsis thalian 0.824 0.439 0.554 1.2e-35
UNIPROTKB|F1SNZ6 363 SUCLG1 "Succinyl-CoA ligase [A 0.615 0.308 0.548 4.7e-29
UNIPROTKB|F1SNZ7 346 SUCLG1 "Succinyl-CoA ligase [A 0.615 0.323 0.548 4.7e-29
UNIPROTKB|O19069 346 SUCLG1 "Succinyl-CoA ligase [A 0.615 0.323 0.548 4.7e-29
MGI|MGI:1927234 346 Suclg1 "succinate-CoA ligase, 0.758 0.398 0.467 2.2e-27
RGD|619821 346 Suclg1 "succinate-CoA ligase, 0.615 0.323 0.539 3.5e-27
UNIPROTKB|E2R0Y5 346 SUCLG1 "Uncharacterized protei 0.829 0.436 0.461 4.5e-27
TAIR|locus:2150773 AT5G08300 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 407 (148.3 bits), Expect = 5.5e-38, P = 5.5e-38
 Identities = 94/161 (58%), Positives = 104/161 (64%)

Query:     1 MARQALAKLIGSIGS--RRPSTASSVSHYRLSSSAAPAAHSRNYGSSAAASHP--AVFVD 56
             M+RQ +A+LIGS+ S  RR ST  S   +    S      SR++ S     HP  AVFVD
Sbjct:     1 MSRQ-VARLIGSLSSKARRCSTGGS-EVFPSCQSLTSLTQSRSFASDP---HPPAAVFVD 55

Query:    57 KNTRVICQGITGKNGTFHTEQAIEYXXXXXXXXXXXXXXXXEHLGLPVFNSVAEAKAETK 116
             KNTRV+CQGITGKNGTFHTEQAIEY                EHLGLPVFNSVAEAKA+TK
Sbjct:    56 KNTRVLCQGITGKNGTFHTEQAIEYGTKMVAGVTPKKGGT-EHLGLPVFNSVAEAKADTK 114

Query:   117 ANASVIYVPPPFXXXXXXXXXXXXLDLVVCITEGIPQHDMV 157
             ANASVIYVP PF            LDL+VCITEGIPQHDMV
Sbjct:   115 ANASVIYVPAPFAAAAIMEGIEAELDLIVCITEGIPQHDMV 155
GO:0000166 "nucleotide binding" evidence=IEA
GO:0003824 "catalytic activity" evidence=IEA
GO:0003878 "ATP citrate synthase activity" evidence=IEA
GO:0004775 "succinate-CoA ligase (ADP-forming) activity" evidence=IEA
GO:0004776 "succinate-CoA ligase (GDP-forming) activity" evidence=ISS
GO:0005739 "mitochondrion" evidence=ISM;IDA
GO:0008152 "metabolic process" evidence=IEA;ISS
GO:0046872 "metal ion binding" evidence=IDA
GO:0005618 "cell wall" evidence=IDA
GO:0046686 "response to cadmium ion" evidence=IEP;RCA
GO:0005507 "copper ion binding" evidence=IDA
GO:0005829 "cytosol" evidence=RCA
GO:0006094 "gluconeogenesis" evidence=RCA
GO:0006096 "glycolysis" evidence=RCA
GO:0006511 "ubiquitin-dependent protein catabolic process" evidence=RCA
GO:0009627 "systemic acquired resistance" evidence=RCA
GO:0009651 "response to salt stress" evidence=RCA
GO:0009744 "response to sucrose stimulus" evidence=RCA
GO:0009749 "response to glucose stimulus" evidence=RCA
GO:0009750 "response to fructose stimulus" evidence=RCA
GO:0009853 "photorespiration" evidence=RCA
GO:0034976 "response to endoplasmic reticulum stress" evidence=RCA
GO:0051788 "response to misfolded protein" evidence=RCA
GO:0080129 "proteasome core complex assembly" evidence=RCA
UNIPROTKB|Q6DQL1 Q6DQL1 "Succinyl-CoA ligase [ADP-forming] subunit alpha-2, mitochondrial" [Solanum lycopersicum (taxid:4081)] Back     alignment and assigned GO terms
UNIPROTKB|Q8GTQ9 SCOA "Succinyl-CoA ligase [ADP-forming] subunit alpha-1, mitochondrial" [Solanum lycopersicum (taxid:4081)] Back     alignment and assigned GO terms
TAIR|locus:2166756 AT5G23250 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|F1SNZ6 SUCLG1 "Succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1SNZ7 SUCLG1 "Succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|O19069 SUCLG1 "Succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1927234 Suclg1 "succinate-CoA ligase, GDP-forming, alpha subunit" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|619821 Suclg1 "succinate-CoA ligase, alpha subunit" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E2R0Y5 SUCLG1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P68209SUCA1_ARATH6, ., 2, ., 1, ., 50.73290.82960.4351yesno
Q9WUM5SUCA_MOUSE6, ., 2, ., 1, ., 50.70790.61530.3236yesno
Q6ZL94SUCA_ORYSJ6, ., 2, ., 1, ., 50.86150.70320.3867yesno
Q94522SUCA_DROME6, ., 2, ., 1, ., 50.71840.56040.3109yesno
P53597SUCA_HUMAN6, ., 2, ., 1, ., 50.72560.61530.3236yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer6.2.10.766

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query182
PLN00125 300 PLN00125, PLN00125, Succinyl-CoA ligase [GDP-formi 8e-70
PRK05678 291 PRK05678, PRK05678, succinyl-CoA synthetase subuni 1e-67
PTZ00187 317 PTZ00187, PTZ00187, succinyl-CoA synthetase alpha 4e-67
COG0074 293 COG0074, SucD, Succinyl-CoA synthetase, alpha subu 1e-59
TIGR01019 286 TIGR01019, sucCoAalpha, succinyl-CoA synthetase, a 7e-59
pfam0262996 pfam02629, CoA_binding, CoA binding domain 2e-37
smart00881100 smart00881, CoA_binding, CoA binding domain 7e-34
PLN02522 608 PLN02522, PLN02522, ATP citrate (pro-S)-lyase 0.002
>gnl|CDD|215066 PLN00125, PLN00125, Succinyl-CoA ligase [GDP-forming] subunit alpha Back     alignment and domain information 
 Score =  213 bits (544), Expect = 8e-70
 Identities = 105/111 (94%), Positives = 108/111 (97%), Gaps = 1/111 (0%)

Query: 47  AASHPAVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVVGGVTPKKGGTEHLGLPVFN 106
           A+  PAVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMV GGVTPKKGGTEHLGLPVFN
Sbjct: 1   ASPPPAVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMV-GGVTPKKGGTEHLGLPVFN 59

Query: 107 SVAEAKAETKANASVIYVPPPFAAAAIMEAMEAELDLVVCITEGIPQHDMV 157
           +VAEAKAETKANASVIYVPPPFAAAAI+EAMEAELDLVVCITEGIPQHDMV
Sbjct: 60  TVAEAKAETKANASVIYVPPPFAAAAILEAMEAELDLVVCITEGIPQHDMV 110

Length = 300
>gnl|CDD|180194 PRK05678, PRK05678, succinyl-CoA synthetase subunit alpha; Validated Back     alignment and domain information
>gnl|CDD|240307 PTZ00187, PTZ00187, succinyl-CoA synthetase alpha subunit; Provisional Back     alignment and domain information
>gnl|CDD|223152 COG0074, SucD, Succinyl-CoA synthetase, alpha subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|130091 TIGR01019, sucCoAalpha, succinyl-CoA synthetase, alpha subunit Back     alignment and domain information
>gnl|CDD|202320 pfam02629, CoA_binding, CoA binding domain Back     alignment and domain information
>gnl|CDD|214881 smart00881, CoA_binding, CoA binding domain Back     alignment and domain information
>gnl|CDD|178137 PLN02522, PLN02522, ATP citrate (pro-S)-lyase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 182
KOG1255 329 consensus Succinyl-CoA synthetase, alpha subunit [ 99.97
PTZ00187 317 succinyl-CoA synthetase alpha subunit; Provisional 99.97
COG0074 293 SucD Succinyl-CoA synthetase, alpha subunit [Energ 99.96
PLN00125 300 Succinyl-CoA ligase [GDP-forming] subunit alpha 99.9
TIGR01019 286 sucCoAalpha succinyl-CoA synthetase, alpha subunit 99.87
PF01113124 DapB_N: Dihydrodipicolinate reductase, N-terminus; 99.85
PRK05678 291 succinyl-CoA synthetase subunit alpha; Validated 99.84
PF0262996 CoA_binding: CoA binding domain; InterPro: IPR0037 99.78
COG0289 266 DapB Dihydrodipicolinate reductase [Amino acid tra 99.76
PLN02775 286 Probable dihydrodipicolinate reductase 99.72
TIGR02130 275 dapB_plant dihydrodipicolinate reductase. This nar 99.68
TIGR00036 266 dapB dihydrodipicolinate reductase. 99.67
PRK00048 257 dihydrodipicolinate reductase; Provisional 99.63
TIGR02717 447 AcCoA-syn-alpha acetyl coenzyme A synthetase (ADP 99.6
PLN02522 608 ATP citrate (pro-S)-lyase 99.59
COG1832140 Predicted CoA-binding protein [General function pr 99.51
PF13380116 CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5 99.49
COG2344211 AT-rich DNA-binding protein [General function pred 99.47
PF01408120 GFO_IDH_MocA: Oxidoreductase family, NAD-binding R 99.11
COG1042 598 Acyl-CoA synthetase (NDP forming) [Energy producti 98.96
PRK13303 265 L-aspartate dehydrogenase; Provisional 98.9
PRK05472213 redox-sensing transcriptional repressor Rex; Provi 98.82
PRK13304 265 L-aspartate dehydrogenase; Reviewed 98.74
PRK11579 346 putative oxidoreductase; Provisional 98.74
COG0673 342 MviM Predicted dehydrogenases and related proteins 98.61
PRK13302 271 putative L-aspartate dehydrogenase; Provisional 98.55
PRK10206 344 putative oxidoreductase; Provisional 98.52
PRK04207 341 glyceraldehyde-3-phosphate dehydrogenase; Provisio 98.4
TIGR01921 324 DAP-DH diaminopimelate dehydrogenase. This model r 98.37
PRK06270 341 homoserine dehydrogenase; Provisional 98.35
TIGR01761 343 thiaz-red thiazolinyl imide reductase. This reduct 98.27
PRK08374 336 homoserine dehydrogenase; Provisional 98.24
PRK06091 555 membrane protein FdrA; Validated 98.15
PRK06349 426 homoserine dehydrogenase; Provisional 98.07
PF03447117 NAD_binding_3: Homoserine dehydrogenase, NAD bindi 98.0
PLN02819 1042 lysine-ketoglutarate reductase/saccharopine dehydr 98.0
PTZ00431 260 pyrroline carboxylate reductase; Provisional 97.99
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 97.96
TIGR00465 314 ilvC ketol-acid reductoisomerase. This is the seco 97.95
PRK11880 267 pyrroline-5-carboxylate reductase; Reviewed 97.95
PRK12491 272 pyrroline-5-carboxylate reductase; Reviewed 97.94
PLN02688 266 pyrroline-5-carboxylate reductase 97.94
PRK07634 245 pyrroline-5-carboxylate reductase; Reviewed 97.93
PF01118121 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi 97.92
PRK06928 277 pyrroline-5-carboxylate reductase; Reviewed 97.9
PRK07679 279 pyrroline-5-carboxylate reductase; Reviewed 97.88
PRK05479 330 ketol-acid reductoisomerase; Provisional 97.88
PF07991165 IlvN: Acetohydroxy acid isomeroreductase, catalyti 97.87
PRK08300 302 acetaldehyde dehydrogenase; Validated 97.86
PRK00436 343 argC N-acetyl-gamma-glutamyl-phosphate reductase; 97.85
PRK13403 335 ketol-acid reductoisomerase; Provisional 97.85
TIGR03215 285 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylati 97.83
PRK07680 273 late competence protein ComER; Validated 97.8
PF0380796 F420_oxidored: NADP oxidoreductase coenzyme F420-d 97.76
PRK13301 267 putative L-aspartate dehydrogenase; Provisional 97.71
PRK12490 299 6-phosphogluconate dehydrogenase-like protein; Rev 97.71
PRK09599 301 6-phosphogluconate dehydrogenase-like protein; Rev 97.7
PRK14619 308 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 97.7
PRK14618 328 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 97.69
PRK06476 258 pyrroline-5-carboxylate reductase; Reviewed 97.68
KOG2741 351 consensus Dimeric dihydrodiol dehydrogenase [Carbo 97.59
PRK11559 296 garR tartronate semialdehyde reductase; Provisiona 97.59
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 97.59
TIGR00872 298 gnd_rel 6-phosphogluconate dehydrogenase (decarbox 97.58
COG1712 255 Predicted dinucleotide-utilizing enzyme [General f 97.52
PLN02256 304 arogenate dehydrogenase 97.52
COG0345 266 ProC Pyrroline-5-carboxylate reductase [Amino acid 97.5
TIGR01850 346 argC N-acetyl-gamma-glutamyl-phosphate reductase, 97.47
COG0059 338 IlvC Ketol-acid reductoisomerase [Amino acid trans 97.44
PRK06392 326 homoserine dehydrogenase; Provisional 97.42
PRK08605332 D-lactate dehydrogenase; Validated 97.42
TIGR03570201 NeuD_NnaD sugar O-acyltransferase, sialic acid O-a 97.41
COG0240 329 GpsA Glycerol-3-phosphate dehydrogenase [Energy pr 97.4
PF03435 386 Saccharop_dh: Saccharopine dehydrogenase ; InterPr 97.39
TIGR03855 229 NAD_NadX aspartate dehydrogenase. Members of this 97.38
TIGR01505 291 tartro_sem_red 2-hydroxy-3-oxopropionate reductase 97.38
PRK15059 292 tartronate semialdehyde reductase; Provisional 97.37
TIGR01915219 npdG NADPH-dependent F420 reductase. This model re 97.37
PRK08664 349 aspartate-semialdehyde dehydrogenase; Reviewed 97.36
TIGR00978 341 asd_EA aspartate-semialdehyde dehydrogenase (non-p 97.35
PRK00094 325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr 97.35
PRK07417 279 arogenate dehydrogenase; Reviewed 97.34
TIGR01692 288 HIBADH 3-hydroxyisobutyrate dehydrogenase. This en 97.33
PRK11199 374 tyrA bifunctional chorismate mutase/prephenate deh 97.3
TIGR03649 285 ergot_EASG ergot alkaloid biosynthesis protein, AF 97.29
PLN02968 381 Probable N-acetyl-gamma-glutamyl-phosphate reducta 97.28
PRK05671 336 aspartate-semialdehyde dehydrogenase; Reviewed 97.27
PRK14874 334 aspartate-semialdehyde dehydrogenase; Provisional 97.25
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 97.24
PF05368233 NmrA: NmrA-like family; InterPro: IPR008030 NmrA i 97.22
PRK06130 311 3-hydroxybutyryl-CoA dehydrogenase; Validated 97.22
PRK08655 437 prephenate dehydrogenase; Provisional 97.21
PF10727127 Rossmann-like: Rossmann-like domain; InterPro: IPR 97.21
PRK07574385 formate dehydrogenase; Provisional 97.19
COG1748 389 LYS9 Saccharopine dehydrogenase and related protei 97.17
TIGR03026 411 NDP-sugDHase nucleotide sugar dehydrogenase. All o 97.16
PLN03139386 formate dehydrogenase; Provisional 97.15
PLN02383 344 aspartate semialdehyde dehydrogenase 97.15
PRK15461 296 NADH-dependent gamma-hydroxybutyrate dehydrogenase 97.13
PRK12480330 D-lactate dehydrogenase; Provisional 97.1
PTZ00142 470 6-phosphogluconate dehydrogenase; Provisional 97.04
PRK06436303 glycerate dehydrogenase; Provisional 97.03
PF04321 286 RmlD_sub_bind: RmlD substrate binding domain; Inte 97.02
PLN02712 667 arogenate dehydrogenase 97.01
PRK14620 326 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 97.01
TIGR03023 451 WcaJ_sugtrans Undecaprenyl-phosphate glucose phosp 96.99
PRK08040 336 putative semialdehyde dehydrogenase; Provisional 96.99
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 96.96
PRK12439 341 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 96.95
PLN02545 295 3-hydroxybutyryl-CoA dehydrogenase 96.94
TIGR03025 445 EPS_sugtrans exopolysaccharide biosynthesis polypr 96.94
PRK06728 347 aspartate-semialdehyde dehydrogenase; Provisional 96.92
PTZ00345 365 glycerol-3-phosphate dehydrogenase; Provisional 96.9
TIGR00715 256 precor6x_red precorrin-6x reductase. This enzyme w 96.9
PRK06545 359 prephenate dehydrogenase; Validated 96.89
TIGR01296 339 asd_B aspartate-semialdehyde dehydrogenase (peptid 96.89
PRK05225 487 ketol-acid reductoisomerase; Validated 96.88
CHL00194 317 ycf39 Ycf39; Provisional 96.86
PRK07502 307 cyclohexadienyl dehydrogenase; Validated 96.86
TIGR03022 456 WbaP_sugtrans Undecaprenyl-phosphate galactose pho 96.84
PRK08507 275 prephenate dehydrogenase; Validated 96.84
PRK15204 476 undecaprenyl-phosphate galactose phosphotransferas 96.83
PRK07531 495 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe 96.82
PLN02712 667 arogenate dehydrogenase 96.81
PRK06444197 prephenate dehydrogenase; Provisional 96.8
PRK13243333 glyoxylate reductase; Reviewed 96.8
PRK08818 370 prephenate dehydrogenase; Provisional 96.8
TIGR01532 325 E4PD_g-proteo D-erythrose-4-phosphate dehydrogenas 96.75
PRK15469312 ghrA bifunctional glyoxylate/hydroxypyruvate reduc 96.75
PLN00016 378 RNA-binding protein; Provisional 96.74
PRK08410311 2-hydroxyacid dehydrogenase; Provisional 96.73
TIGR03376 342 glycerol3P_DH glycerol-3-phosphate dehydrogenase ( 96.72
TIGR01546 333 GAPDH-II_archae glyceraldehyde-3-phosphate dehydro 96.7
PLN02695 370 GDP-D-mannose-3',5'-epimerase 96.69
PRK15438 378 erythronate-4-phosphate dehydrogenase PdxB; Provis 96.69
TIGR01327 525 PGDH D-3-phosphoglycerate dehydrogenase. This mode 96.69
PLN02657 390 3,8-divinyl protochlorophyllide a 8-vinyl reductas 96.69
PRK00257 381 erythronate-4-phosphate dehydrogenase; Validated 96.68
TIGR00873 467 gnd 6-phosphogluconate dehydrogenase, decarboxylat 96.67
PRK08955 334 glyceraldehyde-3-phosphate dehydrogenase; Validate 96.67
PRK12921 305 2-dehydropantoate 2-reductase; Provisional 96.65
PLN02350 493 phosphogluconate dehydrogenase (decarboxylating) 96.65
COG0002 349 ArgC Acetylglutamate semialdehyde dehydrogenase [A 96.64
PRK06522 304 2-dehydropantoate 2-reductase; Reviewed 96.62
COG2084 286 MmsB 3-hydroxyisobutyrate dehydrogenase and relate 96.59
PRK05808 282 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.49
smart00846149 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, 96.48
TIGR01214 287 rmlD dTDP-4-dehydrorhamnose reductase. This enzyme 96.45
PRK11790 409 D-3-phosphoglycerate dehydrogenase; Provisional 96.43
PRK09260 288 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.43
KOG1203 411 consensus Predicted dehydrogenase [Carbohydrate tr 96.43
COG1091 281 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelo 96.41
PRK13581 526 D-3-phosphoglycerate dehydrogenase; Provisional 96.41
PRK14806 735 bifunctional cyclohexadienyl dehydrogenase/ 3-phos 96.4
PRK11863 313 N-acetyl-gamma-glutamyl-phosphate reductase; Provi 96.4
PRK09987 299 dTDP-4-dehydrorhamnose reductase; Provisional 96.39
PRK06932314 glycerate dehydrogenase; Provisional 96.37
PRK08293 287 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.35
PRK10124 463 putative UDP-glucose lipid carrier transferase; Pr 96.34
COG1086 588 Predicted nucleoside-diphosphate sugar epimerases 96.32
PRK06598 369 aspartate-semialdehyde dehydrogenase; Reviewed 96.3
PRK11064 415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro 96.3
PRK06035 291 3-hydroxyacyl-CoA dehydrogenase; Validated 96.26
PLN02928347 oxidoreductase family protein 96.23
PRK08229 341 2-dehydropantoate 2-reductase; Provisional 96.19
TIGR01851 310 argC_other N-acetyl-gamma-glutamyl-phosphate reduc 96.19
TIGR03013 442 EpsB_2 sugar transferase, PEP-CTERM system associa 96.17
COG0111324 SerA Phosphoglycerate dehydrogenase and related de 96.17
PLN03209 576 translocon at the inner envelope of chloroplast su 96.14
TIGR01179 328 galE UDP-glucose-4-epimerase. This enzyme intercon 96.09
cd05211217 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of 96.08
PRK07530 292 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.07
PLN02166 436 dTDP-glucose 4,6-dehydratase 96.06
PRK06813 346 homoserine dehydrogenase; Validated 96.05
PLN00141251 Tic62-NAD(P)-related group II protein; Provisional 96.02
COG0057 335 GapA Glyceraldehyde-3-phosphate dehydrogenase/eryt 96.01
cd01492197 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit 96.0
COG2910211 Putative NADH-flavin reductase [General function p 95.91
PF13727175 CoA_binding_3: CoA-binding domain; PDB: 3NKL_B. 95.9
PRK10675 338 UDP-galactose-4-epimerase; Provisional 95.9
TIGR03466 328 HpnA hopanoid-associated sugar epimerase. The sequ 95.85
PLN02858 1378 fructose-bisphosphate aldolase 95.82
PRK06487317 glycerate dehydrogenase; Provisional 95.81
PRK15409323 bifunctional glyoxylate/hydroxypyruvate reductase 95.77
PLN02858 1378 fructose-bisphosphate aldolase 95.75
PLN02240 352 UDP-glucose 4-epimerase 95.72
PRK15181 348 Vi polysaccharide biosynthesis protein TviC; Provi 95.71
TIGR00936406 ahcY adenosylhomocysteinase. This enzyme hydrolyze 95.66
PRK05476425 S-adenosyl-L-homocysteine hydrolase; Provisional 95.66
cd01485198 E1-1_like Ubiquitin activating enzyme (E1), repeat 95.66
PRK12557 342 H(2)-dependent methylenetetrahydromethanopterin de 95.61
PRK06249 313 2-dehydropantoate 2-reductase; Provisional 95.57
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain 95.56
PRK07066 321 3-hydroxybutyryl-CoA dehydrogenase; Validated 95.52
PRK08223 287 hypothetical protein; Validated 95.51
smart00859122 Semialdhyde_dh Semialdehyde dehydrogenase, NAD bin 95.5
PRK06182 273 short chain dehydrogenase; Validated 95.49
TIGR01777 292 yfcH conserved hypothetical protein TIGR01777. Thi 95.47
PRK12829 264 short chain dehydrogenase; Provisional 95.42
PF00899135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 95.41
PF03721185 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen 95.41
PRK13535 336 erythrose 4-phosphate dehydrogenase; Provisional 95.4
PLN02725 306 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductas 95.39
COG0287 279 TyrA Prephenate dehydrogenase [Amino acid transpor 95.37
TIGR02622 349 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member 95.34
PF00044151 Gp_dh_N: Glyceraldehyde 3-phosphate dehydrogenase, 95.33
COG4693 361 PchG Oxidoreductase (NAD-binding), involved in sid 95.32
COG0136 334 Asd Aspartate-semialdehyde dehydrogenase [Amino ac 95.23
TIGR01181 317 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase. This 95.23
PRK12825 249 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 95.21
PLN02696 454 1-deoxy-D-xylulose-5-phosphate reductoisomerase 95.21
PLN02214 342 cinnamoyl-CoA reductase 95.2
PRK06129 308 3-hydroxyacyl-CoA dehydrogenase; Validated 95.19
PRK12475 338 thiamine/molybdopterin biosynthesis MoeB-like prot 95.17
PRK05447 385 1-deoxy-D-xylulose 5-phosphate reductoisomerase; P 95.14
PRK12320 699 hypothetical protein; Provisional 95.12
PRK10538 248 malonic semialdehyde reductase; Provisional 95.12
PRK09414445 glutamate dehydrogenase; Provisional 95.1
PRK12828 239 short chain dehydrogenase; Provisional 94.99
TIGR01745 366 asd_gamma aspartate-semialdehyde dehydrogenase, ga 94.96
PRK07577 234 short chain dehydrogenase; Provisional 94.95
COG3804 350 Uncharacterized conserved protein related to dihyd 94.95
PRK00683 418 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 94.95
PRK06139 330 short chain dehydrogenase; Provisional 94.93
PRK06953 222 short chain dehydrogenase; Provisional 94.92
PLN02662 322 cinnamyl-alcohol dehydrogenase family protein 94.89
PRK12938 246 acetyacetyl-CoA reductase; Provisional 94.89
PRK06179 270 short chain dehydrogenase; Provisional 94.87
PRK05865 854 hypothetical protein; Provisional 94.84
PRK08278 273 short chain dehydrogenase; Provisional 94.79
COG0569225 TrkA K+ transport systems, NAD-binding component [ 94.78
PRK09186 256 flagellin modification protein A; Provisional 94.75
PRK07231 251 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 94.75
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 94.71
PRK05993 277 short chain dehydrogenase; Provisional 94.68
TIGR02355240 moeB molybdopterin synthase sulfurylase MoeB. This 94.67
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 94.66
PLN02778 298 3,5-epimerase/4-reductase 94.65
PRK08328231 hypothetical protein; Provisional 94.65
TIGR02356202 adenyl_thiF thiazole biosynthesis adenylyltransfer 94.61
PRK06523 260 short chain dehydrogenase; Provisional 94.6
PRK06138 252 short chain dehydrogenase; Provisional 94.6
PRK06180 277 short chain dehydrogenase; Provisional 94.58
PRK06057 255 short chain dehydrogenase; Provisional 94.56
PRK07890 258 short chain dehydrogenase; Provisional 94.54
PRK07819 286 3-hydroxybutyryl-CoA dehydrogenase; Validated 94.52
PRK08177 225 short chain dehydrogenase; Provisional 94.51
cd01483143 E1_enzyme_family Superfamily of activating enzymes 94.51
PRK05693 274 short chain dehydrogenase; Provisional 94.48
PTZ00023 337 glyceraldehyde-3-phosphate dehydrogenase; Provisio 94.48
COG1086 588 Predicted nucleoside-diphosphate sugar epimerases 94.47
PRK12827 249 short chain dehydrogenase; Provisional 94.47
PRK12744 257 short chain dehydrogenase; Provisional 94.46
PRK07454 241 short chain dehydrogenase; Provisional 94.45
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General 94.44
PRK07814 263 short chain dehydrogenase; Provisional 94.42
PLN03096 395 glyceraldehyde-3-phosphate dehydrogenase A; Provis 94.4
PRK06398 258 aldose dehydrogenase; Validated 94.4
COG2085211 Predicted dinucleotide-binding enzymes [General fu 94.4
PRK05690245 molybdopterin biosynthesis protein MoeB; Provision 94.39
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 94.37
KOG0023360 consensus Alcohol dehydrogenase, class V [Secondar 94.33
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 94.33
PRK08340 259 glucose-1-dehydrogenase; Provisional 94.31
PLN02206 442 UDP-glucuronate decarboxylase 94.26
PRK09466 810 metL bifunctional aspartate kinase II/homoserine d 94.23
PLN02306386 hydroxypyruvate reductase 94.22
PRK09436 819 thrA bifunctional aspartokinase I/homoserine dehyd 94.22
PRK12429 258 3-hydroxybutyrate dehydrogenase; Provisional 94.21
PRK08057 248 cobalt-precorrin-6x reductase; Reviewed 94.21
PRK15057 388 UDP-glucose 6-dehydrogenase; Provisional 94.19
COG0460 333 ThrA Homoserine dehydrogenase [Amino acid transpor 94.19
PRK05653 246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 94.17
PLN02572 442 UDP-sulfoquinovose synthase 94.16
PRK05884 223 short chain dehydrogenase; Provisional 94.13
PLN02583 297 cinnamoyl-CoA reductase 94.12
PLN02494 477 adenosylhomocysteinase 94.12
PRK07985 294 oxidoreductase; Provisional 94.11
PRK05557 248 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 94.02
PLN02358 338 glyceraldehyde-3-phosphate dehydrogenase 94.01
PRK15182 425 Vi polysaccharide biosynthesis protein TviB; Provi 94.01
PRK08267 260 short chain dehydrogenase; Provisional 93.98
PLN02260 668 probable rhamnose biosynthetic enzyme 93.98
PRK06841 255 short chain dehydrogenase; Provisional 93.97
PRK07825 273 short chain dehydrogenase; Provisional 93.95
PRK15425 331 gapA glyceraldehyde-3-phosphate dehydrogenase A; P 93.89
PRK07326 237 short chain dehydrogenase; Provisional 93.88
PF1008797 DUF2325: Uncharacterized protein conserved in bact 93.83
PRK12939 250 short chain dehydrogenase; Provisional 93.82
PRK06500 249 short chain dehydrogenase; Provisional 93.8
PRK12745 256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 93.74
TIGR01472 343 gmd GDP-mannose 4,6-dehydratase. Excluded from thi 93.74
PRK07878 392 molybdopterin biosynthesis-like protein MoeZ; Vali 93.74
PRK07729 343 glyceraldehyde-3-phosphate dehydrogenase; Validate 93.74
PRK09496 453 trkA potassium transporter peripheral membrane com 93.69
PF02558151 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: 93.69
PRK08217 253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 93.66
PRK06172 253 short chain dehydrogenase; Provisional 93.61
COG0451 314 WcaG Nucleoside-diphosphate-sugar epimerases [Cell 93.6
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 93.57
PLN02896 353 cinnamyl-alcohol dehydrogenase 93.57
PRK06124 256 gluconate 5-dehydrogenase; Provisional 93.56
TIGR01832 248 kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod 93.52
PRK08703 239 short chain dehydrogenase; Provisional 93.51
PRK08642 253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 93.49
PRK12746 254 short chain dehydrogenase; Provisional 93.49
PLN02427 386 UDP-apiose/xylose synthase 93.47
PF02670129 DXP_reductoisom: 1-deoxy-D-xylulose 5-phosphate re 93.45
PF01073 280 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/iso 93.4
cd00757228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 93.39
PRK10084 352 dTDP-glucose 4,6 dehydratase; Provisional 93.36
PLN02653 340 GDP-mannose 4,6-dehydratase 93.34
PRK06171 266 sorbitol-6-phosphate 2-dehydrogenase; Provisional 93.29
PRK07774 250 short chain dehydrogenase; Provisional 93.29
TIGR03589 324 PseB UDP-N-acetylglucosamine 4,6-dehydratase. This 93.28
TIGR00243 389 Dxr 1-deoxy-D-xylulose 5-phosphate reductoisomeras 93.26
PRK07523 255 gluconate 5-dehydrogenase; Provisional 93.25
PRK06194 287 hypothetical protein; Provisional 93.23
TIGR01724 341 hmd_rel H2-forming N(5),N(10)-methenyltetrahydrome 93.2
PRK10217 355 dTDP-glucose 4,6-dehydratase; Provisional 93.17
PRK07688 339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 93.17
PRK06198 260 short chain dehydrogenase; Provisional 93.13
COG2099 257 CobK Precorrin-6x reductase [Coenzyme metabolism] 93.12
PLN02650 351 dihydroflavonol-4-reductase 93.1
PRK07403 337 glyceraldehyde-3-phosphate dehydrogenase; Reviewed 93.09
PLN02986 322 cinnamyl-alcohol dehydrogenase family protein 93.09
PRK11150 308 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Pro 93.07
PRK05872 296 short chain dehydrogenase; Provisional 93.06
PRK08085 254 gluconate 5-dehydrogenase; Provisional 93.05
KOG0409 327 consensus Predicted dehydrogenase [General functio 93.04
PRK01710 458 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 93.03
PRK06463 255 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 93.02
PRK11908 347 NAD-dependent epimerase/dehydratase family protein 93.02
PRK06719157 precorrin-2 dehydrogenase; Validated 93.02
PRK07109 334 short chain dehydrogenase; Provisional 93.01
PLN02272 421 glyceraldehyde-3-phosphate dehydrogenase 92.99
PRK07060 245 short chain dehydrogenase; Provisional 92.99
PRK05867 253 short chain dehydrogenase; Provisional 92.98
cd01487174 E1_ThiF_like E1_ThiF_like. Member of superfamily o 92.96
COG1052324 LdhA Lactate dehydrogenase and related dehydrogena 92.96
cd01076227 NAD_bind_1_Glu_DH NAD(P) binding domain of glutama 92.93
PTZ00075 476 Adenosylhomocysteinase; Provisional 92.89
cd01491 286 Ube1_repeat1 Ubiquitin activating enzyme (E1), rep 92.86
PRK08017 256 oxidoreductase; Provisional 92.83
PRK05650 270 short chain dehydrogenase; Provisional 92.79
PRK06901 322 aspartate-semialdehyde dehydrogenase; Provisional 92.78
PRK12826 251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 92.76
PF01370236 Epimerase: NAD dependent epimerase/dehydratase fam 92.76
KOG4039238 consensus Serine/threonine kinase TIP30/CC3 [Signa 92.74
PRK14031444 glutamate dehydrogenase; Provisional 92.74
PLN02989 325 cinnamyl-alcohol dehydrogenase family protein 92.72
PRK05565 247 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 92.71
PRK05786 238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 92.71
PRK07062 265 short chain dehydrogenase; Provisional 92.68
PRK08993 253 2-deoxy-D-gluconate 3-dehydrogenase; Validated 92.67
TIGR02197 314 heptose_epim ADP-L-glycero-D-manno-heptose-6-epime 92.66
PF07755 301 DUF1611: Protein of unknown function (DUF1611); In 92.65
PRK12481 251 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 92.63
PRK06935 258 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 92.62
cd00755231 YgdL_like Family of activating enzymes (E1) of ubi 92.61
TIGR03325 262 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro 92.61
PTZ00325 321 malate dehydrogenase; Provisional 92.57
COG1810 224 Uncharacterized protein conserved in archaea [Func 92.57
PRK13394 262 3-hydroxybutyrate dehydrogenase; Provisional 92.56
PRK07024 257 short chain dehydrogenase; Provisional 92.54
PRK07677 252 short chain dehydrogenase; Provisional 92.51
PRK08226 263 short chain dehydrogenase; Provisional 92.48
PRK07904 253 short chain dehydrogenase; Provisional 92.48
COG0300 265 DltE Short-chain dehydrogenases of various substra 92.47
PRK09135 249 pteridine reductase; Provisional 92.45
PF02571 249 CbiJ: Precorrin-6x reductase CbiJ/CobK; InterPro: 92.45
PRK05597 355 molybdopterin biosynthesis protein MoeB; Validated 92.45
PRK08306296 dipicolinate synthase subunit A; Reviewed 92.44
PRK07666 239 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 92.43
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 92.42
TIGR02279 503 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa 92.41
PRK07063 260 short chain dehydrogenase; Provisional 92.41
PTZ00434 361 cytosolic glyceraldehyde 3-phosphate dehydrogenase 92.41
PRK07576 264 short chain dehydrogenase; Provisional 92.39
PRK05717 255 oxidoreductase; Validated 92.3
PRK12937 245 short chain dehydrogenase; Provisional 92.26
PRK12823 260 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylat 92.23
PRK07806 248 short chain dehydrogenase; Provisional 92.23
PRK08213 259 gluconate 5-dehydrogenase; Provisional 92.22
PRK06924 251 short chain dehydrogenase; Provisional 92.18
PRK05876 275 short chain dehydrogenase; Provisional 92.17
PRK08261 450 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 92.17
PRK08862 227 short chain dehydrogenase; Provisional 92.15
PRK12936 245 3-ketoacyl-(acyl-carrier-protein) reductase NodG; 92.09
KOG1502 327 consensus Flavonol reductase/cinnamoyl-CoA reducta 92.08
PRK06181 263 short chain dehydrogenase; Provisional 92.08
TIGR03206 250 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr 92.08
PRK09242 257 tropinone reductase; Provisional 92.03
PRK05866 293 short chain dehydrogenase; Provisional 92.03
PRK08125 660 bifunctional UDP-glucuronic acid decarboxylase/UDP 92.03
PRK12742 237 oxidoreductase; Provisional 92.02
PRK03562621 glutathione-regulated potassium-efflux system prot 92.01
COG4091 438 Predicted homoserine dehydrogenase [Amino acid tra 92.0
PRK05875 276 short chain dehydrogenase; Provisional 91.99
PRK03659601 glutathione-regulated potassium-efflux system prot 91.99
PRK07831 262 short chain dehydrogenase; Provisional 91.96
PRK07067 257 sorbitol dehydrogenase; Provisional 91.94
PRK00421 461 murC UDP-N-acetylmuramate--L-alanine ligase; Provi 91.94
PF02719 293 Polysacc_synt_2: Polysaccharide biosynthesis prote 91.92
PRK14106 450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 91.91
PRK12384 259 sorbitol-6-phosphate dehydrogenase; Provisional 91.88
PRK07578199 short chain dehydrogenase; Provisional 91.85
PRK02472 447 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 91.84
PRK09072 263 short chain dehydrogenase; Provisional 91.84
PLN02260 668 probable rhamnose biosynthetic enzyme 91.84
PRK08268 507 3-hydroxy-acyl-CoA dehydrogenase; Validated 91.81
PLN02700 377 homoserine dehydrogenase family protein 91.79
PRK12935 247 acetoacetyl-CoA reductase; Provisional 91.79
PRK06200 263 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog 91.78
PRK07035 252 short chain dehydrogenase; Provisional 91.78
PRK07102 243 short chain dehydrogenase; Provisional 91.77
PRK08220 252 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated 91.72
PRK09287 459 6-phosphogluconate dehydrogenase; Validated 91.69
PRK08945 247 putative oxoacyl-(acyl carrier protein) reductase; 91.66
PTZ00079454 NADP-specific glutamate dehydrogenase; Provisional 91.64
PRK08628 258 short chain dehydrogenase; Provisional 91.63
PRK07453 322 protochlorophyllide oxidoreductase; Validated 91.62
PRK07069 251 short chain dehydrogenase; Validated 91.6
PRK07074 257 short chain dehydrogenase; Provisional 91.58
PRK08643 256 acetoin reductase; Validated 91.57
COG0702 275 Predicted nucleoside-diphosphate-sugar epimerases 91.54
TIGR01746 367 Thioester-redct thioester reductase domain. It has 91.53
PRK08265 261 short chain dehydrogenase; Provisional 91.52
PRK08416 260 7-alpha-hydroxysteroid dehydrogenase; Provisional 91.52
PRK06114 254 short chain dehydrogenase; Provisional 91.5
PRK15116 268 sulfur acceptor protein CsdL; Provisional 91.37
PRK08644212 thiamine biosynthesis protein ThiF; Provisional 91.36
TIGR00112 245 proC pyrroline-5-carboxylate reductase. This enzym 91.34
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 91.34
PRK07411 390 hypothetical protein; Validated 91.32
PRK07877 722 hypothetical protein; Provisional 91.31
PRK08277 278 D-mannonate oxidoreductase; Provisional 91.29
PRK06482 276 short chain dehydrogenase; Provisional 91.27
TIGR00640132 acid_CoA_mut_C methylmalonyl-CoA mutase C-terminal 91.25
TIGR01963 255 PHB_DH 3-hydroxybutyrate dehydrogenase. This model 91.23
PRK09496453 trkA potassium transporter peripheral membrane com 91.21
PRK07478 254 short chain dehydrogenase; Provisional 91.16
KOG1254 600 consensus ATP-citrate lyase [Energy production and 91.15
PLN02477410 glutamate dehydrogenase 91.14
PRK08264 238 short chain dehydrogenase; Validated 91.13
PRK08263 275 short chain dehydrogenase; Provisional 91.12
PRK07791 286 short chain dehydrogenase; Provisional 91.11
cd01493 425 APPBP1_RUB Ubiquitin activating enzyme (E1) subuni 91.05
PRK07832 272 short chain dehydrogenase; Provisional 91.02
PRK09291 257 short chain dehydrogenase; Provisional 90.95
PRK12743 256 oxidoreductase; Provisional 90.91
PRK06914 280 short chain dehydrogenase; Provisional 90.87
PRK08324 681 short chain dehydrogenase; Validated 90.86
PRK06128 300 oxidoreductase; Provisional 90.83
), forming GARS-AIRS-GART. This entry represents the N-domain, which is related to the N-terminal domain of biotin carboxylase/carbamoyl phosphate synthetase (IPR005481 from INTERPRO).; GO: 0004637 phosphoribosylamine-glycine ligase activity, 0009113 purine base biosynthetic process; PDB: 3MJF_A 2XD4_A 2XCL_A 2IP4_A 2YW2_B 2YYA_A 3LP8_A 1VKZ_A 2YS6_A 2YRX_A ...." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF02844">PF02844100 GARS_N: Phosphoribosylglycinamide synthetase, N do 90.8
PLN02253 280 xanthoxin dehydrogenase 90.78
PRK06718202 precorrin-2 dehydrogenase; Reviewed 90.75
TIGR02964246 xanthine_xdhC xanthine dehydrogenase accessory pro 90.65
PRK05086 312 malate dehydrogenase; Provisional 90.55
PRK06196 315 oxidoreductase; Provisional 90.51
PRK00141 473 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 90.47
PRK03803 448 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 90.46
PRK06079 252 enoyl-(acyl carrier protein) reductase; Provisiona 90.46
PRK08618325 ornithine cyclodeaminase; Validated 90.43
PRK08309177 short chain dehydrogenase; Provisional 90.41
TIGR01534 327 GAPDH-I glyceraldehyde-3-phosphate dehydrogenase, 90.41
PRK07023 243 short chain dehydrogenase; Provisional 90.39
PRK12824 245 acetoacetyl-CoA reductase; Provisional 90.38
PRK05600 370 thiamine biosynthesis protein ThiF; Validated 90.38
PLN00203 519 glutamyl-tRNA reductase 90.32
PRK08589 272 short chain dehydrogenase; Validated 90.31
PRK06947 248 glucose-1-dehydrogenase; Provisional 90.3
PRK06077 252 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 90.3
TIGR01087 433 murD UDP-N-acetylmuramoylalanine--D-glutamate liga 90.29
PF08484160 Methyltransf_14: C-methyltransferase C-terminal do 90.26
TIGR01763 305 MalateDH_bact malate dehydrogenase, NAD-dependent. 90.25
PRK08762 376 molybdopterin biosynthesis protein MoeB; Validated 90.18
PRK07792 306 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 90.1
PRK05855 582 short chain dehydrogenase; Validated 90.09
PRK06550 235 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 90.07
PRK14030445 glutamate dehydrogenase; Provisional 90.06
PRK06483 236 dihydromonapterin reductase; Provisional 89.97
PRK09134 258 short chain dehydrogenase; Provisional 89.9
COG1023 300 Gnd Predicted 6-phosphogluconate dehydrogenase [Ca 89.88
PRK08063 250 enoyl-(acyl carrier protein) reductase; Provisiona 89.88
TIGR03026411 NDP-sugDHase nucleotide sugar dehydrogenase. All o 89.86
PRK06701 290 short chain dehydrogenase; Provisional 89.83
cd01484234 E1-2_like Ubiquitin activating enzyme (E1), repeat 89.77
PRK05708 305 2-dehydropantoate 2-reductase; Provisional 89.72
PRK06197 306 short chain dehydrogenase; Provisional 89.68
PRK06484 520 short chain dehydrogenase; Validated 89.58
PLN02237 442 glyceraldehyde-3-phosphate dehydrogenase B 89.56
PTZ00117 319 malate dehydrogenase; Provisional 89.54
PRK08289 477 glyceraldehyde-3-phosphate dehydrogenase; Reviewed 89.53
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 89.51
COG4569 310 MhpF Acetaldehyde dehydrogenase (acetylating) [Sec 89.46
TIGR01202308 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyl 89.46
PLN02686 367 cinnamoyl-CoA reductase 89.44
KOG1014 312 consensus 17 beta-hydroxysteroid dehydrogenase typ 89.44
PF07085105 DRTGG: DRTGG domain; InterPro: IPR010766 This pres 89.37
>KOG1255 consensus Succinyl-CoA synthetase, alpha subunit [Energy production and conversion] Back     alignment and domain information 
Probab=99.97  E-value=1e-31  Score=231.57  Aligned_cols=129  Identities=65%  Similarity=0.982  Sum_probs=121.4

Q ss_pred             cccccccccccccCCCCCeeeecCCceEEEEccCCCCchhhhHHHHHhCCceEEeeccCCCCCeEecCccccccHHHHHh
Q 030169           34 APAAHSRNYGSSAAASHPAVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVVGGVTPKKGGTEHLGLPVFNSVAEAKA  113 (182)
Q Consensus        34 ~~~~~~~~~~~~~~~~~~~~li~~~trViVvG~tGkmG~~v~k~~~~~g~~IV~AgVdp~~~G~~i~GvPVy~Sv~ea~~  113 (182)
                      ++....|.+.|.|.+|+.++++++++||++||||||+|+++.+.+++||+++| +|++|++.|+++.|+|||.|++|+.+
T Consensus        14 ~~~~~~~~~~s~y~~T~~nl~ink~TkVi~QGfTGKqgTFHs~q~~eYgTk~V-gG~~pkK~Gt~HLG~PVF~sV~eA~~   92 (329)
T KOG1255|consen   14 LSLGILRVFKSLYNKTISNLKINKDTKVICQGFTGKQGTFHSQQALEYGTKVV-GGVNPKKGGTTHLGLPVFNSVAEAKK   92 (329)
T ss_pred             cCcchhhhhcchhhhhhhceeecCCceEEEecccCCccceeHHHHHHhCCcee-eccCCCcCcccccCchhhhhHHHHHH
Confidence            33344555567888999999999999999999999999999999999999999 99999999999999999999999999


Q ss_pred             ccCCcEEEEeeChHHHHHHHHHHHHcCCCEEEEeCCCCCHHHHHHHHHHh
Q 030169          114 ETKANASVIYVPPPFAAAAIMEAMEAELDLVVCITEGIPQHDMVINFTRV  163 (182)
Q Consensus       114 ~~~~DvaVdfVpp~av~~a~~eAie~GIk~VV~iTeG~~~eD~~~l~~~a  163 (182)
                      ++++|+.++||||..+..+++||+|+.|++|||||||+|.|||.++.++-
T Consensus        93 ~t~a~AsvIyVPpp~Aa~aI~eaieaEipLiVcITEGIPQhDMvrvk~~L  142 (329)
T KOG1255|consen   93 ETGADASVIYVPPPFAAAAIEEAIEAEIPLIVCITEGIPQHDMVRVKHAL  142 (329)
T ss_pred             hhCCCceEEEeCChhHHHHHHHHHhccCCEEEEecCCCchhhHHHHHHHH
Confidence            99999999999999999999999999999999999999999999998765

>PTZ00187 succinyl-CoA synthetase alpha subunit; Provisional Back     alignment and domain information
>COG0074 SucD Succinyl-CoA synthetase, alpha subunit [Energy production and conversion] Back     alignment and domain information
>PLN00125 Succinyl-CoA ligase [GDP-forming] subunit alpha Back     alignment and domain information
>TIGR01019 sucCoAalpha succinyl-CoA synthetase, alpha subunit Back     alignment and domain information
>PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] Back     alignment and domain information
>PRK05678 succinyl-CoA synthetase subunit alpha; Validated Back     alignment and domain information
>PF02629 CoA_binding: CoA binding domain; InterPro: IPR003781 This domain has a Rossmann fold and is found in a number of proteins including succinyl CoA synthetases, malate and ATP-citrate ligases Back     alignment and domain information
>COG0289 DapB Dihydrodipicolinate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02775 Probable dihydrodipicolinate reductase Back     alignment and domain information
>TIGR02130 dapB_plant dihydrodipicolinate reductase Back     alignment and domain information
>TIGR00036 dapB dihydrodipicolinate reductase Back     alignment and domain information
>PRK00048 dihydrodipicolinate reductase; Provisional Back     alignment and domain information
>TIGR02717 AcCoA-syn-alpha acetyl coenzyme A synthetase (ADP forming), alpha domain Back     alignment and domain information
>PLN02522 ATP citrate (pro-S)-lyase Back     alignment and domain information
>COG1832 Predicted CoA-binding protein [General function prediction only] Back     alignment and domain information
>PF13380 CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5A_A 2D59_A 2E6U_X 1IUL_A 1IUK_A 1Y81_A 2DUW_A Back     alignment and domain information
>COG2344 AT-rich DNA-binding protein [General function prediction only] Back     alignment and domain information
>PF01408 GFO_IDH_MocA: Oxidoreductase family, NAD-binding Rossmann fold; InterPro: IPR000683 This group of enzymes utilise NADP or NAD, and is known as the GFO/IDH/MOCA family in UniProtKB/Swiss-Prot Back     alignment and domain information
>COG1042 Acyl-CoA synthetase (NDP forming) [Energy production and conversion] Back     alignment and domain information
>PRK13303 L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK05472 redox-sensing transcriptional repressor Rex; Provisional Back     alignment and domain information
>PRK13304 L-aspartate dehydrogenase; Reviewed Back     alignment and domain information
>PRK11579 putative oxidoreductase; Provisional Back     alignment and domain information
>COG0673 MviM Predicted dehydrogenases and related proteins [General function prediction only] Back     alignment and domain information
>PRK13302 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK10206 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK04207 glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01921 DAP-DH diaminopimelate dehydrogenase Back     alignment and domain information
>PRK06270 homoserine dehydrogenase; Provisional Back     alignment and domain information
>TIGR01761 thiaz-red thiazolinyl imide reductase Back     alignment and domain information
>PRK08374 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PRK06091 membrane protein FdrA; Validated Back     alignment and domain information
>PRK06349 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PF03447 NAD_binding_3: Homoserine dehydrogenase, NAD binding domain; InterPro: IPR005106 Bacteria, plants and fungi metabolise aspartic acid to produce four amino acids - lysine, threonine, methionine and isoleucine - in a series of reactions known as the aspartate pathway Back     alignment and domain information
>PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase Back     alignment and domain information
>PTZ00431 pyrroline carboxylate reductase; Provisional Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>TIGR00465 ilvC ketol-acid reductoisomerase Back     alignment and domain information
>PRK11880 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK12491 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PLN02688 pyrroline-5-carboxylate reductase Back     alignment and domain information
>PRK07634 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate Back     alignment and domain information
>PRK06928 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK07679 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK05479 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>PF07991 IlvN: Acetohydroxy acid isomeroreductase, catalytic domain; InterPro: IPR013116 Acetohydroxy acid isomeroreductase catalyses the conversion of acetohydroxy acids into dihydroxy valerates Back     alignment and domain information
>PRK08300 acetaldehyde dehydrogenase; Validated Back     alignment and domain information
>PRK00436 argC N-acetyl-gamma-glutamyl-phosphate reductase; Validated Back     alignment and domain information
>PRK13403 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>TIGR03215 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylating) Back     alignment and domain information
>PRK07680 late competence protein ComER; Validated Back     alignment and domain information
>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain Back     alignment and domain information
>PRK13301 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK06476 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>KOG2741 consensus Dimeric dihydrodiol dehydrogenase [Carbohydrate transport and metabolism; Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK11559 garR tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>COG1712 Predicted dinucleotide-utilizing enzyme [General function prediction only] Back     alignment and domain information
>PLN02256 arogenate dehydrogenase Back     alignment and domain information
>COG0345 ProC Pyrroline-5-carboxylate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01850 argC N-acetyl-gamma-glutamyl-phosphate reductase, common form Back     alignment and domain information
>COG0059 IlvC Ketol-acid reductoisomerase [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PRK06392 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PRK08605 D-lactate dehydrogenase; Validated Back     alignment and domain information
>TIGR03570 NeuD_NnaD sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family Back     alignment and domain information
>COG0240 GpsA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase Back     alignment and domain information
>TIGR03855 NAD_NadX aspartate dehydrogenase Back     alignment and domain information
>TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase Back     alignment and domain information
>PRK15059 tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>TIGR01915 npdG NADPH-dependent F420 reductase Back     alignment and domain information
>PRK08664 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>TIGR00978 asd_EA aspartate-semialdehyde dehydrogenase (non-peptidoglycan organisms) Back     alignment and domain information
>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK07417 arogenate dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01692 HIBADH 3-hydroxyisobutyrate dehydrogenase Back     alignment and domain information
>PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional Back     alignment and domain information
>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family Back     alignment and domain information
>PLN02968 Probable N-acetyl-gamma-glutamyl-phosphate reductase Back     alignment and domain information
>PRK05671 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PRK14874 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA Back     alignment and domain information
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK08655 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins Back     alignment and domain information
>PRK07574 formate dehydrogenase; Provisional Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase Back     alignment and domain information
>PLN03139 formate dehydrogenase; Provisional Back     alignment and domain information
>PLN02383 aspartate semialdehyde dehydrogenase Back     alignment and domain information
>PRK15461 NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK12480 D-lactate dehydrogenase; Provisional Back     alignment and domain information
>PTZ00142 6-phosphogluconate dehydrogenase; Provisional Back     alignment and domain information
>PRK06436 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PF04321 RmlD_sub_bind: RmlD substrate binding domain; InterPro: IPR005913 dTDP-4-dehydrorhamnose reductase (1 Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR03023 WcaJ_sugtrans Undecaprenyl-phosphate glucose phosphotransferase Back     alignment and domain information
>PRK08040 putative semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>PRK12439 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PLN02545 3-hydroxybutyryl-CoA dehydrogenase Back     alignment and domain information
>TIGR03025 EPS_sugtrans exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase Back     alignment and domain information
>PRK06728 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PTZ00345 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR00715 precor6x_red precorrin-6x reductase Back     alignment and domain information
>PRK06545 prephenate dehydrogenase; Validated Back     alignment and domain information
>TIGR01296 asd_B aspartate-semialdehyde dehydrogenase (peptidoglycan organisms) Back     alignment and domain information
>PRK05225 ketol-acid reductoisomerase; Validated Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>PRK07502 cyclohexadienyl dehydrogenase; Validated Back     alignment and domain information
>TIGR03022 WbaP_sugtrans Undecaprenyl-phosphate galactose phosphotransferase, WbaP Back     alignment and domain information
>PRK08507 prephenate dehydrogenase; Validated Back     alignment and domain information
>PRK15204 undecaprenyl-phosphate galactose phosphotransferase; Provisional Back     alignment and domain information
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>PRK06444 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK13243 glyoxylate reductase; Reviewed Back     alignment and domain information
>PRK08818 prephenate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01532 E4PD_g-proteo D-erythrose-4-phosphate dehydrogenase Back     alignment and domain information
>PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional Back     alignment and domain information
>PLN00016 RNA-binding protein; Provisional Back     alignment and domain information
>PRK08410 2-hydroxyacid dehydrogenase; Provisional Back     alignment and domain information
>TIGR03376 glycerol3P_DH glycerol-3-phosphate dehydrogenase (NAD(+)) Back     alignment and domain information
>TIGR01546 GAPDH-II_archae glyceraldehyde-3-phosphate dehydrogenase, type II Back     alignment and domain information
>PLN02695 GDP-D-mannose-3',5'-epimerase Back     alignment and domain information
>PRK15438 erythronate-4-phosphate dehydrogenase PdxB; Provisional Back     alignment and domain information
>TIGR01327 PGDH D-3-phosphoglycerate dehydrogenase Back     alignment and domain information
>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase Back     alignment and domain information
>PRK00257 erythronate-4-phosphate dehydrogenase; Validated Back     alignment and domain information
>TIGR00873 gnd 6-phosphogluconate dehydrogenase, decarboxylating Back     alignment and domain information
>PRK08955 glyceraldehyde-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK12921 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PLN02350 phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>COG0002 ArgC Acetylglutamate semialdehyde dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06522 2-dehydropantoate 2-reductase; Reviewed Back     alignment and domain information
>COG2084 MmsB 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism] Back     alignment and domain information
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>smart00846 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain Back     alignment and domain information
>TIGR01214 rmlD dTDP-4-dehydrorhamnose reductase Back     alignment and domain information
>PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>KOG1203 consensus Predicted dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG1091 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK14806 bifunctional cyclohexadienyl dehydrogenase/ 3-phosphoshikimate 1-carboxyvinyltransferase; Provisional Back     alignment and domain information
>PRK11863 N-acetyl-gamma-glutamyl-phosphate reductase; Provisional Back     alignment and domain information
>PRK09987 dTDP-4-dehydrorhamnose reductase; Provisional Back     alignment and domain information
>PRK06932 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK10124 putative UDP-glucose lipid carrier transferase; Provisional Back     alignment and domain information
>COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK06598 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PLN02928 oxidoreductase family protein Back     alignment and domain information
>PRK08229 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>TIGR01851 argC_other N-acetyl-gamma-glutamyl-phosphate reductase, uncommon form Back     alignment and domain information
>TIGR03013 EpsB_2 sugar transferase, PEP-CTERM system associated Back     alignment and domain information
>COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>TIGR01179 galE UDP-glucose-4-epimerase Back     alignment and domain information
>cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PLN02166 dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>PRK06813 homoserine dehydrogenase; Validated Back     alignment and domain information
>PLN00141 Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>COG0057 GapA Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 Back     alignment and domain information
>COG2910 Putative NADH-flavin reductase [General function prediction only] Back     alignment and domain information
>PF13727 CoA_binding_3: CoA-binding domain; PDB: 3NKL_B Back     alignment and domain information
>PRK10675 UDP-galactose-4-epimerase; Provisional Back     alignment and domain information
>TIGR03466 HpnA hopanoid-associated sugar epimerase Back     alignment and domain information
>PLN02858 fructose-bisphosphate aldolase Back     alignment and domain information
>PRK06487 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK15409 bifunctional glyoxylate/hydroxypyruvate reductase B; Provisional Back     alignment and domain information
>PLN02858 fructose-bisphosphate aldolase Back     alignment and domain information
>PLN02240 UDP-glucose 4-epimerase Back     alignment and domain information
>PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional Back     alignment and domain information
>TIGR00936 ahcY adenosylhomocysteinase Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>cd01485 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-like Back     alignment and domain information
>PRK12557 H(2)-dependent methylenetetrahydromethanopterin dehydrogenase-related protein; Provisional Back     alignment and domain information
>PRK06249 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK08223 hypothetical protein; Validated Back     alignment and domain information
>smart00859 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain Back     alignment and domain information
>PRK06182 short chain dehydrogenase; Validated Back     alignment and domain information
>TIGR01777 yfcH conserved hypothetical protein TIGR01777 Back     alignment and domain information
>PRK12829 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>PRK13535 erythrose 4-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PLN02725 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductase Back     alignment and domain information
>COG0287 TyrA Prephenate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase Back     alignment and domain information
>PF00044 Gp_dh_N: Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain; InterPro: IPR020828 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) plays an important role in glycolysis and gluconeogenesis [] by reversibly catalysing the oxidation and phosphorylation of D-glyceraldehyde-3-phosphate to 1,3-diphospho-glycerate Back     alignment and domain information
>COG4693 PchG Oxidoreductase (NAD-binding), involved in siderophore biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG0136 Asd Aspartate-semialdehyde dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01181 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PLN02696 1-deoxy-D-xylulose-5-phosphate reductoisomerase Back     alignment and domain information
>PLN02214 cinnamoyl-CoA reductase Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>PRK05447 1-deoxy-D-xylulose 5-phosphate reductoisomerase; Provisional Back     alignment and domain information
>PRK12320 hypothetical protein; Provisional Back     alignment and domain information
>PRK10538 malonic semialdehyde reductase; Provisional Back     alignment and domain information
>PRK09414 glutamate dehydrogenase; Provisional Back     alignment and domain information
>PRK12828 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01745 asd_gamma aspartate-semialdehyde dehydrogenase, gamma-proteobacterial Back     alignment and domain information
>PRK07577 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG3804 Uncharacterized conserved protein related to dihydrodipicolinate reductase [Function unknown] Back     alignment and domain information
>PRK00683 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK06139 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06953 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02662 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PRK12938 acetyacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK06179 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05865 hypothetical protein; Provisional Back     alignment and domain information
>PRK08278 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK09186 flagellin modification protein A; Provisional Back     alignment and domain information
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>PRK05993 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>PLN02778 3,5-epimerase/4-reductase Back     alignment and domain information
>PRK08328 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>PRK06523 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06138 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06180 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06057 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07890 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK08177 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>PRK05693 short chain dehydrogenase; Provisional Back     alignment and domain information
>PTZ00023 glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK12827 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12744 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07454 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>PRK07814 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN03096 glyceraldehyde-3-phosphate dehydrogenase A; Provisional Back     alignment and domain information
>PRK06398 aldose dehydrogenase; Validated Back     alignment and domain information
>COG2085 Predicted dinucleotide-binding enzymes [General function prediction only] Back     alignment and domain information
>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>KOG0023 consensus Alcohol dehydrogenase, class V [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>PRK08340 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PLN02206 UDP-glucuronate decarboxylase Back     alignment and domain information
>PRK09466 metL bifunctional aspartate kinase II/homoserine dehydrogenase II; Provisional Back     alignment and domain information
>PLN02306 hydroxypyruvate reductase Back     alignment and domain information
>PRK09436 thrA bifunctional aspartokinase I/homoserine dehydrogenase I; Provisional Back     alignment and domain information
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK08057 cobalt-precorrin-6x reductase; Reviewed Back     alignment and domain information
>PRK15057 UDP-glucose 6-dehydrogenase; Provisional Back     alignment and domain information
>COG0460 ThrA Homoserine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PLN02572 UDP-sulfoquinovose synthase Back     alignment and domain information
>PRK05884 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02583 cinnamoyl-CoA reductase Back     alignment and domain information
>PLN02494 adenosylhomocysteinase Back     alignment and domain information
>PRK07985 oxidoreductase; Provisional Back     alignment and domain information
>PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PLN02358 glyceraldehyde-3-phosphate dehydrogenase Back     alignment and domain information
>PRK15182 Vi polysaccharide biosynthesis protein TviB; Provisional Back     alignment and domain information
>PRK08267 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information
>PRK06841 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07825 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK15425 gapA glyceraldehyde-3-phosphate dehydrogenase A; Provisional Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF10087 DUF2325: Uncharacterized protein conserved in bacteria (DUF2325); InterPro: IPR016772 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PRK12939 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06500 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12745 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>TIGR01472 gmd GDP-mannose 4,6-dehydratase Back     alignment and domain information
>PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated Back     alignment and domain information
>PRK07729 glyceraldehyde-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 Back     alignment and domain information
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06172 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0451 WcaG Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PLN02896 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>PRK06124 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase Back     alignment and domain information
>PRK08703 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12746 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02427 UDP-apiose/xylose synthase Back     alignment and domain information
>PF02670 DXP_reductoisom: 1-deoxy-D-xylulose 5-phosphate reductoisomerase; InterPro: IPR013512 1-deoxy-D-xylulose 5-phosphate reductoisomerase synthesises 2-C-methyl-D-erythritol 4-phosphate from 1-deoxy-D-xylulose 5-phosphate in a single step by intramolecular rearrangement and reduction and is responsible for terpenoid biosynthesis in some organisms [] Back     alignment and domain information
>PF01073 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/isomerase family; InterPro: IPR002225 The enzyme 3 beta-hydroxysteroid dehydrogenase/5-ene-4-ene isomerase (3 beta-HSD) catalyses the oxidation and isomerisation of 5-ene-3 beta-hydroxypregnene and 5-ene-hydroxyandrostene steroid precursors into the corresponding 4-ene-ketosteroids necessary for the formation of all classes of steroid hormones Back     alignment and domain information
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA Back     alignment and domain information
>PRK10084 dTDP-glucose 4,6 dehydratase; Provisional Back     alignment and domain information
>PLN02653 GDP-mannose 4,6-dehydratase Back     alignment and domain information
>PRK06171 sorbitol-6-phosphate 2-dehydrogenase; Provisional Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase Back     alignment and domain information
>TIGR00243 Dxr 1-deoxy-D-xylulose 5-phosphate reductoisomerase Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK06194 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01724 hmd_rel H2-forming N(5),N(10)-methenyltetrahydromethanopterin dehydrogenase-related protein Back     alignment and domain information
>PRK10217 dTDP-glucose 4,6-dehydratase; Provisional Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>PRK06198 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG2099 CobK Precorrin-6x reductase [Coenzyme metabolism] Back     alignment and domain information
>PLN02650 dihydroflavonol-4-reductase Back     alignment and domain information
>PRK07403 glyceraldehyde-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>PLN02986 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PRK11150 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Provisional Back     alignment and domain information
>PRK05872 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08085 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>KOG0409 consensus Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>PRK07109 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02272 glyceraldehyde-3-phosphate dehydrogenase Back     alignment and domain information
>PRK07060 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05867 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd01487 E1_ThiF_like E1_ThiF_like Back     alignment and domain information
>COG1052 LdhA Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>cd01076 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 1 Back     alignment and domain information
>PTZ00075 Adenosylhomocysteinase; Provisional Back     alignment and domain information
>cd01491 Ube1_repeat1 Ubiquitin activating enzyme (E1), repeat 1 Back     alignment and domain information
>PRK08017 oxidoreductase; Provisional Back     alignment and domain information
>PRK05650 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06901 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>PF01370 Epimerase: NAD dependent epimerase/dehydratase family; InterPro: IPR001509 This family of proteins utilise NAD as a cofactor Back     alignment and domain information
>KOG4039 consensus Serine/threonine kinase TIP30/CC3 [Signal transduction mechanisms] Back     alignment and domain information
>PRK14031 glutamate dehydrogenase; Provisional Back     alignment and domain information
>PLN02989 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07062 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated Back     alignment and domain information
>TIGR02197 heptose_epim ADP-L-glycero-D-manno-heptose-6-epimerase Back     alignment and domain information
>PF07755 DUF1611: Protein of unknown function (DUF1611); InterPro: IPR011669 This entry contains a number of hypothetical bacterial and archaeal proteins Back     alignment and domain information
>PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>cd00755 YgdL_like Family of activating enzymes (E1) of ubiquitin-like proteins related to the E Back     alignment and domain information
>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Back     alignment and domain information
>PTZ00325 malate dehydrogenase; Provisional Back     alignment and domain information
>COG1810 Uncharacterized protein conserved in archaea [Function unknown] Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK07024 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07677 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08226 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07904 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>PRK09135 pteridine reductase; Provisional Back     alignment and domain information
>PF02571 CbiJ: Precorrin-6x reductase CbiJ/CobK; InterPro: IPR003723 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt Back     alignment and domain information
>PRK05597 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC Back     alignment and domain information
>PRK07063 short chain dehydrogenase; Provisional Back     alignment and domain information
>PTZ00434 cytosolic glyceraldehyde 3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK07576 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05717 oxidoreductase; Validated Back     alignment and domain information
>PRK12937 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>PRK07806 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08213 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK06924 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05876 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08862 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed Back     alignment and domain information
>KOG1502 consensus Flavonol reductase/cinnamoyl-CoA reductase [Defense mechanisms] Back     alignment and domain information
>PRK06181 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>PRK09242 tropinone reductase; Provisional Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08125 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated Back     alignment and domain information
>PRK12742 oxidoreductase; Provisional Back     alignment and domain information
>PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional Back     alignment and domain information
>COG4091 Predicted homoserine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05875 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional Back     alignment and domain information
>PRK07831 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07067 sorbitol dehydrogenase; Provisional Back     alignment and domain information
>PRK00421 murC UDP-N-acetylmuramate--L-alanine ligase; Provisional Back     alignment and domain information
>PF02719 Polysacc_synt_2: Polysaccharide biosynthesis protein; InterPro: IPR003869 This domain is found in diverse bacterial polysaccharide biosynthesis proteins including the CapD protein from Staphylococcus aureus [], the WalL protein, mannosyl-transferase [], and several putative epimerases Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK07578 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK09072 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information
>PRK08268 3-hydroxy-acyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PLN02700 homoserine dehydrogenase family protein Back     alignment and domain information
>PRK12935 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional Back     alignment and domain information
>PRK07035 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07102 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated Back     alignment and domain information
>PRK09287 6-phosphogluconate dehydrogenase; Validated Back     alignment and domain information
>PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PTZ00079 NADP-specific glutamate dehydrogenase; Provisional Back     alignment and domain information
>PRK08628 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07453 protochlorophyllide oxidoreductase; Validated Back     alignment and domain information
>PRK07069 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07074 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08643 acetoin reductase; Validated Back     alignment and domain information
>COG0702 Predicted nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01746 Thioester-redct thioester reductase domain Back     alignment and domain information
>PRK08265 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>PRK06114 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK15116 sulfur acceptor protein CsdL; Provisional Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>TIGR00112 proC pyrroline-5-carboxylate reductase Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PRK07411 hypothetical protein; Validated Back     alignment and domain information
>PRK07877 hypothetical protein; Provisional Back     alignment and domain information
>PRK08277 D-mannonate oxidoreductase; Provisional Back     alignment and domain information
>PRK06482 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR00640 acid_CoA_mut_C methylmalonyl-CoA mutase C-terminal domain Back     alignment and domain information
>TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>PRK07478 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1254 consensus ATP-citrate lyase [Energy production and conversion] Back     alignment and domain information
>PLN02477 glutamate dehydrogenase Back     alignment and domain information
>PRK08264 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK08263 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07791 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd01493 APPBP1_RUB Ubiquitin activating enzyme (E1) subunit APPBP1 Back     alignment and domain information
>PRK07832 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09291 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12743 oxidoreductase; Provisional Back     alignment and domain information
>PRK06914 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08324 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06128 oxidoreductase; Provisional Back     alignment and domain information
>PF02844 GARS_N: Phosphoribosylglycinamide synthetase, N domain; InterPro: IPR020562 Phosphoribosylglycinamide synthetase (6 Back     alignment and domain information
>PLN02253 xanthoxin dehydrogenase Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>TIGR02964 xanthine_xdhC xanthine dehydrogenase accessory protein XdhC Back     alignment and domain information
>PRK05086 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK06196 oxidoreductase; Provisional Back     alignment and domain information
>PRK00141 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK03803 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK06079 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08618 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK08309 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01534 GAPDH-I glyceraldehyde-3-phosphate dehydrogenase, type I Back     alignment and domain information
>PRK07023 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12824 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK05600 thiamine biosynthesis protein ThiF; Validated Back     alignment and domain information
>PLN00203 glutamyl-tRNA reductase Back     alignment and domain information
>PRK08589 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06947 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK06077 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>TIGR01087 murD UDP-N-acetylmuramoylalanine--D-glutamate ligase Back     alignment and domain information
>PF08484 Methyltransf_14: C-methyltransferase C-terminal domain; InterPro: IPR013691 This domain is found in bacterial C-methyltransferase proteins, often together with other methyltransferase domains such as IPR013216 from INTERPRO or IPR013217 from INTERPRO Back     alignment and domain information
>TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent Back     alignment and domain information
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK07792 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06550 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK14030 glutamate dehydrogenase; Provisional Back     alignment and domain information
>PRK06483 dihydromonapterin reductase; Provisional Back     alignment and domain information
>PRK09134 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG1023 Gnd Predicted 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK08063 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase Back     alignment and domain information
>PRK06701 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd01484 E1-2_like Ubiquitin activating enzyme (E1), repeat 2-like Back     alignment and domain information
>PRK05708 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK06197 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>PLN02237 glyceraldehyde-3-phosphate dehydrogenase B Back     alignment and domain information
>PTZ00117 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK08289 glyceraldehyde-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>COG4569 MhpF Acetaldehyde dehydrogenase (acetylating) [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR01202 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase Back     alignment and domain information
>PLN02686 cinnamoyl-CoA reductase Back     alignment and domain information
>KOG1014 consensus 17 beta-hydroxysteroid dehydrogenase type 3, HSD17B3 [Lipid transport and metabolism] Back     alignment and domain information
>PF07085 DRTGG: DRTGG domain; InterPro: IPR010766 This presumed domain is about 120 amino acids in length Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query182
2fp4_A 305 Crystal Structure Of Pig Gtp-Specific Succinyl-Coa 1e-28
2fpg_A 305 Crystal Structure Of Pig Gtp-Specific Succinyl-Coa 1e-28
1eud_A 311 Crystal Structure Of Phosphorylated Pig Heart, Gtp- 1e-28
1euc_A 311 Crystal Structure Of Dephosphorylated Pig Heart, Gt 2e-28
2nu7_A 288 C123as Mutant Of E. Coli Succinyl-Coa Synthetase Le 9e-23
2nua_A 288 C123av Mutant Of E. Coli Succinyl-Coa Synthetase Le 9e-23
2nu8_A 288 C123at Mutant Of E. Coli Succinyl-Coa Synthetase Le 9e-23
2nu9_A 288 C123at Mutant Of E. Coli Succinyl-Coa Synthetase Or 1e-22
2nu6_A 288 C123aa Mutant Of E. Coli Succinyl-Coa Synthetase Le 1e-22
1cqi_A 286 Crystal Structure Of The Complex Of Adp And Mg2+ Wi 1e-22
1jkj_A 288 E. Coli Scs Length = 288 1e-22
2scu_A 288 A Detailed Description Of The Structure Of Succinyl 1e-22
2yv1_A 294 Crystal Structure Of Succinyl-Coa Synthetase Alpha 4e-17
2yv2_A 297 Crystal Structure Of Succinyl-Coa Synthetase Alpha 1e-16
3ufx_A 296 Thermus Aquaticus Succinyl-coa Synthetase In Comple 1e-14
1oi7_A 288 The Crystal Structure Of Succinyl-Coa Synthetase Al 3e-14
>pdb|2FP4|A Chain A, Crystal Structure Of Pig Gtp-Specific Succinyl-Coa Synthetase In Complex With Gtp Length = 305 Back     alignment and structure 
Iteration: 1

 Score =  122 bits (305), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 62/113 (54%), Positives = 71/113 (62%), Gaps = 1/113 (0%)
Query: 45  SAAASHPAVFVDKNTRVICQGITGKNGTFHTEQAIEYXXXXXXXXXXXXXXXXEHLGLPV 104
           S  AS   ++VDKNT+VICQG TGK GTFH++QA+EY                 HLGLPV
Sbjct: 1   SYTASRKHLYVDKNTKVICQGFTGKQGTFHSQQALEYGTNLVGGTTPGKGGKT-HLGLPV 59
Query: 105 FNSVAEAKAETKANASVIYVPPPFXXXXXXXXXXXXLDLVVCITEGIPQHDMV 157
           FN+V EAK +T A ASVIYVPPPF            + LVVCITEGIPQ DMV
Sbjct: 60  FNTVKEAKEQTGATASVIYVPPPFAAAAINEAIDAEVPLVVCITEGIPQQDMV 112
>pdb|2FPG|A Chain A, Crystal Structure Of Pig Gtp-Specific Succinyl-Coa Synthetase In Complex With Gdp Length = 305 Back     alignment and structure
>pdb|1EUD|A Chain A, Crystal Structure Of Phosphorylated Pig Heart, Gtp-Specific Succinyl-Coa Synthetase Length = 311 Back     alignment and structure
>pdb|1EUC|A Chain A, Crystal Structure Of Dephosphorylated Pig Heart, Gtp- Specific Succinyl-Coa Synthetase Length = 311 Back     alignment and structure
>pdb|2NU7|A Chain A, C123as Mutant Of E. Coli Succinyl-Coa Synthetase Length = 288 Back     alignment and structure
>pdb|2NUA|A Chain A, C123av Mutant Of E. Coli Succinyl-Coa Synthetase Length = 288 Back     alignment and structure
>pdb|2NU8|A Chain A, C123at Mutant Of E. Coli Succinyl-Coa Synthetase Length = 288 Back     alignment and structure
>pdb|2NU9|A Chain A, C123at Mutant Of E. Coli Succinyl-Coa Synthetase Orthorhombic Crystal Form Length = 288 Back     alignment and structure
>pdb|2NU6|A Chain A, C123aa Mutant Of E. Coli Succinyl-Coa Synthetase Length = 288 Back     alignment and structure
>pdb|1CQI|A Chain A, Crystal Structure Of The Complex Of Adp And Mg2+ With Dephosphorylated E. Coli Succinyl-Coa Synthetase Length = 286 Back     alignment and structure
>pdb|1JKJ|A Chain A, E. Coli Scs Length = 288 Back     alignment and structure
>pdb|2SCU|A Chain A, A Detailed Description Of The Structure Of Succinyl-Coa Synthetase From Escherichia Coli Length = 288 Back     alignment and structure
>pdb|2YV1|A Chain A, Crystal Structure Of Succinyl-Coa Synthetase Alpha Chain From Methanocaldococcus Jannaschii Dsm 2661 Length = 294 Back     alignment and structure
>pdb|2YV2|A Chain A, Crystal Structure Of Succinyl-Coa Synthetase Alpha Chain From Aeropyrum Pernix K1 Length = 297 Back     alignment and structure
>pdb|3UFX|A Chain A, Thermus Aquaticus Succinyl-coa Synthetase In Complex With Gdp-mn2+ Length = 296 Back     alignment and structure
>pdb|1OI7|A Chain A, The Crystal Structure Of Succinyl-Coa Synthetase Alpha Subunit From Thermus Thermophilus Length = 288 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query182
2fp4_A 305 Succinyl-COA ligase [GDP-forming] alpha-chain, mit 1e-74
2nu8_A 288 Succinyl-COA ligase [ADP-forming] subunit alpha; c 6e-74
2yv1_A 294 Succinyl-COA ligase [ADP-forming] subunit alpha; C 8e-74
1oi7_A 288 Succinyl-COA synthetase alpha chain; SCS, ligase, 4e-73
2yv2_A 297 Succinyl-COA synthetase alpha chain; COA-binding d 2e-72
3mwd_B 334 ATP-citrate synthase; ATP-grAsp, phosphohistidine, 5e-57
3pff_A 829 ATP-citrate synthase; phosphohistidine, organic ac 2e-51
3dmy_A 480 Protein FDRA; predicted actyl-COA synthetase, nysg 8e-30
>2fp4_A Succinyl-COA ligase [GDP-forming] alpha-chain, mitochondrial; active site phosphohistidine residue; HET: NEP GTP; 2.08A {Sus scrofa} SCOP: c.2.1.8 c.23.4.1 PDB: 2fpg_A* 2fpi_A* 2fpp_A* 1euc_A* 1eud_A* Length = 305 Back     alignment and structure
 Score =  225 bits (576), Expect = 1e-74
 Identities = 81/113 (71%), Positives = 93/113 (82%), Gaps = 1/113 (0%)

Query: 45  SAAASHPAVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVVGGVTPKKGGTEHLGLPV 104
           S  AS   ++VDKNT+VICQG TGK GTFH++QA+EYGT +V GG TP KGG  HLGLPV
Sbjct: 1   SYTASRKHLYVDKNTKVICQGFTGKQGTFHSQQALEYGTNLV-GGTTPGKGGKTHLGLPV 59

Query: 105 FNSVAEAKAETKANASVIYVPPPFAAAAIMEAMEAELDLVVCITEGIPQHDMV 157
           FN+V EAK +T A ASVIYVPPPFAAAAI EA++AE+ LVVCITEGIPQ DMV
Sbjct: 60  FNTVKEAKEQTGATASVIYVPPPFAAAAINEAIDAEVPLVVCITEGIPQQDMV 112
>2nu8_A Succinyl-COA ligase [ADP-forming] subunit alpha; citric acid cycle, heterotetramer, ligase, ATP-grAsp fold, R fold; HET: COA; 2.15A {Escherichia coli} SCOP: c.2.1.8 c.23.4.1 PDB: 2nu9_A* 2nu7_A* 2nua_A* 2nu6_A* 2scu_A* 1jll_A* 1scu_A* 1jkj_A* 1cqj_A* 1cqi_A* Length = 288 Back     alignment and structure
>2yv1_A Succinyl-COA ligase [ADP-forming] subunit alpha; COA-binding domain, structural genomics, NPPSFA; 1.70A {Methanocaldococcus jannaschii} Length = 294 Back     alignment and structure
>1oi7_A Succinyl-COA synthetase alpha chain; SCS, ligase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.23A {Thermus thermophilus} SCOP: c.2.1.8 c.23.4.1 Length = 288 Back     alignment and structure
>2yv2_A Succinyl-COA synthetase alpha chain; COA-binding domain, ligase, structural genomics, NPPSFA; 2.20A {Aeropyrum pernix} Length = 297 Back     alignment and structure
>3mwd_B ATP-citrate synthase; ATP-grAsp, phosphohistidine, organic acid, lyase, transferas; HET: CIT; 2.10A {Homo sapiens} PDB: 3mwe_B* Length = 334 Back     alignment and structure
>3pff_A ATP-citrate synthase; phosphohistidine, organic acid, ATP-grAsp, lyase, transferas; HET: TLA ADP; 2.30A {Homo sapiens} Length = 829 Back     alignment and structure
>3dmy_A Protein FDRA; predicted actyl-COA synthetase, nysgrc, PSI-II, STRU genomics, protein structure initiative; 2.07A {Escherichia coli} Length = 480 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query182
1oi7_A 288 Succinyl-COA synthetase alpha chain; SCS, ligase, 99.91
2yv2_A 297 Succinyl-COA synthetase alpha chain; COA-binding d 99.91
2yv1_A 294 Succinyl-COA ligase [ADP-forming] subunit alpha; C 99.91
2fp4_A 305 Succinyl-COA ligase [GDP-forming] alpha-chain, mit 99.9
2nu8_A 288 Succinyl-COA ligase [ADP-forming] subunit alpha; c 99.9
3mwd_B 334 ATP-citrate synthase; ATP-grAsp, phosphohistidine, 99.86
3pff_A 829 ATP-citrate synthase; phosphohistidine, organic ac 99.79
3ijp_A 288 DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, 99.76
4f3y_A 272 DHPR, dihydrodipicolinate reductase; structural ge 99.72
1iuk_A140 Hypothetical protein TT1466; structural genomics, 99.69
1dih_A 273 Dihydrodipicolinate reductase; oxidoreductase; HET 99.67
3qy9_A 243 DHPR, dihydrodipicolinate reductase; rossmann fold 99.66
2csu_A 457 457AA long hypothetical protein; structural genomi 99.64
2d59_A144 Hypothetical protein PH1109; COA binding, structur 99.64
2duw_A145 Putative COA-binding protein; ligand binding prote 99.63
3ff4_A122 Uncharacterized protein; structural genomics, PSI- 99.62
1y81_A138 Conserved hypothetical protein; hyperthermophIle, 99.62
1p9l_A 245 Dihydrodipicolinate reductase; oxidoreductase, lys 99.57
1vm6_A 228 DHPR, dihydrodipicolinate reductase; TM1520, struc 99.56
3keo_A212 Redox-sensing transcriptional repressor REX; DNA b 99.27
1f06_A 320 MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH 99.1
2dt5_A211 AT-rich DNA-binding protein; REX, NADH, NAD, rossm 99.03
4ew6_A 330 D-galactose-1-dehydrogenase protein; nysgrc, PSI-b 99.0
3o9z_A 312 Lipopolysaccaride biosynthesis protein WBPB; oxido 98.99
2vt3_A215 REX, redox-sensing transcriptional repressor REX; 98.97
3evn_A 329 Oxidoreductase, GFO/IDH/MOCA family; structural ge 98.95
3q2i_A 354 Dehydrogenase; rossmann fold, UDP-sugar binding, N 98.95
2dc1_A 236 L-aspartate dehydrogenase; NAD, oxidoreductase; HE 98.94
3euw_A 344 MYO-inositol dehydrogenase; protein structure init 98.93
3e9m_A 330 Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, 98.92
4fb5_A 393 Probable oxidoreductase protein; PSI-biology, nysg 98.91
3db2_A 354 Putative NADPH-dependent oxidoreductase; two domai 98.91
3c1a_A 315 Putative oxidoreductase; ZP_00056571.1, oxidoreduc 98.9
3e18_A 359 Oxidoreductase; dehydrogenase, NAD-binding, struct 98.9
3rc1_A 350 Sugar 3-ketoreductase; sugar biosynthesis, TDP bin 98.9
3oa2_A 318 WBPB; oxidoreductase, sugar biosynthesis, dehydrog 98.89
1tlt_A 319 Putative oxidoreductase (virulence factor MVIM HO; 98.88
3i23_A 349 Oxidoreductase, GFO/IDH/MOCA family; structural ge 98.88
3kux_A 352 Putative oxidoreductase; oxidoreductase family, cs 98.87
3moi_A 387 Probable dehydrogenase; structural genomics, PSI2, 98.87
3fhl_A 362 Putative oxidoreductase; NAD-binding domain, PSI-2 98.87
4had_A 350 Probable oxidoreductase protein; structural genomi 98.87
1lc0_A 294 Biliverdin reductase A; oxidoreductase, tetrapyrro 98.86
3cea_A 346 MYO-inositol 2-dehydrogenase; NP_786804.1, oxidore 98.86
2glx_A 332 1,5-anhydro-D-fructose reductase; NADP(H) dependen 98.85
2p2s_A 336 Putative oxidoreductase; YP_050235.1, structural g 98.83
4hkt_A 331 Inositol 2-dehydrogenase; structural genomics, nys 98.83
3dmy_A 480 Protein FDRA; predicted actyl-COA synthetase, nysg 98.82
3ec7_A 357 Putative dehydrogenase; alpha-beta, structural gen 98.82
1ydw_A 362 AX110P-like protein; structural genomics, protein 98.8
3e82_A 364 Putative oxidoreductase; NAD, GFO/IDH/MOCA family, 98.8
4gqa_A 412 NAD binding oxidoreductase; structural genomics, P 98.79
3uuw_A 308 Putative oxidoreductase with NAD(P)-binding rossm 98.78
3f4l_A 345 Putative oxidoreductase YHHX; structural genomics, 98.78
3ezy_A 344 Dehydrogenase; structural genomics, unknown functi 98.78
3mz0_A 344 Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; 98.78
3gdo_A 358 Uncharacterized oxidoreductase YVAA; structural ge 98.77
3bio_A 304 Oxidoreductase, GFO/IDH/MOCA family; structural ge 98.77
2ho3_A 325 Oxidoreductase, GFO/IDH/MOCA family; streptococcus 98.76
3m2t_A 359 Probable dehydrogenase; PSI, SGXNY, structural gen 98.76
3u3x_A 361 Oxidoreductase; structural genomics, PSI-biology, 98.76
1zh8_A 340 Oxidoreductase; TM0312, structural genomics, JO ce 98.75
3btv_A 438 Galactose/lactose metabolism regulatory protein GA 98.73
4gmf_A 372 Yersiniabactin biosynthetic protein YBTU; rossmann 98.71
3oqb_A 383 Oxidoreductase; structural genomics, protein struc 98.69
3ohs_X 334 Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; d 98.69
1h6d_A 433 Precursor form of glucose-fructose oxidoreductase; 98.68
3ip3_A 337 Oxidoreductase, putative; structural genomics, PSI 98.66
4h3v_A 390 Oxidoreductase domain protein; structural genomics 98.61
2ixa_A 444 Alpha-N-acetylgalactosaminidase; NAD, A-ECO conver 98.6
2nvw_A 479 Galactose/lactose metabolism regulatory protein GA 98.59
3dty_A 398 Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetram 98.59
3v5n_A 417 Oxidoreductase; structural genomics, PSI-biology, 98.55
3upl_A 446 Oxidoreductase; rossmann fold, NADPH binding; 1.50 98.51
3nkl_A141 UDP-D-quinovosamine 4-dehydrogenase; alpha-beta fo 98.42
1j5p_A 253 Aspartate dehydrogenase; TM1643, structural genomi 98.41
1xea_A 323 Oxidoreductase, GFO/IDH/MOCA family; structural ge 98.38
3do5_A 327 HOM, homoserine dehydrogenase; NP_069768.1, putati 98.31
3c8m_A 331 Homoserine dehydrogenase; structural genomics, APC 98.3
3mtj_A 444 Homoserine dehydrogenase; rossmann-fold, PSI, MCSG 98.29
3ing_A 325 Homoserine dehydrogenase; NP_394635.1, structural 98.24
3tri_A 280 Pyrroline-5-carboxylate reductase; amino acid bios 98.24
2rcy_A 262 Pyrroline carboxylate reductase; malaria, structur 98.23
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 98.19
3pef_A 287 6-phosphogluconate dehydrogenase, NAD-binding; gam 98.14
3d1l_A 266 Putative NADP oxidoreductase BF3122; structural ge 98.12
2g0t_A 350 Conserved hypothetical protein; structural genomic 98.08
1i36_A 264 Conserved hypothetical protein MTH1747; NADP bindi 98.07
2ahr_A 259 Putative pyrroline carboxylate reductase; pyrrolin 98.07
2gf2_A 296 Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct 98.05
3qha_A 296 Putative oxidoreductase; seattle structural genomi 98.03
4dll_A 320 2-hydroxy-3-oxopropionate reductase; structural ge 98.03
3pdu_A 287 3-hydroxyisobutyrate dehydrogenase family protein; 98.0
2ejw_A 332 HDH, homoserine dehydrogenase; NAD-dependent, oxid 97.97
2h78_A 302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 97.97
2izz_A 322 Pyrroline-5-carboxylate reductase 1; amino-acid bi 97.93
3ggo_A 314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 97.91
3qsg_A 312 NAD-binding phosphogluconate dehydrogenase-like P; 97.9
3doj_A 310 AT3G25530, dehydrogenase-like protein; gamma-hydro 97.9
3l6d_A 306 Putative oxidoreductase; structural genomics, prot 97.88
3gt0_A 247 Pyrroline-5-carboxylate reductase; structural geno 97.87
4e21_A 358 6-phosphogluconate dehydrogenase (decarboxylating; 97.87
3abi_A 365 Putative uncharacterized protein PH1688; L-lysine 97.86
2f1k_A 279 Prephenate dehydrogenase; tyrosine synthesis, X-RA 97.86
2obn_A 349 Hypothetical protein; structural genomics, joint c 97.85
1yb4_A 295 Tartronic semialdehyde reductase; structural genom 97.85
1ebf_A 358 Homoserine dehydrogenase; dinucleotide, NAD, dimer 97.83
4huj_A220 Uncharacterized protein; PSI-biology, nysgrc, stru 97.82
2czc_A 334 Glyceraldehyde-3-phosphate dehydrogenase; glycolys 97.8
1vpd_A 299 Tartronate semialdehyde reductase; structural geno 97.79
1b7g_O 340 Protein (glyceraldehyde 3-phosphate dehydrogenase; 97.79
3dr3_A 337 N-acetyl-gamma-glutamyl-phosphate reductase; csgid 97.79
1cf2_P 337 Protein (glyceraldehyde-3-phosphate dehydrogenase) 97.74
4gbj_A 297 6-phosphogluconate dehydrogenase NAD-binding; stru 97.74
2pv7_A 298 T-protein [includes: chorismate mutase (EC 5.4.99 97.74
3b1f_A 290 Putative prephenate dehydrogenase; enzyme, 4-hydro 97.72
3cky_A 301 2-hydroxymethyl glutarate dehydrogenase; rossmann 97.72
2py6_A 409 Methyltransferase FKBM; YP_546752.1, structural ge 97.71
2g5c_A 281 Prephenate dehydrogenase; TYRA, oxidoreductase; HE 97.7
4dgs_A340 Dehydrogenase; structural genomics, PSI-biology, N 97.69
4ezb_A 317 Uncharacterized conserved protein; structural geno 97.68
2uyy_A 316 N-PAC protein; long-chain dehydrogenase, cytokine; 97.68
1nvm_B 312 Acetaldehyde dehydrogenase (acylating), 4-hydroxy- 97.68
1f0y_A 302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 97.67
3g0o_A 303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 97.65
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 97.65
3fr7_A 525 Putative ketol-acid reductoisomerase (OS05G057370 97.64
3ktd_A 341 Prephenate dehydrogenase; structural genomics, joi 97.62
1evy_A 366 Glycerol-3-phosphate dehydrogenase; rossmann fold, 97.62
2z2v_A 365 Hypothetical protein PH1688; L-lysine dehydrogenas 97.62
2ozp_A 345 N-acetyl-gamma-glutamyl-phosphate reductase; amino 97.61
2zyd_A 480 6-phosphogluconate dehydrogenase, decarboxylating; 97.6
2cvz_A 289 Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; 97.59
1yqg_A 263 Pyrroline-5-carboxylate reductase; structural geno 97.58
1z82_A 335 Glycerol-3-phosphate dehydrogenase; TM0378, struct 97.57
3c24_A 286 Putative oxidoreductase; YP_511008.1, structural g 97.56
2iz1_A 474 6-phosphogluconate dehydrogenase, decarboxylating; 97.52
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 97.52
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 97.52
2ep5_A 350 350AA long hypothetical aspartate-semialdehyde deh 97.51
2p4q_A 497 6-phosphogluconate dehydrogenase, decarboxylating; 97.49
3ba1_A333 HPPR, hydroxyphenylpyruvate reductase; two domain 97.48
3gg2_A 450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 97.47
1qp8_A303 Formate dehydrogenase; oxidoreductase; HET: NDP; 2 97.47
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 97.45
2pgd_A 482 6-phosphogluconate dehydrogenase; oxidoreductase ( 97.42
3k96_A 356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 97.41
3e48_A 289 Putative nucleoside-diphosphate-sugar epimerase; a 97.41
3dtt_A245 NADP oxidoreductase; structural genomics, joint ce 97.41
1txg_A 335 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid 97.41
4dpk_A 359 Malonyl-COA/succinyl-COA reductase; dinucleotide b 97.39
4dpl_A 359 Malonyl-COA/succinyl-COA reductase; dinucleotide b 97.39
3gvx_A290 Glycerate dehydrogenase related protein; NYSGXRC, 97.35
4gwg_A 484 6-phosphogluconate dehydrogenase, decarboxylating; 97.35
1ys4_A 354 Aspartate-semialdehyde dehydrogenase; oxidoreducta 97.34
2yjz_A201 Metalloreductase steap4; oxidoreductase, metabolic 96.45
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 97.33
1pgj_A 478 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; o 97.3
1np3_A 338 Ketol-acid reductoisomerase; A DEEP figure-OF-eigh 97.27
1qyc_A 308 Phenylcoumaran benzylic ether reductase PT1; NADPH 97.27
4e12_A 283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 97.26
3m2p_A 311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 97.26
1xyg_A 359 Putative N-acetyl-gamma-glutamyl-phosphate reduct; 97.25
3obb_A 300 Probable 3-hydroxyisobutyrate dehydrogenase; struc 97.23
3pid_A 432 UDP-glucose 6-dehydrogenase; rossmann fold, oxidor 97.23
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 97.23
4ina_A 405 Saccharopine dehydrogenase; structural genomics, P 97.23
2hjs_A 340 USG-1 protein homolog; aspartate-semialdehyde dehy 97.22
1yj8_A 375 Glycerol-3-phosphate dehydrogenase; SGPP, structur 97.21
1x0v_A 354 GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase 97.21
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 97.2
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 97.2
1mv8_A 436 GMD, GDP-mannose 6-dehydrogenase; rossman fold, do 97.2
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 97.19
2cuk_A311 Glycerate dehydrogenase/glyoxylate reductase; stru 97.19
2w2k_A348 D-mandelate dehydrogenase; 2-hydroxyacid dehydroge 97.18
3e5r_O 337 PP38, glyceraldehyde-3-phosphate dehydrogenase, cy 97.17
1qyd_A 313 Pinoresinol-lariciresinol reductase; NADPH-depende 97.16
1bg6_A 359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 97.16
2r00_A 336 Aspartate-semialdehyde dehydrogenase; conformation 97.13
1ks9_A 291 KPA reductase;, 2-dehydropantoate 2-reductase; PAN 97.1
2q3e_A 467 UDP-glucose 6-dehydrogenase; hexamer, structural g 97.1
3pp8_A315 Glyoxylate/hydroxypyruvate reductase A; structural 97.1
1lss_A140 TRK system potassium uptake protein TRKA homolog; 97.1
1mx3_A347 CTBP1, C-terminal binding protein 1; nuclear prote 97.09
1e6u_A 321 GDP-fucose synthetase; epimerase/reductase, SDR, R 97.09
4id9_A 347 Short-chain dehydrogenase/reductase; putative dehy 97.07
3hn2_A 312 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str 97.07
2r6j_A 318 Eugenol synthase 1; phenylpropene, PIP reductase, 97.06
2gas_A 307 Isoflavone reductase; NADPH-dependent reductase, o 97.04
1sc6_A 404 PGDH, D-3-phosphoglycerate dehydrogenase; alloster 97.04
2nqt_A 352 N-acetyl-gamma-glutamyl-phosphate reductase; apopr 97.04
3c1o_A 321 Eugenol synthase; phenylpropene, PIP reductase, sh 97.04
2d0i_A333 Dehydrogenase; structural genomics, NPPSFA, nation 97.03
4fgw_A 391 Glycerol-3-phosphate dehydrogenase [NAD(+)] 1; oxi 97.02
1dxy_A333 D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxyc 97.02
2wm3_A 299 NMRA-like family domain containing protein 1; unkn 97.0
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 97.0
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 97.0
3i6i_A 346 Putative leucoanthocyanidin reductase 1; rossmann 96.99
4egb_A 346 DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce 96.99
3ruf_A 351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 96.98
4ea9_A220 Perosamine N-acetyltransferase; beta helix, acetyl 96.98
2x4g_A 342 Nucleoside-diphosphate-sugar epimerase; isomerase; 96.97
3ulk_A 491 Ketol-acid reductoisomerase; branched-chain amino 96.96
1dlj_A 402 UDP-glucose dehydrogenase; rossmann fold, ternary 96.95
3hwr_A 318 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A 96.94
1u8f_O 335 GAPDH, glyceraldehyde-3-phosphate dehydrogenase, l 96.94
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 96.94
1vl0_A 292 DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s 96.93
3hsk_A 381 Aspartate-semialdehyde dehydrogenase; candida albi 96.93
2y0c_A 478 BCEC, UDP-glucose dehydrogenase; oxidoreductase, c 96.92
3pwk_A 366 Aspartate-semialdehyde dehydrogenase; NADP binding 96.92
4g2n_A345 D-isomer specific 2-hydroxyacid dehydrogenase, Na; 96.92
1gdh_A320 D-glycerate dehydrogenase; oxidoreductase(CHOH (D) 96.91
3c85_A183 Putative glutathione-regulated potassium-efflux S 96.91
3enk_A 341 UDP-glucose 4-epimerase; seattle structural genomi 96.91
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 96.9
3i83_A 320 2-dehydropantoate 2-reductase; structural genomics 96.89
4a7p_A 446 UDP-glucose dehydrogenase; oxidoreductase, carbohy 96.89
2nac_A393 NAD-dependent formate dehydrogenase; oxidoreductas 96.88
2pzm_A 330 Putative nucleotide sugar epimerase/ dehydratase; 96.86
2g76_A335 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor 96.86
2zcu_A 286 Uncharacterized oxidoreductase YTFG; alpha-beta sa 96.85
1t4b_A 367 Aspartate-semialdehyde dehydrogenase; asadh, HOSR, 96.85
2j6i_A364 Formate dehydrogenase; oxidoreductase, D-specific- 96.83
2gcg_A330 Glyoxylate reductase/hydroxypyruvate reductase; NA 96.82
2ekl_A313 D-3-phosphoglycerate dehydrogenase; structural gen 96.8
2i76_A 276 Hypothetical protein; NADP, dehydrogenase, TM1727, 96.8
2dpo_A 319 L-gulonate 3-dehydrogenase; structural genomics, N 96.79
1xdw_A331 NAD+-dependent (R)-2-hydroxyglutarate dehydrogenas 96.78
3uw3_A 377 Aspartate-semialdehyde dehydrogenase; structural g 96.77
3jtm_A351 Formate dehydrogenase, mitochondrial; mitochondrio 96.77
2ew2_A 316 2-dehydropantoate 2-reductase, putative; alpha-str 96.75
2dbq_A334 Glyoxylate reductase; D-3-phosphoglycerate dehydro 96.75
3pzr_A 370 Aspartate-semialdehyde dehydrogenase; NADP, oxidor 96.74
2qyt_A 317 2-dehydropantoate 2-reductase; APC81190, porphyrom 96.72
1wwk_A307 Phosphoglycerate dehydrogenase; riken structural g 96.71
1j4a_A333 D-LDH, D-lactate dehydrogenase; NAD-dependent dehy 96.7
3k5p_A 416 D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, 96.7
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 96.7
1ygy_A 529 PGDH, D-3-phosphoglycerate dehydrogenase; oxidored 96.66
2c20_A 330 UDP-glucose 4-epimerase; carbohydrate metabolism, 96.66
2ph5_A 480 Homospermidine synthase; alpha-beta protein, struc 96.65
2jl1_A 287 Triphenylmethane reductase; oxidoreductase, biorem 96.64
3sc6_A 287 DTDP-4-dehydrorhamnose reductase; RFBD, structural 96.63
3tz6_A 344 Aspartate-semialdehyde dehydrogenase; asadh, ASD, 96.62
3ay3_A 267 NAD-dependent epimerase/dehydratase; glucuronic ac 96.62
2q1w_A 333 Putative nucleotide sugar epimerase/ dehydratase; 96.62
1rpn_A 335 GDP-mannose 4,6-dehydratase; short-chain dehydroge 96.61
3evt_A324 Phosphoglycerate dehydrogenase; structural genomic 96.61
3hg7_A324 D-isomer specific 2-hydroxyacid dehydrogenase FAM 96.59
2a35_A215 Hypothetical protein PA4017; alpha-beta-alpha sand 96.58
3gg9_A352 D-3-phosphoglycerate dehydrogenase oxidoreductase; 96.56
2yy7_A 312 L-threonine dehydrogenase; thermolabIle, flavobact 96.54
2yq5_A343 D-isomer specific 2-hydroxyacid dehydrogenase; oxi 96.53
2p5y_A 311 UDP-glucose 4-epimerase; TTHA0591, structural geno 96.51
2gn4_A 344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 96.51
2pk3_A 321 GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor 96.5
1id1_A153 Putative potassium channel protein; RCK domain, E. 96.49
4hy3_A365 Phosphoglycerate oxidoreductase; PSI-biology, stru 96.49
2o3j_A 481 UDP-glucose 6-dehydrogenase; structural genomics, 96.48
1xgk_A 352 Nitrogen metabolite repression regulator NMRA; ros 96.46
3ghy_A 335 Ketopantoate reductase protein; oxidoreductase, NA 96.45
2c5a_A 379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 96.45
2pi1_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 96.44
3g17_A 294 Similar to 2-dehydropantoate 2-reductase; structur 96.43
1n2s_A 299 DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold 96.39
1xq6_A253 Unknown protein; structural genomics, protein stru 96.38
1sb8_A 352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 96.35
2x5j_O 339 E4PDH, D-erythrose-4-phosphate dehydrogenase; oxid 96.33
4e5n_A330 Thermostable phosphite dehydrogenase; D-2-hydroxya 96.33
2q1s_A 377 Putative nucleotide sugar epimerase/ dehydratase; 96.33
2yv3_A 331 Aspartate-semialdehyde dehydrogenase; aspartate pa 96.32
4b8w_A 319 GDP-L-fucose synthase; oxidoreductase; HET: NAP GD 96.31
2ydy_A 315 Methionine adenosyltransferase 2 subunit beta; oxi 96.3
3b1j_A 339 Glyceraldehyde 3-phosphate dehydrogenase (NADP+); 96.3
1vkn_A 351 N-acetyl-gamma-glutamyl-phosphate reductase; TM178 96.28
3st7_A 369 Capsular polysaccharide synthesis enzyme CAP5F; ro 96.27
3ajr_A 317 NDP-sugar epimerase; L-threonine dehydrogenase, L- 96.27
2z1m_A 345 GDP-D-mannose dehydratase; short-chain dehydrogena 96.26
3oet_A 381 Erythronate-4-phosphate dehydrogenase; structural 96.22
3oh8_A 516 Nucleoside-diphosphate sugar epimerase (SULA FAMI; 96.21
1rkx_A 357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 96.17
2d2i_A 380 Glyceraldehyde 3-phosphate dehydrogenase; rossmann 96.16
1gy8_A 397 UDP-galactose 4-epimerase; oxidoreductase; HET: NA 96.15
3ego_A 307 Probable 2-dehydropantoate 2-reductase; structural 96.13
1ek6_A 348 UDP-galactose 4-epimerase; short-chain dehydrogena 96.13
2o4c_A 380 Erythronate-4-phosphate dehydrogenase; erythronate 96.11
3dfu_A 232 Uncharacterized protein from 6-phosphogluconate de 96.11
3vps_A 321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 96.11
2rir_A300 Dipicolinate synthase, A chain; structural genomic 96.1
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 96.08
1hdg_O 332 Holo-D-glyceraldehyde-3-phosphate dehydrogenase; o 96.07
1ff9_A 450 Saccharopine reductase; lysine biosynthesis, alpha 96.05
2g82_O 331 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; G 96.02
3sxp_A 362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 96.02
1orr_A 347 CDP-tyvelose-2-epimerase; rossmann fold, short-cha 96.01
3gpi_A 286 NAD-dependent epimerase/dehydratase; structural ge 95.98
3l9w_A 413 Glutathione-regulated potassium-efflux system Pro 95.97
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 95.96
2axq_A 467 Saccharopine dehydrogenase; rossmann fold variant, 95.92
3slg_A 372 PBGP3 protein; structural genomics, seattle struct 95.92
3ehe_A 313 UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, 95.91
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 95.91
3ko8_A 312 NAD-dependent epimerase/dehydratase; isomerase, UD 95.91
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 95.9
1y1p_A 342 ARII, aldehyde reductase II; rossmann fold, short 95.89
1t2a_A 375 GDP-mannose 4,6 dehydratase; structural genomics c 95.85
3c7a_A 404 Octopine dehydrogenase; L) stereospecific opine de 95.83
3cps_A 354 Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, g 95.83
1rm4_O 337 Glyceraldehyde 3-phosphate dehydrogenase A; rossma 95.78
1udb_A 338 Epimerase, UDP-galactose-4-epimerase; isomerase; H 95.74
3cmc_O 334 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; m 95.74
1zej_A 293 HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural 95.74
3rft_A 267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 95.73
3a06_A 376 1-deoxy-D-xylulose 5-phosphate reductoisomerase; M 95.72
3v2g_A 271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 95.69
1gad_O 330 D-glyceraldehyde-3-phosphate dehydrogenase; oxidor 95.62
3g79_A 478 NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; 95.61
2ggs_A 273 273AA long hypothetical DTDP-4-dehydrorhamnose red 95.6
4da9_A 280 Short-chain dehydrogenase/reductase; structural ge 95.57
1kew_A 361 RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fo 95.55
3kb6_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 95.51
1r6d_A 337 TDP-glucose-4,6-dehydratase; rossmann fold, short- 95.48
2yyy_A 343 Glyceraldehyde-3-phosphate dehydrogenase; glyceral 95.47
1r0k_A 388 1-deoxy-D-xylulose 5-phosphate reductoisomerase; N 95.43
2o23_A 265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 95.4
2v6g_A 364 Progesterone 5-beta-reductase; tyrosine-dependent 95.36
3k6j_A 460 Protein F01G10.3, confirmed by transcript evidenc; 95.33
4e3z_A 272 Putative oxidoreductase protein; PSI-biology, stru 95.3
3l77_A 235 Short-chain alcohol dehydrogenase; oxidoreductase; 95.2
1db3_A 372 GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lya 95.18
1z45_A 699 GAL10 bifunctional protein; epimerase, mutarotase, 95.16
3e03_A 274 Short chain dehydrogenase; structural genomics, PS 95.12
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 95.12
4iin_A 271 3-ketoacyl-acyl carrier protein reductase (FABG); 95.1
1n7h_A 381 GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, 95.05
2rh8_A 338 Anthocyanidin reductase; flavonoids, rossmann fold 95.05
2hrz_A 342 AGR_C_4963P, nucleoside-diphosphate-sugar epimeras 95.05
3ijr_A 291 Oxidoreductase, short chain dehydrogenase/reducta; 95.02
2hk9_A275 Shikimate dehydrogenase; shikimate pathway, drug d 95.0
1i24_A 404 Sulfolipid biosynthesis protein SQD1; SDR, short-c 94.97
3o38_A 266 Short chain dehydrogenase; tuberculosis, ortholog 94.97
3qiv_A 253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 94.96
2q2v_A 255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 94.93
3tpc_A 257 Short chain alcohol dehydrogenase-related dehydro; 94.91
2p4h_X 322 Vestitone reductase; NADPH-dependent reductase, is 94.91
4fc7_A 277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 94.87
4e6p_A 259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 94.87
3d7l_A202 LIN1944 protein; APC89317, structural genomics, PS 94.8
3mog_A 483 Probable 3-hydroxybutyryl-COA dehydrogenase; struc 94.77
2bll_A 345 Protein YFBG; decarboxylase, short chain dehydroge 94.74
2dtx_A 264 Glucose 1-dehydrogenase related protein; rossmann 94.73
1oc2_A 348 DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos 94.72
2c29_D 337 Dihydroflavonol 4-reductase; flavonoids, short deh 94.72
2x6t_A 357 ADP-L-glycero-D-manno-heptose-6-epimerase; isomera 94.7
3n74_A 261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 94.7
3orf_A 251 Dihydropteridine reductase; alpha-beta-alpha sandw 94.7
1uls_A 245 Putative 3-oxoacyl-acyl carrier protein reductase; 94.67
3nzo_A 399 UDP-N-acetylglucosamine 4,6-dehydratase; structura 94.65
1eq2_A 310 ADP-L-glycero-D-mannoheptose 6-epimerase; N-termin 94.63
3tzq_B 271 Short-chain type dehydrogenase/reductase; ssgcid, 94.6
3rwb_A 247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 94.55
3cxt_A 291 Dehydrogenase with different specificities; rossma 94.52
2b69_A 343 UDP-glucuronate decarboxylase 1; UDP-glucoronic ac 94.49
1pqw_A198 Polyketide synthase; rossmann fold, dimer, structu 94.48
3sc4_A 285 Short chain dehydrogenase (A0QTM2 homolog); ssgcid 94.47
1zcj_A 463 Peroxisomal bifunctional enzyme; peroxisomal multi 94.46
1h5q_A 265 NADP-dependent mannitol dehydrogenase; oxidoreduct 94.45
3qlj_A 322 Short chain dehydrogenase; structural genomics, se 94.43
2fwm_X 250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e 94.43
1obf_O 335 Glyceraldehyde 3-phosphate dehydrogenase; glycolyt 94.43
3vtz_A 269 Glucose 1-dehydrogenase; rossmann fold, oxidoreduc 94.42
3afn_B 258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 94.4
3kvo_A 346 Hydroxysteroid dehydrogenase-like protein 2; HSDL2 94.39
3pgx_A 280 Carveol dehydrogenase; structural genomics, seattl 94.39
3ai3_A 263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 94.38
3r1i_A 276 Short-chain type dehydrogenase/reductase; structur 94.37
3pxx_A 287 Carveol dehydrogenase; structural genomics, seattl 94.35
4dqx_A 277 Probable oxidoreductase protein; structural genomi 94.34
2hun_A 336 336AA long hypothetical DTDP-glucose 4,6-dehydrat; 94.33
2ew8_A 249 (S)-1-phenylethanol dehydrogenase; transferase; 2. 94.31
2dkn_A 255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 94.29
3h9e_O 346 Glyceraldehyde-3-phosphate dehydrogenase, testis-; 94.26
3eag_A 326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME 94.26
3un1_A 260 Probable oxidoreductase; structural genomics, PSI- 94.24
3ak4_A 263 NADH-dependent quinuclidinone reductase; SDR, (R)- 94.23
3tjr_A 301 Short chain dehydrogenase; structural genomics, se 94.22
3s55_A 281 Putative short-chain dehydrogenase/reductase; stru 94.2
2wsb_A 254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 94.18
1hdc_A 254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 94.15
2ewd_A 317 Lactate dehydrogenase,; protein-substrate_cofactor 94.14
3is3_A 270 17BETA-hydroxysteroid dehydrogenase; short chain d 94.12
3lyl_A 247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 94.12
3i1j_A 247 Oxidoreductase, short chain dehydrogenase/reducta; 94.09
1vl8_A 267 Gluconate 5-dehydrogenase; TM0441, structural geno 94.08
2aef_A234 Calcium-gated potassium channel MTHK; rossmann fol 94.06
3gvc_A 277 Oxidoreductase, probable short-chain type dehydrog 94.05
1smk_A 326 Malate dehydrogenase, glyoxysomal; tricarboxylic c 94.04
3gk3_A 269 Acetoacetyl-COA reductase; acetoacetyl-CO reductas 94.04
2jah_A 247 Clavulanic acid dehydrogenase; short-chain dehydro 94.0
3m1a_A 281 Putative dehydrogenase; short, PSI, MCSG, structur 93.95
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 93.94
4eso_A 255 Putative oxidoreductase; NADP, structural genomics 93.94
3imf_A 257 Short chain dehydrogenase; structural genomics, in 93.93
3ioy_A 319 Short-chain dehydrogenase/reductase SDR; structura 93.92
1fjh_A 257 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc 93.92
3rih_A 293 Short chain dehydrogenase or reductase; structural 93.92
3uve_A 286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 93.91
3pk0_A 262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 93.87
3op4_A 248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 93.86
3o26_A 311 Salutaridine reductase; short chain dehydrogenase/ 93.86
1spx_A 278 Short-chain reductase family member (5L265); paral 93.84
2ehd_A 234 Oxidoreductase, oxidoreductase, short-chain dehydr 93.83
3u5t_A 267 3-oxoacyl-[acyl-carrier-protein] reductase; struct 93.82
4dqv_A 478 Probable peptide synthetase NRP (peptide synthase; 93.81
3i4f_A 264 3-oxoacyl-[acyl-carrier protein] reductase; struct 93.79
1uzm_A 247 3-oxoacyl-[acyl-carrier protein] reductase; beta-k 93.75
3h7a_A 252 Short chain dehydrogenase; oxidoreductase, PSI-2, 93.74
1nff_A 260 Putative oxidoreductase RV2002; directed evolution 93.74
3tfo_A 264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 93.73
3sju_A 279 Keto reductase; short-chain dehydrogenase, oxidore 93.71
3u9l_A 324 3-oxoacyl-[acyl-carrier-protein] reductase; struct 93.69
3ius_A 286 Uncharacterized conserved protein; APC63810, silic 93.69
2i99_A312 MU-crystallin homolog; thyroid hormine binding pro 93.65
3ojo_A 431 CAP5O; rossmann fold, complex with cofactor NAD an 93.64
1yxm_A 303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 93.64
3osu_A 246 3-oxoacyl-[acyl-carrier-protein] reductase; struct 93.63
1gz6_A 319 Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MF 93.62
3gem_A 260 Short chain dehydrogenase; structural genomics, AP 93.62
1zem_A 262 Xylitol dehydrogenase; rossmann fold, dinucleotide 93.59
3v2h_A 281 D-beta-hydroxybutyrate dehydrogenase; structural g 93.58
2z1n_A 260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 93.57
1g0o_A 283 Trihydroxynaphthalene reductase; protein-NADPH-act 93.55
2uvd_A 246 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k 93.55
1gr0_A 367 Inositol-3-phosphate synthase; isomerase, oxidored 93.55
2pnf_A 248 3-oxoacyl-[acyl-carrier-protein] reductase; short 93.54
4dmm_A 269 3-oxoacyl-[acyl-carrier-protein] reductase; rossma 93.53
3grp_A 266 3-oxoacyl-(acyl carrierprotein) reductase; structu 93.53
4e2x_A416 TCAB9; kijanose, tetronitrose, tetradeoxy sugar, s 93.52
3gaf_A 256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 93.52
2ph3_A 245 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 93.5
3oec_A 317 Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; 93.49
1wly_A333 CAAR, 2-haloacrylate reductase; NADPH-dependent ox 93.48
2hq1_A 247 Glucose/ribitol dehydrogenase; CTH-1438, structura 93.48
3lf2_A 265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 93.47
1wdk_A 715 Fatty oxidation complex alpha subunit; alpha2BETA2 93.46
2b4q_A 276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 93.44
4dyv_A 272 Short-chain dehydrogenase/reductase SDR; structura 93.43
1hyh_A 309 L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2 93.43
3oig_A 266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 93.41
1gpj_A 404 Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro 93.4
3ezl_A 256 Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA 93.39
3gdg_A 267 Probable NADP-dependent mannitol dehydrogenase; ro 93.38
1fmc_A 255 7 alpha-hydroxysteroid dehydrogenase; short-chain 93.38
1yb1_A 272 17-beta-hydroxysteroid dehydrogenase type XI; shor 93.36
3sx2_A 278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 93.34
1qsg_A 265 Enoyl-[acyl-carrier-protein] reductase; enoyl redu 93.34
2cfc_A 250 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor 93.34
3oid_A 258 Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa 93.33
3ucx_A 264 Short chain dehydrogenase; ssgcid, seattle structu 93.32
1ja9_A 274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 93.26
3ek2_A 271 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 93.23
2x9g_A 288 PTR1, pteridine reductase; short chain dehydrogena 93.23
2hcy_A347 Alcohol dehydrogenase 1; tetramer of asymmetric di 93.23
1sny_A 267 Sniffer CG10964-PA; alpha and beta protein, rossma 93.22
2a4k_A 263 3-oxoacyl-[acyl carrier protein] reductase; reduct 93.22
1zmt_A 254 Haloalcohol dehalogenase HHEC; halohydrin dehaloge 93.22
1ae1_A 273 Tropinone reductase-I; oxidoreductase, tropane alk 93.21
1xg5_A 279 ARPG836; short chain dehydrogenase, human, SGC, st 93.19
4dry_A 281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 93.18
3k31_A 296 Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI 93.18
2ae2_A 260 Protein (tropinone reductase-II); oxidoreductase, 93.15
3pym_A 332 GAPDH 3, glyceraldehyde-3-phosphate dehydrogenase 93.14
3rkr_A 262 Short chain oxidoreductase; rossmann fold; HET: NA 93.14
1gee_A 261 Glucose 1-dehydrogenase; short-chain dehydrogenase 93.12
1wma_A 276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 93.12
2wtb_A 725 MFP2, fatty acid multifunctional protein (ATMFP2); 93.12
3t7c_A 299 Carveol dehydrogenase; structural genomics, seattl 93.11
1hxh_A 253 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b 93.1
3p19_A 266 BFPVVD8, putative blue fluorescent protein; rossma 93.1
3awd_A 260 GOX2181, putative polyol dehydrogenase; oxidoreduc 93.09
1w6u_A 302 2,4-dienoyl-COA reductase, mitochondrial precursor 93.08
1x1t_A 260 D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S 93.08
4ibo_A 271 Gluconate dehydrogenase; enzyme function initiativ 93.06
2rhc_B 277 Actinorhodin polyketide ketoreductase; oxidoreduct 93.02
2c07_A 285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 93.02
2ep7_A 342 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; o 93.0
3ftp_A 270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 92.99
1zk4_A 251 R-specific alcohol dehydrogenase; short chain redu 92.98
1yo6_A 250 Putative carbonyl reductase sniffer; tyrosine-depe 92.95
1qor_A327 Quinone oxidoreductase; HET: NAP; 2.20A {Escherich 92.95
3l6e_A 235 Oxidoreductase, short-chain dehydrogenase/reducta; 92.94
1pzg_A 331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 92.93
2d5c_A263 AROE, shikimate 5-dehydrogenase; substrate, dimer, 92.92
1geg_A 256 Acetoin reductase; SDR family, oxidoreductase; HET 92.91
3f1l_A 252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 92.9
3nyw_A 250 Putative oxidoreductase; fatty acid synthesis,3-ox 92.83
4egf_A 266 L-xylulose reductase; structural genomics, ssgcid, 92.77
>1oi7_A Succinyl-COA synthetase alpha chain; SCS, ligase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.23A {Thermus thermophilus} SCOP: c.2.1.8 c.23.4.1 Back     alignment and structure
Probab=99.91  E-value=1.2e-24  Score=187.47  Aligned_cols=115  Identities=51%  Similarity=0.837  Sum_probs=109.2

Q ss_pred             eeecCCceEEEEccCCCCchhhhHHHHHhCCceEEeeccCCCCCeEecCccccccHHHHHhccCCcEEEEeeChHHHHHH
Q 030169           53 VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVVGGVTPKKGGTEHLGLPVFNSVAEAKAETKANASVIYVPPPFAAAA  132 (182)
Q Consensus        53 ~li~~~trViVvG~tGkmG~~v~k~~~~~g~~IV~AgVdp~~~G~~i~GvPVy~Sv~ea~~~~~~DvaVdfVpp~av~~a  132 (182)
                      +++++++||+|+|++|+||+.+++.++++|++++ ++|+|++.|+++.|+|||+|++|+++++++|+++||+||+.+.++
T Consensus         2 ~~~~~~~~VaVvGasG~~G~~~~~~l~~~g~~~v-~~VnP~~~g~~i~G~~vy~sl~el~~~~~~Dv~Ii~vp~~~~~~~   80 (288)
T 1oi7_A            2 ILVNRETRVLVQGITGREGQFHTKQMLTYGTKIV-AGVTPGKGGMEVLGVPVYDTVKEAVAHHEVDASIIFVPAPAAADA   80 (288)
T ss_dssp             CSCCTTCEEEEETTTSHHHHHHHHHHHHHTCEEE-EEECTTCTTCEETTEEEESSHHHHHHHSCCSEEEECCCHHHHHHH
T ss_pred             eecCCCCEEEEECCCCCHHHHHHHHHHHcCCeEE-EEECCCCCCceECCEEeeCCHHHHhhcCCCCEEEEecCHHHHHHH
Confidence            6899999999999999999999999999999988 999999877788999999999999987789999999999999999


Q ss_pred             HHHHHHcCCCEEEEeCCCCCHHHHHHHHHHhcccch
Q 030169          133 IMEAMEAELDLVVCITEGIPQHDMVINFTRVNILLV  168 (182)
Q Consensus       133 ~~eAie~GIk~VV~iTeG~~~eD~~~l~~~ak~ipv  168 (182)
                      +++|+++|++.+|++|+||+++|+.++.++|++.++
T Consensus        81 ~~ea~~~Gi~~vVi~t~G~~~~~~~~l~~~a~~~gi  116 (288)
T 1oi7_A           81 ALEAAHAGIPLIVLITEGIPTLDMVRAVEEIKALGS  116 (288)
T ss_dssp             HHHHHHTTCSEEEECCSCCCHHHHHHHHHHHHHHTC
T ss_pred             HHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHcCC
Confidence            999999999999989999999999999999988766
>2yv2_A Succinyl-COA synthetase alpha chain; COA-binding domain, ligase, structural genomics, NPPSFA; 2.20A {Aeropyrum pernix} Back     alignment and structure
>2yv1_A Succinyl-COA ligase [ADP-forming] subunit alpha; COA-binding domain, structural genomics, NPPSFA; 1.70A {Methanocaldococcus jannaschii} Back     alignment and structure
>2fp4_A Succinyl-COA ligase [GDP-forming] alpha-chain, mitochondrial; active site phosphohistidine residue; HET: NEP GTP; 2.08A {Sus scrofa} SCOP: c.2.1.8 c.23.4.1 PDB: 2fpg_A* 2fpi_A* 2fpp_A* 1euc_A* 1eud_A* Back     alignment and structure
>2nu8_A Succinyl-COA ligase [ADP-forming] subunit alpha; citric acid cycle, heterotetramer, ligase, ATP-grAsp fold, R fold; HET: COA; 2.15A {Escherichia coli} SCOP: c.2.1.8 c.23.4.1 PDB: 2nu9_A* 2nu7_A* 2nua_A* 2nu6_A* 2scu_A* 1jll_A* 1scu_A* 1jkj_A* 1cqj_A* 1cqi_A* Back     alignment and structure
>3mwd_B ATP-citrate synthase; ATP-grAsp, phosphohistidine, organic acid, lyase, transferas; HET: CIT; 2.10A {Homo sapiens} PDB: 3mwe_B* Back     alignment and structure
>3pff_A ATP-citrate synthase; phosphohistidine, organic acid, ATP-grAsp, lyase, transferas; HET: TLA ADP; 2.30A {Homo sapiens} Back     alignment and structure
>3ijp_A DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, decode biostructures, niaid, amino-acid biosynthesis, cytoplasm; HET: NAP; 2.30A {Bartonella henselae} Back     alignment and structure
>4f3y_A DHPR, dihydrodipicolinate reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Burkholderia thailandensis} Back     alignment and structure
>1iuk_A Hypothetical protein TT1466; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; 1.70A {Thermus thermophilus} SCOP: c.2.1.8 PDB: 1iul_A Back     alignment and structure
>1dih_A Dihydrodipicolinate reductase; oxidoreductase; HET: NDP; 2.20A {Escherichia coli} SCOP: c.2.1.3 d.81.1.3 PDB: 1arz_A* 1dru_A* 1drv_A* 1drw_A* Back     alignment and structure
>3qy9_A DHPR, dihydrodipicolinate reductase; rossmann fold, NADH, NADPH, oxidoreductase; 1.80A {Staphylococcus aureus} Back     alignment and structure
>2csu_A 457AA long hypothetical protein; structural genomics, PH0766, riken ST genomics/proteomics initiative, RSGI, NPPSFA; 2.20A {Pyrococcus horikoshii} SCOP: c.2.1.8 c.23.4.1 c.23.4.1 Back     alignment and structure
>2d59_A Hypothetical protein PH1109; COA binding, structural genomics; 1.65A {Pyrococcus horikoshii} SCOP: c.2.1.8 PDB: 2d5a_A* 2e6u_X* 3qa9_A 3q9n_A* 3q9u_A* Back     alignment and structure
>2duw_A Putative COA-binding protein; ligand binding protein; NMR {Klebsiella pneumoniae} Back     alignment and structure
>3ff4_A Uncharacterized protein; structural genomics, PSI- protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>1y81_A Conserved hypothetical protein; hyperthermophIle, structural genomics, PSI, protein structure initiative; HET: COA; 1.70A {Pyrococcus furiosus} SCOP: c.2.1.8 Back     alignment and structure
>1p9l_A Dihydrodipicolinate reductase; oxidoreductase, lysine biosynthesis, NADH binding specificity, TB structural genomics consortium; HET: NAD PDC PG4; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.3 d.81.1.3 PDB: 1c3v_A* 1yl5_A 1yl7_A* 1yl6_A* Back     alignment and structure
>1vm6_A DHPR, dihydrodipicolinate reductase; TM1520, structural genomics, protein structure initiative, PSI, joint center for structu genomics; HET: NAD PG4; 2.27A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.3 Back     alignment and structure
>3keo_A Redox-sensing transcriptional repressor REX; DNA binding protein, winged helix, rossmann fold, NAD+; HET: NAD; 1.50A {Streptococcus agalactiae serogroup iiiorganism_taxid} PDB: 3keq_A* 3ket_A* Back     alignment and structure
>1f06_A MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH-inhibitor ternary complex, oxidoreductase; HET: NDP 2NP; 2.10A {Corynebacterium glutamicum} SCOP: c.2.1.3 d.81.1.3 PDB: 1dap_A* 2dap_A* 3dap_A* Back     alignment and structure
>2dt5_A AT-rich DNA-binding protein; REX, NADH, NAD, rossmann fold, redox sensing, winged helix, themophilus; HET: NAD; 2.16A {Thermus thermophilus} SCOP: a.4.5.38 c.2.1.12 PDB: 1xcb_A* 3ikt_A* 3ikv_A 3il2_A* Back     alignment and structure
>4ew6_A D-galactose-1-dehydrogenase protein; nysgrc, PSI-biology, structural genomics, NEW YORK structura genomics research consortium, two domain; 2.30A {Rhizobium etli} Back     alignment and structure
>3o9z_A Lipopolysaccaride biosynthesis protein WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD AKG; 1.45A {Thermus thermophilus} PDB: 3oa0_A* Back     alignment and structure
>2vt3_A REX, redox-sensing transcriptional repressor REX; transcriptional regulation, redox poise; HET: ATP; 2.0A {Bacillus subtilis} PDB: 2vt2_A* Back     alignment and structure
>3evn_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics; 2.00A {Streptococcus agalactiae serogroup V} Back     alignment and structure
>3q2i_A Dehydrogenase; rossmann fold, UDP-sugar binding, NAD binding oxidoreductase; HET: NAD HP7; 1.50A {Chromobacterium violaceum} PDB: 3q2k_A* Back     alignment and structure
>2dc1_A L-aspartate dehydrogenase; NAD, oxidoreductase; HET: CIT NAD; 1.90A {Archaeoglobus fulgidus} Back     alignment and structure
>3euw_A MYO-inositol dehydrogenase; protein structure initiative II (PSI II), NYSGXRC, MYO-inosi dehydrogenase, oxidoreductase, tetramer; 2.30A {Corynebacterium glutamicum} Back     alignment and structure
>3e9m_A Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, PSI-II, dimeric dihydodiol dehydrogenase, structural genomics; 2.70A {Enterococcus faecalis} Back     alignment and structure
>4fb5_A Probable oxidoreductase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, GFO/IDH/MOCA family; 2.61A {Rhizobium etli} Back     alignment and structure
>3db2_A Putative NADPH-dependent oxidoreductase; two domain protein, rossman fold, putative dehydrogenase, ST genomics; 1.70A {Desulfitobacterium hafniense dcb-2} Back     alignment and structure
>3c1a_A Putative oxidoreductase; ZP_00056571.1, oxidoreductase FAM binding rossmann fold, structural genomics; HET: MSE PG4 PGE; 1.85A {Magnetospirillum magnetotacticum} Back     alignment and structure
>3e18_A Oxidoreductase; dehydrogenase, NAD-binding, structural genom protein structure initiative, PSI, NEW YORK structural GENO research consortium; HET: NAD; 1.95A {Listeria innocua} Back     alignment and structure
>3rc1_A Sugar 3-ketoreductase; sugar biosynthesis, TDP binding, NADP binding binding protein; HET: TLO NAP; 1.71A {Actinomadura kijaniata} PDB: 3rbv_A* 3rc2_A* 3rcb_A* 3rc7_A* 3rc9_A* Back     alignment and structure
>3oa2_A WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>1tlt_A Putative oxidoreductase (virulence factor MVIM HO; structural genomics, NYSGXRC, PSI, protein structure initiative; 2.70A {Escherichia coli} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>3i23_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.30A {Enterococcus faecalis} PDB: 3fd8_A* 3hnp_A Back     alignment and structure
>3kux_A Putative oxidoreductase; oxidoreductase family, csgid, structural genomics, center FO structural genomics of infectious diseases; HET: MSE; 2.75A {Yersinia pestis} Back     alignment and structure
>3moi_A Probable dehydrogenase; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics; 2.50A {Bordetella bronchiseptica} Back     alignment and structure
>3fhl_A Putative oxidoreductase; NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 1.93A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>4had_A Probable oxidoreductase protein; structural genomics, protein structure initiative, nysgrc, PSI-biology; 2.00A {Rhizobium etli} Back     alignment and structure
>1lc0_A Biliverdin reductase A; oxidoreductase, tetrapyrrole, bIle pigment, heme, bilirubin, NADH; 1.20A {Rattus norvegicus} SCOP: c.2.1.3 d.81.1.4 PDB: 1lc3_A* 1gcu_A 2h63_A* Back     alignment and structure
>3cea_A MYO-inositol 2-dehydrogenase; NP_786804.1, oxidoreductase FA NAD-binding rossmann fold, structural genomics; HET: NAD; 2.40A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>2glx_A 1,5-anhydro-D-fructose reductase; NADP(H) dependent reductase, rossmann-fold, sugar metabolism, 1,5-anhydro-D-mannitol, oxidoreductase; HET: NDP; 2.20A {Ensifer adhaerens} Back     alignment and structure
>2p2s_A Putative oxidoreductase; YP_050235.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.25A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>4hkt_A Inositol 2-dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium, oxidoreductase; HET: MSE; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>3dmy_A Protein FDRA; predicted actyl-COA synthetase, nysgrc, PSI-II, STRU genomics, protein structure initiative; 2.07A {Escherichia coli} Back     alignment and structure
>3ec7_A Putative dehydrogenase; alpha-beta, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; HET: MSE NAD EPE; 2.15A {Salmonella typhimurium} Back     alignment and structure
>1ydw_A AX110P-like protein; structural genomics, protein structure initiative, center for eukaryotic structural genomics, CESG, AT4G09670; 2.49A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.5 PDB: 2q4e_A Back     alignment and structure
>3e82_A Putative oxidoreductase; NAD, GFO/IDH/MOCA family, PSI-2, NYSGXRC, 11136F, structural genomics, protein structure initiative; 2.04A {Klebsiella pneumoniae subsp} Back     alignment and structure
>4gqa_A NAD binding oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: MSE; 2.42A {Klebsiella pneumoniae} Back     alignment and structure
>3uuw_A Putative oxidoreductase with NAD(P)-binding rossm domain; structural genomics, center for structural genomics of infec diseases, csgid; HET: 1PE PGE; 1.63A {Clostridium difficile} Back     alignment and structure
>3f4l_A Putative oxidoreductase YHHX; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Escherichia coli k-12} Back     alignment and structure
>3ezy_A Dehydrogenase; structural genomics, unknown function, PSI-2, protein structure initiative; 2.04A {Thermotoga maritima} Back     alignment and structure
>3mz0_A Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; MYO-inositol dehydrogenase, bsidh, oxidoreductase; HET: MSE PGE; 1.54A {Bacillus subtilis} PDB: 3nt2_A* 3nt4_A* 3nt5_A* 3nto_A* 3ntq_A* 3ntr_A* Back     alignment and structure
>3gdo_A Uncharacterized oxidoreductase YVAA; structural genomics, putative oxidoreductase YVAA, oxidoredu PSI-2, protein structure initiative; 2.03A {Bacillus subtilis subsp} PDB: 3gfg_A Back     alignment and structure
>3bio_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, MCSG, PSI-2, GFO/IDH/MO family, protein structure initiative; HET: MSE EPE; 1.80A {Porphyromonas gingivalis} Back     alignment and structure
>3m2t_A Probable dehydrogenase; PSI, SGXNY, structural genomics, protein structure initiative; HET: NAD; 2.30A {Chromobacterium violaceum} Back     alignment and structure
>3u3x_A Oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.79A {Sinorhizobium meliloti} Back     alignment and structure
>1zh8_A Oxidoreductase; TM0312, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI; HET: MSE NAP; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>3btv_A Galactose/lactose metabolism regulatory protein GAL80; eukaryotic transcription repressor, acetylation, carbohydrate metabolism; 2.10A {Saccharomyces cerevisiae} PDB: 3bts_A 3v2u_A* 3btu_A Back     alignment and structure
>4gmf_A Yersiniabactin biosynthetic protein YBTU; rossmann fold, NADPH dependent thiazoline reductase, oxidore; HET: EPE; 1.85A {Yersinia enterocolitica subsp} PDB: 4gmg_A* Back     alignment and structure
>3oqb_A Oxidoreductase; structural genomics, protein structure INI NEW YORK structural genomix research consortium, NYSGXRC, PSI-2; 2.60A {Bradyrhizobium japonicum} Back     alignment and structure
>3ohs_X Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; dimeric dihydrodiol dehydrogenase, MDD, oxidoreductase; 1.90A {Macaca fascicularis} PDB: 2o48_X 2poq_X* 2o4u_X Back     alignment and structure
>1h6d_A Precursor form of glucose-fructose oxidoreductase; protein translocation, periplasmic oxidoreductase, signal peptide, ligand binding,; HET: NDP; 2.05A {Zymomonas mobilis} SCOP: c.2.1.3 d.81.1.5 PDB: 1h6b_A* 1h6a_A* 1h6c_A* 1ryd_A* 1rye_A* 1ofg_A* 1evj_A* Back     alignment and structure
>3ip3_A Oxidoreductase, putative; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.14A {Thermotoga maritima} Back     alignment and structure
>4h3v_A Oxidoreductase domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 1.68A {Kribbella flavida} Back     alignment and structure
>2ixa_A Alpha-N-acetylgalactosaminidase; NAD, A-ECO conversion, hydrolase; HET: NAD; 2.3A {Flavobacterium meningosepticum} PDB: 2ixb_A* Back     alignment and structure
>2nvw_A Galactose/lactose metabolism regulatory protein GAL80; transcription, galactose metabolism, repressor; 2.10A {Kluyveromyces lactis} SCOP: c.2.1.3 d.81.1.5 PDB: 3e1k_A Back     alignment and structure
>3dty_A Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetramer, PSI-2, 11131, NYSGXRC, structural genomics, protein structure initiative; 2.04A {Pseudomonas syringae PV} Back     alignment and structure
>3v5n_A Oxidoreductase; structural genomics, PSI-biology, protein structure initiati nysgrc, NEW YORK structural genomics research consortium; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>3upl_A Oxidoreductase; rossmann fold, NADPH binding; 1.50A {Brucella melitensis biovar abortus 230ORGANISM_TAXID} PDB: 3upy_A* Back     alignment and structure
>3nkl_A UDP-D-quinovosamine 4-dehydrogenase; alpha-beta fold, structural genomics, PSI-2, protein structu initiative; HET: MSE GOL; 1.90A {Vibrio fischeri} Back     alignment and structure
>1j5p_A Aspartate dehydrogenase; TM1643, structural genomics, JCSG, protein structure initiative, joint center for structural G oxidoreductase; HET: NAD; 1.90A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.3 PDB: 1h2h_A* Back     alignment and structure
>1xea_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, protein structure initiative, NYSGXRC, VCA1048, GFO/IDH/MOCA family oxidoreductase; 2.65A {Vibrio cholerae} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>3do5_A HOM, homoserine dehydrogenase; NP_069768.1, putative homoserine dehydrogenase, structural G joint center for structural genomics, JCSG; 2.20A {Archaeoglobus fulgidus} Back     alignment and structure
>3c8m_A Homoserine dehydrogenase; structural genomics, APC89447, PS protein structure initiative, midwest center for structural genomics; HET: MSE; 1.90A {Thermoplasma volcanium GSS1} PDB: 3jsa_A* Back     alignment and structure
>3mtj_A Homoserine dehydrogenase; rossmann-fold, PSI, MCSG, structural genomics, midwest cente structural genomics; 2.15A {Thiobacillus denitrificans} Back     alignment and structure
>3ing_A Homoserine dehydrogenase; NP_394635.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: NDP; 1.95A {Thermoplasma acidophilum} Back     alignment and structure
>3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} Back     alignment and structure
>2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} Back     alignment and structure
>2g0t_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.67A {Thermotoga maritima} SCOP: c.37.1.10 Back     alignment and structure
>1i36_A Conserved hypothetical protein MTH1747; NADP binding domain, protein NADP complex, structural genomics, PSI; HET: NAP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.100.1.8 c.2.1.6 Back     alignment and structure
>2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A Back     alignment and structure
>2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>2ejw_A HDH, homoserine dehydrogenase; NAD-dependent, oxidoreductase; 1.70A {Thermus thermophilus} Back     alignment and structure
>2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A* Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>2obn_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, unknown function; HET: PG4; 2.30A {Anabaena variabilis} Back     alignment and structure
>1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} Back     alignment and structure
>1ebf_A Homoserine dehydrogenase; dinucleotide, NAD, dimer, oxidoreductase; HET: NAD; 2.30A {Saccharomyces cerevisiae} SCOP: c.2.1.3 d.81.1.2 PDB: 1ebu_A* 1tve_A* 1q7g_A* Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>2czc_A Glyceraldehyde-3-phosphate dehydrogenase; glycolysis, NAD, oxidoreductase, structural genomics; HET: NAD; 2.00A {Pyrococcus horikoshii} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>1b7g_O Protein (glyceraldehyde 3-phosphate dehydrogenase; archaea, hyperthermophIle, GAPDH, hyperthermophilic dehydrog oxidoreductase; 2.05A {Sulfolobus solfataricus} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>3dr3_A N-acetyl-gamma-glutamyl-phosphate reductase; csgid target, ARGC, essential gene, amino-acid biosynthesis, arginine biosynthesis, cytoplasm; HET: MLT; 2.00A {Shigella flexneri} PDB: 2g17_A Back     alignment and structure
>1cf2_P Protein (glyceraldehyde-3-phosphate dehydrogenase); oxydoreductase, oxidoreductase; HET: NAP; 2.10A {Methanothermus fervidus} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3b1f_A Putative prephenate dehydrogenase; enzyme, 4-hydroxyphenylpyruvate, oxidative decarboxylation pathway, tyrosine biosynthesis, oxidoreduct; HET: NAD; 2.10A {Streptococcus mutans} PDB: 3dzb_A Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Back     alignment and structure
>2py6_A Methyltransferase FKBM; YP_546752.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; 2.15A {Methylobacillus flagellatus KT} SCOP: c.66.1.56 Back     alignment and structure
>2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>4dgs_A Dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>1nvm_B Acetaldehyde dehydrogenase (acylating), 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>3fr7_A Putative ketol-acid reductoisomerase (OS05G057370 protein); rossmann fold, NADPH, knotted protein, branched-chain amino biosynthesis; 1.55A {Oryza sativa japonica group} PDB: 3fr8_A* 1qmg_A* 1yve_I* Back     alignment and structure
>3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* Back     alignment and structure
>2ozp_A N-acetyl-gamma-glutamyl-phosphate reductase; amino acid biosynthesis, structural genomics, riken structur genomics/proteomics initiative; 2.01A {Thermus thermophilus} Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Back     alignment and structure
>2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* Back     alignment and structure
>1yqg_A Pyrroline-5-carboxylate reductase; structural genomics, PSI, structure initiative, midwest center for structural genomic oxidoreductase; 1.90A {Neisseria meningitidis} SCOP: a.100.1.10 c.2.1.6 PDB: 2ag8_A* Back     alignment and structure
>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>2ep5_A 350AA long hypothetical aspartate-semialdehyde dehydrogenase; oxidoreductase, structural genomics, NPPSFA; 2.40A {Sulfolobus tokodaii} Back     alignment and structure
>2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} Back     alignment and structure
>3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>1qp8_A Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A {Pyrobaculum aerophilum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A* Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 Back     alignment and structure
>4dpk_A Malonyl-COA/succinyl-COA reductase; dinucleotide binding, dimerization domain, NADP, oxidoreductase; 2.05A {Sulfolobus tokodaii} PDB: 4dpm_A* Back     alignment and structure
>4dpl_A Malonyl-COA/succinyl-COA reductase; dinucleotide binding, dimerization domain, NADP, oxidoreductase; HET: NAP; 1.90A {Sulfolobus tokodaii} PDB: 4dpk_A* 4dpm_A* Back     alignment and structure
>3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} Back     alignment and structure
>4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A Back     alignment and structure
>1ys4_A Aspartate-semialdehyde dehydrogenase; oxidoreductase, asadh; HET: NAP; 2.29A {Methanocaldococcus jannaschii} Back     alignment and structure
>2yjz_A Metalloreductase steap4; oxidoreductase, metabolic syndrome; HET: NAP; 2.20A {Rattus norvegicus} Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>1pgj_A 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; oxidoreductase, CHOH(D)-NADP+(B); 2.82A {Trypanosoma brucei} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>1np3_A Ketol-acid reductoisomerase; A DEEP figure-OF-eight knot, C-terminal alpha-helical domain oxidoreductase; 2.00A {Pseudomonas aeruginosa} SCOP: a.100.1.2 c.2.1.6 Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>1xyg_A Putative N-acetyl-gamma-glutamyl-phosphate reduct; structural genomics, protein structure initiative, CENT eukaryotic structural genomics; 2.19A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.1 PDB: 2q49_A 2cvo_A Back     alignment and structure
>3obb_A Probable 3-hydroxyisobutyrate dehydrogenase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: EPE; 2.20A {Pseudomonas aeruginosa} PDB: 3q3c_A* Back     alignment and structure
>3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} Back     alignment and structure
>2hjs_A USG-1 protein homolog; aspartate-semialdehyde dehydrogenase, probable hydrolase, PS aeruginosa, structurual genomics; 2.20A {Pseudomonas aeruginosa} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>1yj8_A Glycerol-3-phosphate dehydrogenase; SGPP, structural genomics, PSI; 2.85A {Plasmodium falciparum} Back     alignment and structure
>1x0v_A GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic; two independent domains, GXGXXG motif, oxidoreductase; 2.30A {Homo sapiens} PDB: 1x0x_A* 1wpq_A* 2pla_A* Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structur genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus} Back     alignment and structure
>2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B Back     alignment and structure
>3e5r_O PP38, glyceraldehyde-3-phosphate dehydrogenase, cytosolic; GAPDH, RICE, oxidoreductase, cytoplasm, glycolysis, NAD; HET: NAD; 2.30A {Oryza sativa subsp} PDB: 3e6a_O Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>2r00_A Aspartate-semialdehyde dehydrogenase; conformational change, half-OF-sites-reactivity, protein evolution, sequence homology; HET: HTI; 2.03A {Vibrio cholerae} PDB: 2qz9_A* 2r00_C* Back     alignment and structure
>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* Back     alignment and structure
>2q3e_A UDP-glucose 6-dehydrogenase; hexamer, structural genomics, S genomics consortium, SGC, oxidoreductase; HET: NAD UPG; 2.00A {Homo sapiens} PDB: 2qg4_A* 3khu_A* 3itk_A* 3tdk_A* 3ptz_A* 3prj_A* 3tf5_A Back     alignment and structure
>3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>1mx3_A CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepresso transcription repressor; HET: NAD; 1.95A {Homo sapiens} SCOP: c.2.1.4 c.23.12.1 PDB: 1hku_A* 1hl3_A* 2hu2_A* 3ga0_A 2ome_A* Back     alignment and structure
>1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A* Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* Back     alignment and structure
>2nqt_A N-acetyl-gamma-glutamyl-phosphate reductase; apoprotein, dimer, rossmann fold, structural genomics, PSI, protein structure initiative; 1.58A {Mycobacterium tuberculosis} PDB: 2i3a_A* 2i3g_A Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} Back     alignment and structure
>4fgw_A Glycerol-3-phosphate dehydrogenase [NAD(+)] 1; oxidoreductase; 2.45A {Saccharomyces cerevisiae} Back     alignment and structure
>1dxy_A D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarboxylate dehydrogenase, D-lactate dehydrogenas oxidoreductase; HET: NAD; 1.86A {Lactobacillus casei} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>4ea9_A Perosamine N-acetyltransferase; beta helix, acetyl coenzyme A, GDP-perosa transferase; HET: JBT; 0.90A {Caulobacter vibrioides} PDB: 4ea8_A* 4ea7_A* 4eaa_A* 4eab_A* Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>3ulk_A Ketol-acid reductoisomerase; branched-chain amino acid biosynthesis, rossmann fold, acetolactate, oxidoreductase; HET: CSX NDP; 2.30A {Escherichia coli} PDB: 1yrl_A* Back     alignment and structure
>1dlj_A UDP-glucose dehydrogenase; rossmann fold, ternary complex, crystallographic dimer, oxidoreductase; HET: NAI UGA; 1.80A {Streptococcus pyogenes} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1dli_A* Back     alignment and structure
>3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} Back     alignment and structure
>1u8f_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase, liver; rossmann fold, oxidoreductase, mammalian GAPDH; HET: NAD; 1.75A {Homo sapiens} SCOP: c.2.1.3 d.81.1.1 PDB: 1znq_O* 1j0x_O* 3gpd_R* 1dss_G* 1crw_G* 1szj_G* 1ihx_A* 1ihy_A* 1gpd_G* 4gpd_1 Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 Back     alignment and structure
>3hsk_A Aspartate-semialdehyde dehydrogenase; candida albicans NADP complex, amino-acid biosynthesis; HET: NAP; 2.20A {Candida albicans} Back     alignment and structure
>2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* Back     alignment and structure
>3pwk_A Aspartate-semialdehyde dehydrogenase; NADP binding, oxidoreductase-oxidoreductase I complex; HET: 25A L14; 1.50A {Streptococcus pneumoniae} PDB: 2gyy_A* 2gz2_A* 2gz3_A* 2gz1_A* 3pws_A* 3pyl_A 3pyx_A* 3pzb_A* 3q11_A* 3q1l_A Back     alignment and structure
>4g2n_A D-isomer specific 2-hydroxyacid dehydrogenase, Na; structural genomics, protein structure initiative, nysgrc, P biology; 1.70A {Polaromonas SP} Back     alignment and structure
>1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} Back     alignment and structure
>2nac_A NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP} SCOP: c.2.1.4 c.23.12.1 PDB: 2nad_A* 2go1_A 2gug_A* 2gsd_A* 3fn4_A Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} Back     alignment and structure
>2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* Back     alignment and structure
>1t4b_A Aspartate-semialdehyde dehydrogenase; asadh, HOSR, lysine biosynthesis, NADP+ oxidoreductase (phosphorylating), domain movement; 1.60A {Escherichia coli} SCOP: c.2.1.3 d.81.1.1 PDB: 1t4d_A 1brm_A 1gl3_A* 1nwc_A 1ta4_A 1tb4_A 1ps8_A 1pr3_A 1oza_A 1pqu_A* 1pqp_A 1nwh_A* 1nx6_A* 1pu2_A* 1q2x_A* Back     alignment and structure
>2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A Back     alignment and structure
>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A Back     alignment and structure
>2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} Back     alignment and structure
>2i76_A Hypothetical protein; NADP, dehydrogenase, TM1727, structural genomics, PSI-2, protein structure initiative; HET: NDP; 3.00A {Thermotoga maritima} SCOP: a.100.1.10 c.2.1.6 Back     alignment and structure
>1xdw_A NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural variant of the BAB rossmann fold, oxidoreductase; 1.98A {Acidaminococcus fermentans} Back     alignment and structure
>3uw3_A Aspartate-semialdehyde dehydrogenase; structural genomics, seattle structural genomics center for infectious disease (ssgcid); 1.55A {Burkholderia thailandensis} Back     alignment and structure
>3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* Back     alignment and structure
>3pzr_A Aspartate-semialdehyde dehydrogenase; NADP, oxidoreductase-oxidoreductase inhibitor complex; HET: NAP; 1.75A {Vibrio cholerae} PDB: 1mc4_A 1mb4_A* 3q0e_A Back     alignment and structure
>2qyt_A 2-dehydropantoate 2-reductase; APC81190, porphyromonas gingi W83, structural genomics, PSI-2; HET: MSE; 2.15A {Porphyromonas gingivalis} Back     alignment and structure
>1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>1j4a_A D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase, reversible interconversion of pyruvate INTO D-lactate; 1.90A {Lactobacillus delbrueckii subsp} SCOP: c.2.1.4 c.23.12.1 PDB: 1j49_A* 2dld_A* Back     alignment and structure
>3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosy structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A* Back     alignment and structure
>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} Back     alignment and structure
>2ph5_A Homospermidine synthase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: NAD; 2.50A {Legionella pneumophila subsp} Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Back     alignment and structure
>3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 Back     alignment and structure
>3tz6_A Aspartate-semialdehyde dehydrogenase; asadh, ASD, ASA, amino-acid biosynthesis, diaminopimelate biosynthesis, lysine biosynthesis; HET: SO4; 1.95A {Mycobacterium tuberculosis} PDB: 3vos_A* 3kub_A 3llg_A Back     alignment and structure
>3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} Back     alignment and structure
>3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} Back     alignment and structure
>2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase; structural genomics, PSI-2, P structure initiative; 1.90A {Ralstonia solanacearum} Back     alignment and structure
>2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} Back     alignment and structure
>2yq5_A D-isomer specific 2-hydroxyacid dehydrogenase; oxidoreductase; HET: NAD; 2.75A {Lactobacillus delbrueckii subsp} PDB: 2yq4_A* Back     alignment and structure
>2p5y_A UDP-glucose 4-epimerase; TTHA0591, structural genomics, PSI; HET: NAD; 1.92A {Thermus thermophilus HB8} PDB: 2p5u_A* Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>4hy3_A Phosphoglycerate oxidoreductase; PSI-biology, structural genomics, protein structure initiati acid transport and metabolism, NAD binding domain.; 2.80A {Rhizobium etli} Back     alignment and structure
>2o3j_A UDP-glucose 6-dehydrogenase; structural genomics, PSI-2, prote structure initiative, NEW YORK SGX research center for STRU genomics; 1.88A {Caenorhabditis elegans} Back     alignment and structure
>1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* Back     alignment and structure
>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
>3g17_A Similar to 2-dehydropantoate 2-reductase; structural genomics, putative 2-dehydropantoate 2-reductase, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Back     alignment and structure
>1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>2x5j_O E4PDH, D-erythrose-4-phosphate dehydrogenase; oxidoreductase, hydride transfer, aldehyde dehydrogenase, PY biosynthesis; 2.30A {Escherichia coli} PDB: 2xf8_A* 2x5k_O* Back     alignment and structure
>4e5n_A Thermostable phosphite dehydrogenase; D-2-hydroxyacid dehydrogenase, oxidoreductase; HET: NAD; 1.70A {Pseudomonas stutzeri} PDB: 4e5k_A* 4ebf_A* 4e5p_A* 4e5m_A* Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Back     alignment and structure
>2yv3_A Aspartate-semialdehyde dehydrogenase; aspartate pathway, structural genomics; 2.70A {Thermus thermophilus} Back     alignment and structure
>4b8w_A GDP-L-fucose synthase; oxidoreductase; HET: NAP GDP; 2.75A {Homo sapiens} Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Back     alignment and structure
>3b1j_A Glyceraldehyde 3-phosphate dehydrogenase (NADP+); alpha/beta fold, oxidoreductase-protein binding complex; HET: NAD; 2.20A {Synechococcus elongatus} PDB: 3b1k_A* 3b20_A* Back     alignment and structure
>1vkn_A N-acetyl-gamma-glutamyl-phosphate reductase; TM1782, structu genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; 1.80A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A Back     alignment and structure
>3ajr_A NDP-sugar epimerase; L-threonine dehydrogenase, L-3- hydroxynorvaline, oxidoreductase; HET: NAD; 1.77A {Thermoplasma volcanium} PDB: 3a9w_A* 3a4v_A* 3a1n_A* Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>3oet_A Erythronate-4-phosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.36A {Salmonella enterica subsp} Back     alignment and structure
>3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Back     alignment and structure
>2d2i_A Glyceraldehyde 3-phosphate dehydrogenase; rossmann fold, protein-NADP+ complex, oxidoreductase; HET: NAP; 2.50A {Synechococcus SP} PDB: 2duu_A Back     alignment and structure
>1gy8_A UDP-galactose 4-epimerase; oxidoreductase; HET: NAD UDP; 2.0A {Trypanosoma brucei} SCOP: c.2.1.2 PDB: 2cnb_A* Back     alignment and structure
>3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} Back     alignment and structure
>1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* Back     alignment and structure
>2o4c_A Erythronate-4-phosphate dehydrogenase; erythronate-4-phsphate, NAD, tartrate, phosph oxidoreductase; HET: NAD TLA; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3dfu_A Uncharacterized protein from 6-phosphogluconate dehydrogenase-like family; putative rossmann-like dehydrogenase, structural genomics; HET: MSE; 2.07A {Corynebacterium glutamicum} Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>1hdg_O Holo-D-glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase (aldehy(D)-NAD(A)); HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Back     alignment and structure
>2g82_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase; G3PDH, glycolysis, oxidoreductase, NAD, rossmann fold; HET: NAD PGE; 1.65A {Thermus aquaticus} SCOP: c.2.1.3 d.81.1.1 PDB: 1cer_O* 1vc2_A* Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Back     alignment and structure
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} SCOP: c.2.1.0 Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3c7a_A Octopine dehydrogenase; L) stereospecific opine dehydrogenas, oxidorecutase, oxidoreductase; HET: NAD; 2.10A {Pecten maximus} PDB: 3c7c_B* 3c7d_B* 3iqd_B* Back     alignment and structure
>3cps_A Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, glycolysis, malaria, structural genomics; HET: NAD; 1.90A {Cryptosporidium parvum iowa II} PDB: 1vsv_A* 1vsu_A* 3chz_A 3cie_A* 3cif_A* 3sth_A* Back     alignment and structure
>1rm4_O Glyceraldehyde 3-phosphate dehydrogenase A; rossmann fold, GAPDH-NADP complex, oxidoreductase; HET: NDP; 2.00A {Spinacia oleracea} SCOP: c.2.1.3 d.81.1.1 PDB: 1nbo_O* 2hki_A 2pkq_P* 1rm5_O* 1rm3_O* 2pkr_O* 1jn0_O* 3qv1_A* 3k2b_A* 3rvd_A* 2pkq_O* Back     alignment and structure
>1udb_A Epimerase, UDP-galactose-4-epimerase; isomerase; HET: NAD UFG; 1.65A {Escherichia coli} SCOP: c.2.1.2 PDB: 1lrj_A* 1nai_A* 1uda_A* 1nah_A* 1xel_A* 1kvq_A* 1kvs_A* 1udc_A* 2udp_A* 1a9z_A* 1kvt_A* 1kvr_A* 1lrk_A* 1lrl_A* 1kvu_A* 1a9y_A* Back     alignment and structure
>3cmc_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase; microspectrophotometry, reaction intermediate, dehydrogenase phosphate binding site; HET: G3H NAD; 1.77A {Bacillus stearothermophilus} SCOP: c.2.1.3 d.81.1.1 PDB: 2gd1_O 1gd1_O* 1npt_O* 1nqa_O* 1nqo_O* 1nq5_O* 2dbv_O* 1dbv_O* 3dbv_O* 4dbv_O* Back     alignment and structure
>1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Back     alignment and structure
>3a06_A 1-deoxy-D-xylulose 5-phosphate reductoisomerase; MEP pathway, isoprene biosynthesis, metal- NADP, oxidoreductase; HET: NDP; 2.00A {Thermotoga maritima} PDB: 3a14_A* Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Back     alignment and structure
>1gad_O D-glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase (aldehyde(D)-NAD+(A)); HET: NAD; 1.80A {Escherichia coli} SCOP: c.2.1.3 d.81.1.1 PDB: 1dc4_A* 1dc3_A 1dc6_A* 1dc5_A* 1s7c_A* 1gae_O* 2vyn_A* 2vyv_A* Back     alignment and structure
>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} Back     alignment and structure
>2ggs_A 273AA long hypothetical DTDP-4-dehydrorhamnose reductase; alpha, beta, oxidoreductase; HET: NDP; 1.70A {Sulfolobus tokodaii} Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>1kew_A RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fold, lyase; HET: TYD NAD; 1.80A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1g1a_A* 1keu_A* 1bxk_A* Back     alignment and structure
>3kb6_A D-lactate dehydrogenase; oxidoreductase, D-LDH, NAD, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; HET: MSE NAD 1PE; 2.12A {Aquifex aeolicus} Back     alignment and structure
>1r6d_A TDP-glucose-4,6-dehydratase; rossmann fold, short-chain dehydrogenase/reductase, lyase; HET: NAD DAU; 1.35A {Streptomyces venezuelae} SCOP: c.2.1.2 PDB: 1r66_A* Back     alignment and structure
>2yyy_A Glyceraldehyde-3-phosphate dehydrogenase; glyceraldehyde 3-phosphate binding, alpha and beta proteins (A/B) class, MJ1146; HET: NAP; 1.85A {Methanocaldococcus jannaschii} Back     alignment and structure
>1r0k_A 1-deoxy-D-xylulose 5-phosphate reductoisomerase; NADPH dependent, fosmidomycin, non- mevalonate pathway, oxidoreductase; 1.91A {Zymomonas mobilis} SCOP: a.69.3.1 c.2.1.3 d.81.1.3 PDB: 1r0l_A* Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Back     alignment and structure
>2v6g_A Progesterone 5-beta-reductase; tyrosine-dependent oxidoreductase, oxidoreductase, SDR, cardenolides, cardiac glycosides; HET: NAP; 2.3A {Digitalis lanata} PDB: 2v6f_A* Back     alignment and structure
>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Back     alignment and structure
>4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} Back     alignment and structure
>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* Back     alignment and structure
>1db3_A GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lyase; 2.30A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>1z45_A GAL10 bifunctional protein; epimerase, mutarotase, metabolism, isomerase; HET: GAL NAD GUD; 1.85A {Saccharomyces cerevisiae} SCOP: b.30.5.4 c.2.1.2 Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A Back     alignment and structure
>1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* Back     alignment and structure
>2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A Back     alignment and structure
>2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Back     alignment and structure
>1i24_A Sulfolipid biosynthesis protein SQD1; SDR, short-chain dehydrogenase/reductase, rossmann fold, BIO protein; HET: NAD UPG; 1.20A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1i2c_A* 1i2b_A* 1qrr_A* Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Back     alignment and structure
>2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa} Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Back     alignment and structure
>3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} Back     alignment and structure
>3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} Back     alignment and structure
>2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A Back     alignment and structure
>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A Back     alignment and structure
>1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* Back     alignment and structure
>2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* Back     alignment and structure
>2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Back     alignment and structure
>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>1eq2_A ADP-L-glycero-D-mannoheptose 6-epimerase; N-terminal domain rossmann fold, C-terminal mixed alpha/beta domain; HET: NAP ADQ; 2.00A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Back     alignment and structure
>2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* Back     alignment and structure
>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Back     alignment and structure
>3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} Back     alignment and structure
>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} Back     alignment and structure
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Back     alignment and structure
>3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} Back     alignment and structure
>2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} Back     alignment and structure
>1obf_O Glyceraldehyde 3-phosphate dehydrogenase; glycolytic pathway, oxidoreductase, free-NAD GAPDH; HET: PG4; 1.7A {Achromobacter xylosoxidans} SCOP: c.2.1.3 d.81.1.1 PDB: 3gnq_A* Back     alignment and structure
>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Back     alignment and structure
>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Back     alignment and structure
>2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Back     alignment and structure
>3h9e_O Glyceraldehyde-3-phosphate dehydrogenase, testis-; oxidoreductase, structural genomics, structural genomics CON SGC, glycolysis, NAD; HET: NAD; 1.72A {Homo sapiens} PDB: 3pfw_O* 2vyn_D* 2vyv_D* Back     alignment and structure
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} Back     alignment and structure
>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Back     alignment and structure
>1smk_A Malate dehydrogenase, glyoxysomal; tricarboxylic cycle, glyoxysome, NAD, glyoxylate bypass, oxidoreductase; HET: CIT; 2.50A {Citrullus lanatus} PDB: 1sev_A Back     alignment and structure
>3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Back     alignment and structure
>3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} Back     alignment and structure
>4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} SCOP: c.2.1.0 Back     alignment and structure
>1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Back     alignment and structure
>3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>2i99_A MU-crystallin homolog; thyroid hormine binding protein, oxidoreductase; HET: NDP; 2.60A {Homo sapiens} Back     alignment and structure
>3ojo_A CAP5O; rossmann fold, complex with cofactor NAD and EU(PDC)3, oxidi conformation, oxidoreductase; HET: NAD PDC; 2.50A {Staphylococcus aureus} PDB: 3ojl_A* Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A* Back     alignment and structure
>1gz6_A Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MFE-2, beta-oxidation, peroxisome, SDR, steroid biosynthesis, oxidoreductase, NADP; HET: NAI; 2.38A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1zbq_A* Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Back     alignment and structure
>1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* Back     alignment and structure
>2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} Back     alignment and structure
>1gr0_A Inositol-3-phosphate synthase; isomerase, oxidoreductase, PSI, protein structure initiative, TB structural genomics consortium, TB; HET: NAD; 1.95A {Mycobacterium tuberculosis} SCOP: c.2.1.3 d.81.1.3 Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Back     alignment and structure
>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Back     alignment and structure
>4e2x_A TCAB9; kijanose, tetronitrose, tetradeoxy sugar, sugar methylation, transferase; HET: SAH TYD; 1.40A {Micromonospora chalcea} PDB: 3ndi_A* 3ndj_A* 4e32_A* 4e33_A* 4e2y_A* 4e31_A* 4e2w_A* 4e2z_A* 4e30_A* Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Back     alignment and structure
>2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} Back     alignment and structure
>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} Back     alignment and structure
>1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} Back     alignment and structure
>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Back     alignment and structure
>1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: a.100.1.3 a.100.1.3 c.2.1.6 c.14.1.3 PDB: 1wdl_A* 1wdm_A* 2d3t_A* Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Back     alignment and structure
>1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Back     alignment and structure
>1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 Back     alignment and structure
>3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} SCOP: c.2.1.0 PDB: 3gdf_A Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Back     alignment and structure
>1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* Back     alignment and structure
>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Back     alignment and structure
>3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Back     alignment and structure
>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 Back     alignment and structure
>2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... Back     alignment and structure
>2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Back     alignment and structure
>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A* Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Back     alignment and structure
>3pym_A GAPDH 3, glyceraldehyde-3-phosphate dehydrogenase 3; NAD(P)-binding rossmann-fold domain, alpha and beta protein, oxidoreductase; HET: NAD; 2.00A {Saccharomyces cerevisiae} PDB: 2i5p_O* Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Back     alignment and structure
>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Back     alignment and structure
>2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Back     alignment and structure
>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 Back     alignment and structure
>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Back     alignment and structure
>1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* Back     alignment and structure
>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Back     alignment and structure
>2ep7_A GAPDH, glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase, structural genomics, NPPSFA; HET: NAD; 2.30A {Aquifex aeolicus} Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* Back     alignment and structure
>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 182
d1euca1130 c.2.1.8 (A:1-130) Succinyl-CoA synthetase, alpha-c 1e-50
d1oi7a1121 c.2.1.8 (A:1-121) Succinyl-CoA synthetase, alpha-c 3e-50
d2nu7a1119 c.2.1.8 (A:2-120) Succinyl-CoA synthetase, alpha-c 8e-50
>d1euca1 c.2.1.8 (A:1-130) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Pig (Sus scrofa) [TaxId: 9823]} Length = 130 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: CoA-binding domain
domain: Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain
species: Pig (Sus scrofa) [TaxId: 9823]

 Score =  157 bits (398), Expect = 1e-50
 Identities = 81/113 (71%), Positives = 93/113 (82%), Gaps = 1/113 (0%)

Query: 45  SAAASHPAVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVVGGVTPKKGGTEHLGLPV 104
           S  AS   ++VDKNT+VICQG TGK GTFH++QA+EYGT +V GG TP KGG  HLGLPV
Sbjct: 2   SYTASRKHLYVDKNTKVICQGFTGKQGTFHSQQALEYGTNLV-GGTTPGKGGKTHLGLPV 60

Query: 105 FNSVAEAKAETKANASVIYVPPPFAAAAIMEAMEAELDLVVCITEGIPQHDMV 157
           FN+V EAK +T A ASVIYVPPPFAAAAI EA++AE+ LVVCITEGIPQ DMV
Sbjct: 61  FNTVKEAKEQTGATASVIYVPPPFAAAAINEAIDAEVPLVVCITEGIPQQDMV 113
>d1oi7a1 c.2.1.8 (A:1-121) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Thermus thermophilus [TaxId: 274]} Length = 121 Back     information, alignment and structure
>d2nu7a1 c.2.1.8 (A:2-120) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Escherichia coli [TaxId: 562]} Length = 119 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query182
d1euca1130 Succinyl-CoA synthetase, alpha-chain, N-terminal ( 100.0
d1oi7a1121 Succinyl-CoA synthetase, alpha-chain, N-terminal ( 100.0
d2nu7a1119 Succinyl-CoA synthetase, alpha-chain, N-terminal ( 100.0
d1diha1162 Dihydrodipicolinate reductase {Escherichia coli [T 99.82
d1vm6a3128 Dihydrodipicolinate reductase {Thermotoga maritima 99.78
d1yl7a1135 Dihydrodipicolinate reductase {Mycobacterium tuber 99.75
d2csua1129 Acetate-CoA ligase alpha chain, AcdA, N-terminal d 99.7
d2d59a1139 Hypothetical protein PH1109 {Pyrococcus horikoshii 99.64
d1y81a1116 Hypothetical protein PF0725 {Pyrococcus furiosus [ 99.63
d1iuka_136 Hypothetical protein TT1466 {Thermus thermophilus 99.54
d2dt5a2126 Transcriptional repressor Rex, C-terminal domain { 99.15
d1f06a1170 Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb 99.07
d1tlta1164 Virulence factor MviM {Escherichia coli [TaxId: 56 98.94
d1ydwa1184 Probable oxidoreductase At4g09670 {Thale cress (Ar 98.93
d1zh8a1181 Hypothetical protein TM0312 {Thermotoga maritima [ 98.92
d1j5pa4132 Hypothetical protein TM1643 {Thermotoga maritima [ 98.8
d1lc0a1172 Biliverdin reductase {Rat (Rattus norvegicus) [Tax 98.77
d1h6da1221 Glucose-fructose oxidoreductase, N-terminal domain 98.75
d2nvwa1237 Galactose/lactose metabolism regulatory protein GA 98.58
d1xeaa1167 Putative oxidoreductase VCA1048 {Vibrio cholerae [ 98.58
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 98.5
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 98.37
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 98.35
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 98.14
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 98.03
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 97.92
d1b7go1178 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 97.85
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 97.77
d2hjsa1144 Usg-1 protein homolog PA3116 {Pseudomonas aerugino 97.74
d2czca2172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 97.72
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 97.7
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 97.69
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 97.62
d1mb4a1147 Aspartate beta-semialdehyde dehydrogenase {Vibrio 97.6
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 97.55
d1t4ba1146 Aspartate beta-semialdehyde dehydrogenase {Escheri 97.55
d1np3a2182 Class I ketol-acid reductoisomerase (KARI) {Pseudo 97.49
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 97.46
d1cf2o1171 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 97.45
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 97.44
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 97.38
d1nvmb1157 Acetaldehyde dehydrogenase (acylating) {Pseudomona 97.33
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 97.22
d2g17a1179 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 97.1
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 97.08
d2c5aa1 363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 97.05
d2gz1a1154 Aspartate beta-semialdehyde dehydrogenase {Strepto 97.04
d2g0ta1 338 Hypothetical protein TM0796 {Thermotoga maritima [ 97.0
d1udca_ 338 Uridine diphosphogalactose-4-epimerase (UDP-galact 96.84
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 96.81
d1dxya1199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 96.81
d1vl0a_ 281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 96.78
d1e6ua_ 315 GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( 96.76
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 96.74
d1orra_ 338 CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 96.74
d1qmga2226 Class II ketol-acid reductoisomerase (KARI) {Spina 96.69
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 96.68
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapien 96.64
d2cvza2156 Hydroxyisobutyrate dehydrogenase {Thermus thermoph 96.64
d1n2sa_ 298 dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {S 96.62
d1qyda_ 312 Pinoresinol-lariciresinol reductase {Giant arborvi 96.59
d1qyca_ 307 Phenylcoumaran benzylic ether reductase {Loblolly 96.52
d2bkaa1232 TAT-interacting protein TIP30 {Human (Homo sapiens 96.51
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 96.49
d1sc6a1188 Phosphoglycerate dehydrogenase {Escherichia coli [ 96.46
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 96.39
d2blla1 342 Polymyxin resistance protein ArnA (PrmI) {Escheric 96.37
d2py6a1 395 Methyltransferase FkbM {Methylobacillus flagellatu 96.36
d2cvoa1183 Putative semialdehyde dehydrogenase {Rice (Oryza s 96.33
d1rkxa_ 356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 96.22
d1i24a_ 393 Sulfolipid biosynthesis protein SQD1 {Thale cress 96.2
d2a35a1212 Hypothetical protein PA4017 {Pseudomonas aeruginos 96.17
d1xgka_ 350 Negative transcriptional regulator NmrA {Aspergill 96.16
d1dssg1169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 96.06
d2naca1188 Formate dehydrogenase {Pseudomonas sp., strain 101 95.97
d2b4ro1166 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 95.88
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 95.84
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 95.84
d1vkna1176 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 95.79
d2i76a2153 Hypothetical protein TM1727 {Thermotoga maritima [ 95.78
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 95.71
d1gdha1191 D-glycerate dehydrogenase {Hyphomicrobium methylov 95.69
d2g82a1168 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 95.65
d1vl8a_ 251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 95.63
d1ygya1184 Phosphoglycerate dehydrogenase {Mycobacterium tube 95.58
d1gz6a_ 302 (3R)-hydroxyacyl-CoA dehydrogenase domain of estra 95.53
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 95.4
d1kewa_ 361 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 95.32
d1gado1166 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 95.31
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 95.29
d1ebfa1168 Homoserine dehydrogenase {Baker's yeast (Saccharom 95.23
d1xg5a_ 257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 95.23
d1h5qa_ 260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 95.2
d1z45a2 347 Uridine diphosphogalactose-4-epimerase (UDP-galact 95.18
d1k3ta1190 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 95.12
d1obfo1173 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 95.1
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 95.09
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 95.07
d1ulsa_ 242 beta-keto acyl carrier protein reductase {Thermus 95.06
d1t2aa_ 347 GDP-mannose 4,6-dehydratase {Human (Homo sapiens) 95.0
d1y1pa1 342 Aldehyde reductase II {Sporobolomyces salmonicolor 94.98
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 94.92
d1uzma1 237 beta-keto acyl carrier protein reductase {Mycobact 94.89
d1bgva1255 Glutamate dehydrogenase {Clostridium symbiosum [Ta 94.78
d1rpna_ 321 GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos 94.76
d2q46a1252 Hypothetical protein At5g02240 (T7H20_290) {Thale 94.7
d1db3a_ 357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 94.58
d2a4ka1 241 beta-keto acyl carrier protein reductase {Thermus 94.57
d1geea_ 261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 94.56
d1u8fo1169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 94.56
d1r6da_ 322 dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces 94.55
d1ae1a_ 258 Tropinone reductase {Jimsonweed (Datura stramonium 94.54
d1sb8a_ 341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 94.53
d2b69a1 312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 94.52
d1k2wa_ 256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 94.29
d1ek6a_ 346 Uridine diphosphogalactose-4-epimerase (UDP-galact 94.21
d1n7ha_ 339 GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop 94.19
d1g0oa_ 272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 94.17
d2ew8a1 247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 94.15
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 94.15
d1rm4a1172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 94.14
d1nffa_ 244 Putative oxidoreductase Rv2002 {Mycobacterium tube 93.99
d2d1ya1 248 Hypothetical protein TTHA0369 {Thermus thermophilu 93.93
d1hdgo1169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 93.89
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 93.84
d2c07a1 251 beta-keto acyl carrier protein reductase {Malaria 93.73
d3cmco1171 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 93.71
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 93.7
d1gy8a_ 383 Uridine diphosphogalactose-4-epimerase (UDP-galact 93.66
d1xq1a_ 259 Tropinone reductase {Thale cress (Arabidopsis thal 93.54
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 93.45
d1q0qa2151 1-deoxy-D-xylulose-5-phosphate reductoisomerase {E 93.45
d1q7ba_ 243 beta-keto acyl carrier protein reductase {Escheric 93.35
d1xkqa_ 272 Hypothetical protein R05D8.7 {Caenorhabditis elega 93.28
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 93.21
d1hxha_ 253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 93.12
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 93.08
d1yxma1 297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 93.05
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 93.03
d1zema1 260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 93.01
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 92.92
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 92.76
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 92.64
d1oc2a_ 346 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 92.56
d2bgka1 268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 92.54
d1fmca_ 255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 92.53
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 92.5
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 92.28
d1gega_ 255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 92.28
d2rhca1 257 beta-keto acyl carrier protein reductase {Streptom 92.19
d1r0ka2150 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Z 92.12
d1dhra_ 236 Dihydropteridin reductase (pteridine reductase) {R 92.06
d1hdca_ 254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 91.99
d1w6ua_ 294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 91.99
d1dlja2196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 91.94
d1zk4a1 251 R-specific alcohol dehydrogenase {Lactobacillus br 91.93
d1yovb1 426 UBA3 {Human (Homo sapiens) [TaxId: 9606]} 91.93
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 91.91
d1vj1a2187 Putative zinc-binding alcohol dehydrogenase {Mouse 91.88
d2ae2a_ 259 Tropinone reductase {Jimsonweed (Datura stramonium 91.77
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 91.76
d1c1da1201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 91.69
d1spxa_ 264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 91.5
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 91.35
d2gdza1 254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 91.19
d1jtva_ 285 Human estrogenic 17beta-hydroxysteroid dehydrogena 91.13
d1pr9a_ 244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 91.02
d2blna2203 Polymyxin resistance protein ArnA, N-terminal doma 90.95
d1x1ta1 260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 90.84
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 90.8
d1iy8a_ 258 Levodione reductase {Corynebacterium aquaticum [Ta 90.78
d1edoa_ 244 beta-keto acyl carrier protein reductase {Oil seed 90.68
d1bdba_ 276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 90.64
d1gsoa2105 Glycinamide ribonucleotide synthetase (GAR-syn), N 90.58
d1gtma1239 Glutamate dehydrogenase {Archaeon Pyrococcus furio 90.51
d1v9la1242 Glutamate dehydrogenase {Pyrobaculum islandicum [T 90.45
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 90.41
d1jw9b_247 Molybdenum cofactor biosynthesis protein MoeB {Esc 90.19
d1y7ta1154 Malate dehydrogenase {Thermus thermophilus [TaxId: 90.09
d1ooea_ 235 Dihydropteridin reductase (pteridine reductase) {N 90.08
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 90.02
d1xhla_ 274 Hypothetical protein F25D1.5 {Caenorhabditis elega 90.0
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 89.92
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 89.9
d1leha1230 Leucine dehydrogenase {Bacillus sphaericus [TaxId: 89.89
d5mdha1154 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 89.89
d1o5ia_ 234 beta-keto acyl carrier protein reductase {Thermoto 89.46
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 89.33
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 89.27
d1ydea1 250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 88.75
d1id1a_153 Rck domain from putative potassium channel Kch {Es 88.73
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 88.52
d1sbya1 254 Drosophila alcohol dehydrogenase {Fly (Drosophila 88.5
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 88.4
d1yb1a_ 244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 88.37
d7reqa2168 Methylmalonyl-CoA mutase alpha subunit, C-terminal 88.25
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 88.24
d2bw0a2203 10-formyltetrahydrofolate dehydrogenase domain 1 { 88.15
d1gu7a2189 2,4-dienoyl-CoA reductase {Yeast (Candida tropical 87.96
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 87.71
d1xa0a2176 B. subtilis YhfP homologue {Bacillus stearothermop 87.36
d1cyda_ 242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 87.25
d1tt7a2167 Hypothetical protein YhfP {Bacillus subtilis [TaxI 87.25
d1ulua_ 256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 87.16
d2b0ja2242 5,10-methenyltetrahydromethanopterin hydrogenase, 86.99
d2bd0a1 240 Bacterial sepiapterin reductase {Chlorobium tepidu 86.57
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 86.5
d1j6ua189 UDP-N-acetylmuramate-alanine ligase MurC {Thermoto 86.35
d1dxya2131 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 86.01
d1o8ca277 Hypothetical protein YhdH {Escherichia coli [TaxId 86.0
d2ag5a1 245 Dehydrogenase/reductase SDR family member 6, DHRS6 85.89
d2csua3163 Acetate-CoA ligase alpha chain, AcdA, domains 2 an 85.84
d1xu9a_ 269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 85.8
d2pd4a1 274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 85.66
d1hwxa1 293 Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 85.28
d1vjta1193 Putative alpha-glucosidase TM0752 {Thermotoga mari 85.08
d1mxha_ 266 Dihydropteridin reductase (pteridine reductase) {T 84.78
d1uaya_ 241 Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t 84.76
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 84.62
d1zmta1 252 Halohydrin dehalogenase HheC {Agrobacterium tumefa 84.34
d1fjha_ 257 3-alpha-hydroxysteroid dehydrogenase {Comamonas te 84.03
d1yova1 529 Amyloid beta precursor protein-binding protein 1, 83.86
d1ja9a_ 259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 83.83
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 83.75
d1mv8a3136 GDP-mannose 6-dehydrogenase, GDP-binding domain {P 82.88
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 82.7
d2h7ma1 268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 81.94
d1yo6a1 250 Putative carbonyl reductase sniffer {Caenorhabditi 81.66
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 81.59
d7mdha1175 Malate dehydrogenase {Sorghum (Sorghum vulgare), c 81.33
d1snya_ 248 Carbonyl reductase sniffer {Fruit fly (Drosophila 80.88
d1b26a1234 Glutamate dehydrogenase {Thermotoga maritima [TaxI 80.42
d2fr1a1 259 Erythromycin synthase, eryAI, 1st ketoreductase mo 80.21
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 80.01
>d1euca1 c.2.1.8 (A:1-130) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: CoA-binding domain
domain: Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain
species: Pig (Sus scrofa) [TaxId: 9823]

Probab=100.00  E-value=1.6e-38  Score=247.14  Aligned_cols=118  Identities=69%  Similarity=1.081  Sum_probs=114.2

Q ss_pred             ccCCCCCeeeecCCceEEEEccCCCCchhhhHHHHHhCCceEEeeccCCCCCeEecCccccccHHHHHhccCCcEEEEee
Q 030169           45 SAAASHPAVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVVGGVTPKKGGTEHLGLPVFNSVAEAKAETKANASVIYV  124 (182)
Q Consensus        45 ~~~~~~~~~li~~~trViVvG~tGkmG~~v~k~~~~~g~~IV~AgVdp~~~G~~i~GvPVy~Sv~ea~~~~~~DvaVdfV  124 (182)
                      +|++|.|++++++++||+|||+||++|+.+++.|++||++|| |||+|+++|++++|+|||+|++|+.+++++|++++||
T Consensus         2 ~~~~~~~sIli~k~TrVivQGiTG~~G~~ht~~m~~YGT~iV-aGVtPgKgG~~~~giPVf~tV~eA~~~~~~daSvIfV   80 (130)
T d1euca1           2 SYTASRKHLYVDKNTKVICQGFTGKQGTFHSQQALEYGTNLV-GGTTPGKGGKTHLGLPVFNTVKEAKEQTGATASVIYV   80 (130)
T ss_dssp             CGGGGGGGGCCCTTCEEEEETTTSHHHHHHHHHHHHHTCEEE-EEECTTCTTCEETTEEEESSHHHHHHHHCCCEEEECC
T ss_pred             CccccceeEEEcCCCeEEEEcCCCcHHHHHHHHHHHhcCCeE-EeeccCCCCccccCccchhhHHHHHHhcCCcEEEEec
Confidence            356999999999999999999999999999999999999999 9999999999999999999999999999999999999


Q ss_pred             ChHHHHHHHHHHHHcCCCEEEEeCCCCCHHHHHHHHHHh
Q 030169          125 PPPFAAAAIMEAMEAELDLVVCITEGIPQHDMVINFTRV  163 (182)
Q Consensus       125 pp~av~~a~~eAie~GIk~VV~iTeG~~~eD~~~l~~~a  163 (182)
                      ||.++.|++.||+++||++|||||||+|++||.++.+.+
T Consensus        81 Pp~~a~dAi~EAi~agI~liV~ITEgIPv~Dm~~i~~~~  119 (130)
T d1euca1          81 PPPFAAAAINEAIDAEVPLVVCITEGIPQQDMVRVKHRL  119 (130)
T ss_dssp             CHHHHHHHHHHHHHTTCSEEEECCCCCCHHHHHHHHHHH
T ss_pred             CHHHHHHHHHHHHhCCCCEEEEecCCCCHHHHHHHHHHH
Confidence            999999999999999999999999999999999998654
>d1oi7a1 c.2.1.8 (A:1-121) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2nu7a1 c.2.1.8 (A:2-120) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1diha1 c.2.1.3 (A:2-130,A:241-273) Dihydrodipicolinate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2csua1 c.2.1.8 (A:1-129) Acetate-CoA ligase alpha chain, AcdA, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2d59a1 c.2.1.8 (A:4-142) Hypothetical protein PH1109 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1y81a1 c.2.1.8 (A:6-121) Hypothetical protein PF0725 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1iuka_ c.2.1.8 (A:) Hypothetical protein TT1466 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2dt5a2 c.2.1.12 (A:78-203) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d1tlta1 c.2.1.3 (A:5-127,A:268-308) Virulence factor MviM {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1zh8a1 c.2.1.3 (A:4-131,A:276-328) Hypothetical protein TM0312 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1lc0a1 c.2.1.3 (A:2-128,A:247-291) Biliverdin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1h6da1 c.2.1.3 (A:51-212,A:375-433) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d2nvwa1 c.2.1.3 (A:2-154,A:374-457) Galactose/lactose metabolism regulatory protein GAL80 {Yeast (Kluyveromyces lactis) [TaxId: 28985]} Back     information, alignment and structure
>d1xeaa1 c.2.1.3 (A:2-122,A:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1b7go1 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2hjsa1 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2czca2 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1mb4a1 c.2.1.3 (A:1-132,A:355-369) Aspartate beta-semialdehyde dehydrogenase {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t4ba1 c.2.1.3 (A:1-133,A:355-367) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1np3a2 c.2.1.6 (A:1-182) Class I ketol-acid reductoisomerase (KARI) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1cf2o1 c.2.1.3 (O:1-138,O:304-336) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1nvmb1 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydrogenase (acylating) {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d2g17a1 c.2.1.3 (A:1-153,A:309-334) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2gz1a1 c.2.1.3 (A:2-127,A:330-357) Aspartate beta-semialdehyde dehydrogenase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2g0ta1 c.37.1.10 (A:1-338) Hypothetical protein TM0796 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d1qmga2 c.2.1.6 (A:82-307) Class II ketol-acid reductoisomerase (KARI) {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d2cvza2 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1n2sa_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2py6a1 c.66.1.56 (A:14-408) Methyltransferase FkbM {Methylobacillus flagellatus [TaxId: 405]} Back     information, alignment and structure
>d2cvoa1 c.2.1.3 (A:68-218,A:384-415) Putative semialdehyde dehydrogenase {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d1dssg1 c.2.1.3 (G:1-148,G:313-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {South China Sea lobster (Palinurus versicolor) [TaxId: 150436]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d2b4ro1 c.2.1.3 (O:4-152,O:319-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vkna1 c.2.1.3 (A:1-144,A:308-339) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2i76a2 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d2g82a1 c.2.1.3 (A:1-148,A:311-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1gado1 c.2.1.3 (O:0-148,O:313-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ebfa1 c.2.1.3 (A:2-150,A:341-359) Homoserine dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k3ta1 c.2.1.3 (A:1-164,A:334-359) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1obfo1 c.2.1.3 (O:1-152,O:315-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Achromobacter xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1bgva1 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1u8fo1 c.2.1.3 (O:3-151,O:316-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Human(Homo sapiens), liver isoform [TaxId: 9606]} Back     information, alignment and structure
>d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1rm4a1 c.2.1.3 (A:1-148,A:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1hdgo1 c.2.1.3 (O:1-148,O:313-331) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d3cmco1 c.2.1.3 (O:0-148,O:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1q0qa2 c.2.1.3 (A:1-125,A:275-300) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1r0ka2 c.2.1.3 (A:3-126,A:265-290) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2blna2 c.65.1.1 (A:1-203) Polymyxin resistance protein ArnA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d1gtma1 c.2.1.7 (A:181-419) Glutamate dehydrogenase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1v9la1 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Back     information, alignment and structure
>d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d7reqa2 c.23.6.1 (A:561-728) Methylmalonyl-CoA mutase alpha subunit, C-terminal domain {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d2bw0a2 c.65.1.1 (A:1-203) 10-formyltetrahydrofolate dehydrogenase domain 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2b0ja2 c.2.1.6 (A:1-242) 5,10-methenyltetrahydromethanopterin hydrogenase, HMD {Archaeon Methanocaldococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1dxya2 c.23.12.1 (A:1-100,A:300-330) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csua3 c.23.4.1 (A:291-453) Acetate-CoA ligase alpha chain, AcdA, domains 2 and 3 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1hwxa1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1yova1 c.111.1.2 (A:6-534) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1mv8a3 c.26.3.1 (A:301-436) GDP-mannose 6-dehydrogenase, GDP-binding domain {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d7mdha1 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} Back     information, alignment and structure
>d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1b26a1 c.2.1.7 (A:179-412) Glutamate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure