Citrus Sinensis ID: 030209

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-
MSITEYNGSALVAMVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDRLFIGLSGLATDSQTLYQRLVFRHKLYQLREERDMKPETFASLVSALLYEKRFGPYFCQPVIAGLSDEDKPFICTMDSIGAKYVGSLQKILLLLELLESLFMVPVRQCSSLIWNPMSCLKLYLKLCYHLLTVTV
cccccccccEEEEEEcccEEEEEEEcccccccEEEEcccccEEEEcccEEEEEcccHHcHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccccccccccEEEEEccccccEEEEEcccccEEEEcccccEEHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHccc
cccccccccEEEEEEEccEEEEEEEccEEEccEEEEcccccEEEcEccEEEEEEEcHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccccccEEEEEEEEcccccEEEEEEccccccccccccccEEccccHHHHHHHHHccccccccccccHHHHHHHHHHHHHHccc
MSITEYNGSALVAMVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDRLFIglsglatdsqTLYQRLVFRHKLYQlreerdmkpETFASLVSALLYEkrfgpyfcqpviaglsdedkpfictmdsigAKYVGSLQKILLLLELLESLFMVPVRQCSSLIWNPMSCLKLYLKLCYHLLTVTV
MSITEYNGSALVAMVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDRLFIGLSGLATDSQTLYQRLVFRHKLYQlreerdmkpETFASLVSALLYEKRFGPYFCQPVIAGLSDEDKPFICTMDSIGAKYVGSLQKILLLLELLESLFMVPVRQCSSLIWNPMSCLKLYLKLCYHLLTVTV
MSITEYNGSALVAMVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDRLFIGLSGLATDSQTLYQRLVFRHKLYQLREERDMKPETFASLVSALLYEKRFGPYFCQPVIAGLSDEDKPFICTMDSIGAKYVGSLQKIllllelleslFMVPVRQCSSLIWNPMSclklylklcyhllTVTV
*****YNGSALVAMVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDRLFIGLSGLATDSQTLYQRLVFRHKLYQLREERDMKPETFASLVSALLYEKRFGPYFCQPVIAGLSDEDKPFICTMDSIGAKYVGSLQKILLLLELLESLFMVPVRQCSSLIWNPMSCLKLYLKLCYHLLTV**
MSITEYNGSALVAMVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDRLFIGLSGLATDSQTLYQRLVFRHKLYQLREERDMKPETFASLVSALLYEKRFGPYFCQPVIAGLSDEDKPFICTMDSIGAKYVGSLQKILLLLELLESLFMVPVRQCSSLIWNPMSCLKLYLKLCYHLLTVT*
MSITEYNGSALVAMVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDRLFIGLSGLATDSQTLYQRLVFRHKLYQLREERDMKPETFASLVSALLYEKRFGPYFCQPVIAGLSDEDKPFICTMDSIGAKYVGSLQKILLLLELLESLFMVPVRQCSSLIWNPMSCLKLYLKLCYHLLTVTV
*SITEYNGSALVAMVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDRLFIGLSGLATDSQTLYQRLVFRHKLYQLREERDMKPETFASLVSALLYEKRFGPYFCQPVIAGLSDEDKPFICTMDSIGAKYVGSLQKILLLLELLESLFMVPVRQCSSLIWNPMSCLKLYLKLCYHLLTVT*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSITEYNGSALVAMVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDRLFIGLSGLATDSQTLYQRLVFRHKLYQLREERDMKPETFASLVSALLYEKRFGPYFCQPVIAGLSDEDKPFICTMDSIGAKYVGSLQKILLLLELLESLFMVPVRQCSSLIWNPMSCLKLYLKLCYHLLTVTV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query181 2.2.26 [Sep-21-2011]
Q9XI05204 Proteasome subunit beta t yes no 0.712 0.632 0.937 6e-68
O81153204 Proteasome subunit beta t yes no 0.712 0.632 0.922 1e-66
O65084204 Proteasome subunit beta t N/A no 0.950 0.843 0.702 2e-65
Q9LST7204 Proteasome subunit beta t yes no 0.712 0.632 0.883 7e-65
Q55D66205 Proteasome subunit beta t yes no 0.707 0.624 0.612 3e-43
O73817205 Proteasome subunit beta t N/A no 0.723 0.639 0.606 3e-41
P33672205 Proteasome subunit beta t yes no 0.723 0.639 0.606 3e-41
Q9R1P1205 Proteasome subunit beta t yes no 0.723 0.639 0.606 3e-41
P49720205 Proteasome subunit beta t yes no 0.723 0.639 0.606 3e-41
P40112205 Proteasome subunit beta t yes no 0.723 0.639 0.598 5e-41
>sp|Q9XI05|PSB3A_ARATH Proteasome subunit beta type-3-A OS=Arabidopsis thaliana GN=PBC1 PE=1 SV=2 Back     alignment and function desciption
 Score =  256 bits (654), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 121/129 (93%), Positives = 125/129 (96%)

Query: 1   MSITEYNGSALVAMVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDRLFIGLSGLATDS 60
           MSI EYNGSA+VAMVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDR+FIGLSGLATD 
Sbjct: 1   MSIFEYNGSAVVAMVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDRVFIGLSGLATDV 60

Query: 61  QTLYQRLVFRHKLYQLREERDMKPETFASLVSALLYEKRFGPYFCQPVIAGLSDEDKPFI 120
           QTLYQRLVFRHKLYQLREERDMKPETFASLVSA+LYEKRFGPY CQPVIAGL D+DKPFI
Sbjct: 61  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYLCQPVIAGLGDDDKPFI 120

Query: 121 CTMDSIGAK 129
           CTMDSIGAK
Sbjct: 121 CTMDSIGAK 129
The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 4EC: .EC: 2EC: 5EC: .EC: 1
>sp|O81153|PSB3B_ARATH Proteasome subunit beta type-3-B OS=Arabidopsis thaliana GN=PBC2 PE=1 SV=1 Back     alignment and function description
>sp|O65084|PSB3_PICMA Proteasome subunit beta type-3 OS=Picea mariana GN=PBC1 PE=2 SV=1 Back     alignment and function description
>sp|Q9LST7|PSB3_ORYSJ Proteasome subunit beta type-3 OS=Oryza sativa subsp. japonica GN=PBC1 PE=2 SV=1 Back     alignment and function description
>sp|Q55D66|PSB3_DICDI Proteasome subunit beta type-3 OS=Dictyostelium discoideum GN=psmB3 PE=3 SV=1 Back     alignment and function description
>sp|O73817|PSB3_ONCMY Proteasome subunit beta type-3 OS=Oncorhynchus mykiss GN=psmb3 PE=2 SV=1 Back     alignment and function description
>sp|P33672|PSB3_BOVIN Proteasome subunit beta type-3 OS=Bos taurus GN=PSMB3 PE=1 SV=3 Back     alignment and function description
>sp|Q9R1P1|PSB3_MOUSE Proteasome subunit beta type-3 OS=Mus musculus GN=Psmb3 PE=1 SV=1 Back     alignment and function description
>sp|P49720|PSB3_HUMAN Proteasome subunit beta type-3 OS=Homo sapiens GN=PSMB3 PE=1 SV=2 Back     alignment and function description
>sp|P40112|PSB3_RAT Proteasome subunit beta type-3 OS=Rattus norvegicus GN=Psmb3 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query181
357509159204 Proteasome subunit beta type [Medicago t 0.950 0.843 0.730 4e-67
388491594206 unknown [Medicago truncatula] 0.950 0.834 0.730 4e-67
388513745204 unknown [Medicago truncatula] 0.950 0.843 0.724 8e-67
255558626204 proteasome subunit beta type, putative [ 0.712 0.632 0.945 8e-67
388521659204 unknown [Lotus japonicus] 0.712 0.632 0.937 1e-66
351723417204 uncharacterized protein LOC100306084 [Gl 0.950 0.843 0.724 2e-66
18395025204 proteasome subunit beta type-3-A [Arabid 0.712 0.632 0.937 3e-66
351721818204 uncharacterized protein LOC100499664 [Gl 0.712 0.632 0.937 4e-66
449464176204 PREDICTED: proteasome subunit beta type- 0.712 0.632 0.922 8e-66
217075224204 unknown [Medicago truncatula] 0.950 0.843 0.724 9e-66
>gi|357509159|ref|XP_003624868.1| Proteasome subunit beta type [Medicago truncatula] gi|355499883|gb|AES81086.1| Proteasome subunit beta type [Medicago truncatula] Back     alignment and taxonomy information
 Score =  259 bits (661), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 130/178 (73%), Positives = 145/178 (81%), Gaps = 6/178 (3%)

Query: 1   MSITEYNGSALVAMVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDRLFIGLSGLATDS 60
           MSI EYNGSALVAMVGKNCFAIASDRRLGVQLQTIATDFQRISKIHD+LFIGLSGLATDS
Sbjct: 1   MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDKLFIGLSGLATDS 60

Query: 61  QTLYQRLVFRHKLYQLREERDMKPETFASLVSALLYEKRFGPYFCQPVIAGLSDEDKPFI 120
           QTLYQRLVFRHKLYQLREERDMKPETFASLVS++ YEKRFGPYFCQPVIAGL D+DKPFI
Sbjct: 61  QTLYQRLVFRHKLYQLREERDMKPETFASLVSSMQYEKRFGPYFCQPVIAGLGDDDKPFI 120

Query: 121 CTMDSIGAKYVGSLQKILLLLELLESLFMVPVRQCSSLIWNPMSCLKLYLKLCYHLLT 178
           CTMD+IGAK +   +  ++     ESL+      C S+    M   +L+  +   LL+
Sbjct: 121 CTMDAIGAKELA--KDFVVAGTASESLYGA----CESMFKPDMEAEELFETISQALLS 172

Source: Medicago truncatula

Species: Medicago truncatula

Genus: Medicago

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|388491594|gb|AFK33863.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|388513745|gb|AFK44934.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|255558626|ref|XP_002520338.1| proteasome subunit beta type, putative [Ricinus communis] gi|223540557|gb|EEF42124.1| proteasome subunit beta type, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|388521659|gb|AFK48891.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|351723417|ref|NP_001237278.1| uncharacterized protein LOC100306084 [Glycine max] gi|255627485|gb|ACU14087.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|18395025|ref|NP_564149.1| proteasome subunit beta type-3-A [Arabidopsis thaliana] gi|288558823|sp|Q9XI05.2|PSB3A_ARATH RecName: Full=Proteasome subunit beta type-3-A; AltName: Full=20S proteasome beta subunit C-1; AltName: Full=Proteasome component T gi|17473525|gb|AAL38246.1| proteasome subunit [Arabidopsis thaliana] gi|21387087|gb|AAM47947.1| proteasome subunit [Arabidopsis thaliana] gi|110740894|dbj|BAE98543.1| 20S proteasome beta subunit PBC2 like protein [Arabidopsis thaliana] gi|332192025|gb|AEE30146.1| proteasome subunit beta type-3-A [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|351721818|ref|NP_001237990.1| uncharacterized protein LOC100499664 [Glycine max] gi|255625639|gb|ACU13164.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|449464176|ref|XP_004149805.1| PREDICTED: proteasome subunit beta type-3-A-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|217075224|gb|ACJ85972.1| unknown [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query181
TAIR|locus:2036972204 PBC1 "proteasome beta subunit 0.712 0.632 0.937 5.5e-61
TAIR|locus:2204675204 PBC2 "20S proteasome beta subu 0.712 0.632 0.922 8.1e-60
DICTYBASE|DDB_G0269772205 psmB3 "proteasome subunit beta 0.707 0.624 0.612 1.4e-39
UNIPROTKB|E1BYW9205 PSMB3 "Proteasome subunit beta 0.723 0.639 0.598 4.3e-38
UNIPROTKB|P33672205 PSMB3 "Proteasome subunit beta 0.723 0.639 0.606 5.5e-38
UNIPROTKB|E2QX17205 PSMB3 "Proteasome subunit beta 0.723 0.639 0.606 5.5e-38
UNIPROTKB|P49720205 PSMB3 "Proteasome subunit beta 0.723 0.639 0.606 5.5e-38
UNIPROTKB|O73817205 psmb3 "Proteasome subunit beta 0.723 0.639 0.606 5.5e-38
MGI|MGI:1347014205 Psmb3 "proteasome (prosome, ma 0.723 0.639 0.606 5.5e-38
RGD|61875205 Psmb3 "proteasome (prosome, ma 0.723 0.639 0.598 7e-38
TAIR|locus:2036972 PBC1 "proteasome beta subunit C1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 624 (224.7 bits), Expect = 5.5e-61, P = 5.5e-61
 Identities = 121/129 (93%), Positives = 125/129 (96%)

Query:     1 MSITEYNGSALVAMVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDRLFIGLSGLATDS 60
             MSI EYNGSA+VAMVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDR+FIGLSGLATD 
Sbjct:     1 MSIFEYNGSAVVAMVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDRVFIGLSGLATDV 60

Query:    61 QTLYQRLVFRHKLYQLREERDMKPETFASLVSALLYEKRFGPYFCQPVIAGLSDEDKPFI 120
             QTLYQRLVFRHKLYQLREERDMKPETFASLVSA+LYEKRFGPY CQPVIAGL D+DKPFI
Sbjct:    61 QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYLCQPVIAGLGDDDKPFI 120

Query:   121 CTMDSIGAK 129
             CTMDSIGAK
Sbjct:   121 CTMDSIGAK 129
GO:0004175 "endopeptidase activity" evidence=IEA
GO:0004298 "threonine-type endopeptidase activity" evidence=IEA
GO:0005737 "cytoplasm" evidence=ISM
GO:0005839 "proteasome core complex" evidence=IEA;TAS
GO:0008233 "peptidase activity" evidence=ISS
GO:0051603 "proteolysis involved in cellular protein catabolic process" evidence=IEA
GO:0006511 "ubiquitin-dependent protein catabolic process" evidence=TAS
GO:0005774 "vacuolar membrane" evidence=IDA
GO:0000502 "proteasome complex" evidence=IDA
GO:0005829 "cytosol" evidence=IDA
GO:0006094 "gluconeogenesis" evidence=RCA
GO:0006096 "glycolysis" evidence=RCA
GO:0006635 "fatty acid beta-oxidation" evidence=RCA
GO:0009407 "toxin catabolic process" evidence=RCA
GO:0009651 "response to salt stress" evidence=RCA
GO:0043161 "proteasomal ubiquitin-dependent protein catabolic process" evidence=RCA
GO:0043248 "proteasome assembly" evidence=RCA
GO:0046686 "response to cadmium ion" evidence=RCA
GO:0051788 "response to misfolded protein" evidence=RCA
GO:0080129 "proteasome core complex assembly" evidence=RCA
TAIR|locus:2204675 PBC2 "20S proteasome beta subunit C2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0269772 psmB3 "proteasome subunit beta type 3" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|E1BYW9 PSMB3 "Proteasome subunit beta type" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|P33672 PSMB3 "Proteasome subunit beta type-3" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2QX17 PSMB3 "Proteasome subunit beta type" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P49720 PSMB3 "Proteasome subunit beta type-3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|O73817 psmb3 "Proteasome subunit beta type-3" [Oncorhynchus mykiss (taxid:8022)] Back     alignment and assigned GO terms
MGI|MGI:1347014 Psmb3 "proteasome (prosome, macropain) subunit, beta type 3" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|61875 Psmb3 "proteasome (prosome, macropain) subunit, beta type 3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9LST7PSB3_ORYSJ3, ., 4, ., 2, 5, ., 10.88370.71270.6323yesno
P33672PSB3_BOVIN3, ., 4, ., 2, 5, ., 10.60600.72370.6390yesno
P40112PSB3_RAT3, ., 4, ., 2, 5, ., 10.59840.72370.6390yesno
Q9XI05PSB3A_ARATH3, ., 4, ., 2, 5, ., 10.93790.71270.6323yesno
O81153PSB3B_ARATH3, ., 4, ., 2, 5, ., 10.92240.71270.6323yesno
Q55D66PSB3_DICDI3, ., 4, ., 2, 5, ., 10.61240.70710.6243yesno
Q9Y7T8PSB3_SCHPO3, ., 4, ., 2, 5, ., 10.57480.70160.6225yesno
O65084PSB3_PICMA3, ., 4, ., 2, 5, ., 10.70220.95020.8431N/Ano
Q9R1P1PSB3_MOUSE3, ., 4, ., 2, 5, ., 10.60600.72370.6390yesno
P49720PSB3_HUMAN3, ., 4, ., 2, 5, ., 10.60600.72370.6390yesno
Q9XYN7PSB3_DROME3, ., 4, ., 2, 5, ., 10.54680.70160.6195yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.4.25.10.991
3rd Layer3.4.250.976

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
PBC1
PBC1 (PROTEASOME BETA SUBUNIT C1); peptidase/ threonine-type endopeptidase; 20S proteasome beta subunit PBC1 truncated protein (PBC1) ; The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity (204 aa)
(Arabidopsis thaliana)
Predicted Functional Partners:
PBG1
PBG1; peptidase/ threonine-type endopeptidase; 20S proteasome beta subunit PBG1 (PBG1) mRNA, co [...] (246 aa)
  ••••• 0.996
PBF1
PBF1; peptidase/ threonine-type endopeptidase; Encodes 20S proteasome beta subunit PBF1 (PBF1). [...] (223 aa)
  ••••••0.994
PAE1
PAE1; endopeptidase/ peptidase/ threonine-type endopeptidase; Encodes alpha5 subunit of 20s pro [...] (237 aa)
  ••••• 0.993
PBD1
PBD1 (20S PROTEASOME BETA SUBUNIT D1); peptidase/ threonine-type endopeptidase; Encodes 20S pro [...] (204 aa)
   •••• 0.990
PBD2
PBD2 (20S PROTEASOME BETA SUBUNIT 2); peptidase/ threonine-type endopeptidase; Encodes 20S prot [...] (199 aa)
   •••• 0.990
PBA1
PBA1; endopeptidase/ peptidase/ threonine-type endopeptidase; Encodes 20S proteasome subunit PB [...] (234 aa)
  ••••••0.987
AT1G79210
20S proteasome alpha subunit B, putative; 20S proteasome alpha subunit B, putative; FUNCTIONS I [...] (235 aa)
  ••••• 0.987
PBB2
PBB2; endopeptidase/ peptidase/ threonine-type endopeptidase; Encodes 20S proteasome beta subun [...] (274 aa)
  ••••••0.987
AT5G23540
26S proteasome regulatory subunit, putative; 26S proteasome regulatory subunit, putative; INVOL [...] (308 aa)
   •••• 0.985
AT1G16470
PAB1 (PROTEASOME SUBUNIT PAB1); endopeptidase/ peptidase/ threonine-type endopeptidase; Encodes [...] (235 aa)
  ••••• 0.985

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query181
cd03759195 cd03759, proteasome_beta_type_3, proteasome beta t 5e-80
cd01912189 cd01912, proteasome_beta, proteasome beta subunit 9e-43
cd01906182 cd01906, proteasome_protease_HslV, proteasome_prot 9e-33
pfam00227188 pfam00227, Proteasome, Proteasome subunit 9e-31
COG0638236 COG0638, PRE1, 20S proteasome, alpha and beta subu 1e-26
cd03757212 cd03757, proteasome_beta_type_1, proteasome beta t 7e-24
cd01901164 cd01901, Ntn_hydrolase, The Ntn hydrolases (N-term 8e-23
TIGR03634185 TIGR03634, arc_protsome_B, proteasome endopeptidas 4e-17
cd03764188 cd03764, proteasome_beta_archeal, Archeal proteaso 6e-17
cd03760197 cd03760, proteasome_beta_type_4, proteasome beta t 4e-09
cd03758193 cd03758, proteasome_beta_type_2, proteasome beta t 4e-05
cd01911209 cd01911, proteasome_alpha, proteasome alpha subuni 0.002
>gnl|CDD|239728 cd03759, proteasome_beta_type_3, proteasome beta type-3 subunit Back     alignment and domain information 
 Score =  235 bits (602), Expect = 5e-80
 Identities = 85/123 (69%), Positives = 105/123 (85%)

Query: 6   YNGSALVAMVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDRLFIGLSGLATDSQTLYQ 65
           YNG A+VAM GK+C AIASD RLGVQ QT++TDFQ++ +I DRL+IGL+GLATD QTL Q
Sbjct: 1   YNGGAVVAMAGKDCVAIASDLRLGVQQQTVSTDFQKVFRIGDRLYIGLAGLATDVQTLAQ 60

Query: 66  RLVFRHKLYQLREERDMKPETFASLVSALLYEKRFGPYFCQPVIAGLSDEDKPFICTMDS 125
           +L FR  LY+LREER++KP+TF+SL+S+LLYEKRFGPYF +PV+AGL  + KPFICTMD 
Sbjct: 61  KLRFRVNLYRLREEREIKPKTFSSLISSLLYEKRFGPYFVEPVVAGLDPDGKPFICTMDL 120

Query: 126 IGA 128
           IG 
Sbjct: 121 IGC 123

The 20S proteasome, multisubunit proteolytic complex, is the central enzyme of nonlysosomal protein degradation in both the cytosol and nucleus. It is composed of 28 subunits arranged as four homoheptameric rings that stack on top of one another forming an elongated alpha-beta-beta-alpha cylinder with a central cavity. The proteasome alpha and beta subunits are members of the N-terminal nucleophile (Ntn)-hydrolase superfamily. Their N-terminal threonine residues are exposed as a nucleophile in peptide bond hydrolysis. Mammals have 7 alpha and 7 beta proteasome subunits while archaea have one of each. Length = 195
>gnl|CDD|238893 cd01912, proteasome_beta, proteasome beta subunit Back     alignment and domain information
>gnl|CDD|238887 cd01906, proteasome_protease_HslV, proteasome_protease_HslV Back     alignment and domain information
>gnl|CDD|215805 pfam00227, Proteasome, Proteasome subunit Back     alignment and domain information
>gnl|CDD|223711 COG0638, PRE1, 20S proteasome, alpha and beta subunits [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|239726 cd03757, proteasome_beta_type_1, proteasome beta type-1 subunit Back     alignment and domain information
>gnl|CDD|238884 cd01901, Ntn_hydrolase, The Ntn hydrolases (N-terminal nucleophile) are a diverse superfamily of of enzymes that are activated autocatalytically via an N-terminally lcated nucleophilic amino acid Back     alignment and domain information
>gnl|CDD|234287 TIGR03634, arc_protsome_B, proteasome endopeptidase complex, archaeal, beta subunit Back     alignment and domain information
>gnl|CDD|239733 cd03764, proteasome_beta_archeal, Archeal proteasome, beta subunit Back     alignment and domain information
>gnl|CDD|239729 cd03760, proteasome_beta_type_4, proteasome beta type-4 subunit Back     alignment and domain information
>gnl|CDD|239727 cd03758, proteasome_beta_type_2, proteasome beta type-2 subunit Back     alignment and domain information
>gnl|CDD|238892 cd01911, proteasome_alpha, proteasome alpha subunit Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 181
cd03757212 proteasome_beta_type_1 proteasome beta type-1 subu 100.0
cd03759195 proteasome_beta_type_3 proteasome beta type-3 subu 100.0
cd03760197 proteasome_beta_type_4 proteasome beta type-4 subu 100.0
cd03761188 proteasome_beta_type_5 proteasome beta type-5 subu 100.0
TIGR03634185 arc_protsome_B proteasome endopeptidase complex, a 100.0
cd03758193 proteasome_beta_type_2 proteasome beta type-2 subu 100.0
COG0638236 PRE1 20S proteasome, alpha and beta subunits [Post 100.0
cd03764188 proteasome_beta_archeal Archeal proteasome, beta s 100.0
TIGR03690219 20S_bact_beta proteasome, beta subunit, bacterial 100.0
cd03755207 proteasome_alpha_type_7 proteasome_alpha_type_7. T 100.0
cd03762188 proteasome_beta_type_6 proteasome beta type-6 subu 100.0
PTZ00488247 Proteasome subunit beta type-5; Provisional 100.0
cd03751212 proteasome_alpha_type_3 proteasome_alpha_type_3. T 100.0
cd03752213 proteasome_alpha_type_4 proteasome_alpha_type_4. T 100.0
cd03750227 proteasome_alpha_type_2 proteasome_alpha_type_2. T 100.0
cd01912189 proteasome_beta proteasome beta subunit. The 20S p 100.0
cd03763189 proteasome_beta_type_7 proteasome beta type-7 subu 100.0
cd03754215 proteasome_alpha_type_6 proteasome_alpha_type_6. T 100.0
cd03749211 proteasome_alpha_type_1 proteasome_alpha_type_1. T 100.0
cd01911209 proteasome_alpha proteasome alpha subunit. The 20S 100.0
cd03756211 proteasome_alpha_archeal proteasome_alpha_archeal. 100.0
PTZ00246253 proteasome subunit alpha; Provisional 100.0
cd01906182 proteasome_protease_HslV proteasome_protease_HslV. 100.0
TIGR03633224 arc_protsome_A proteasome endopeptidase complex, a 100.0
PF00227190 Proteasome: Proteasome subunit; InterPro: IPR00135 100.0
cd03753213 proteasome_alpha_type_5 proteasome_alpha_type_5. T 100.0
PRK03996241 proteasome subunit alpha; Provisional 100.0
cd03765236 proteasome_beta_bacterial Bacterial proteasome, be 100.0
KOG0179235 consensus 20S proteasome, regulatory subunit beta 100.0
KOG0177200 consensus 20S proteasome, regulatory subunit beta 100.0
TIGR03691228 20S_bact_alpha proteasome, alpha subunit, bacteria 100.0
KOG0176241 consensus 20S proteasome, regulatory subunit alpha 100.0
KOG0185256 consensus 20S proteasome, regulatory subunit beta 100.0
KOG0178249 consensus 20S proteasome, regulatory subunit alpha 99.98
KOG0182246 consensus 20S proteasome, regulatory subunit alpha 99.97
KOG0181233 consensus 20S proteasome, regulatory subunit alpha 99.97
KOG0175285 consensus 20S proteasome, regulatory subunit beta 99.97
KOG0174224 consensus 20S proteasome, regulatory subunit beta 99.97
KOG0184254 consensus 20S proteasome, regulatory subunit alpha 99.97
KOG0180204 consensus 20S proteasome, regulatory subunit beta 99.97
PRK05456172 ATP-dependent protease subunit HslV; Provisional 99.97
KOG0183249 consensus 20S proteasome, regulatory subunit alpha 99.97
cd01913171 protease_HslV Protease HslV and the ATPase/chapero 99.97
cd01901164 Ntn_hydrolase The Ntn hydrolases (N-terminal nucle 99.96
TIGR03692171 ATP_dep_HslV ATP-dependent protease HslVU, peptida 99.96
KOG0173271 consensus 20S proteasome, regulatory subunit beta 99.96
KOG0863264 consensus 20S proteasome, regulatory subunit alpha 99.93
COG5405178 HslV ATP-dependent protease HslVU (ClpYQ), peptida 99.11
COG3484255 Predicted proteasome-type protease [Posttranslatio 98.08
>cd03757 proteasome_beta_type_1 proteasome beta type-1 subunit Back     alignment and domain information 
Probab=100.00  E-value=3.9e-43  Score=281.85  Aligned_cols=170  Identities=28%  Similarity=0.465  Sum_probs=154.9

Q ss_pred             CcccccCceEEEEEeCCEEEEeEeCCcccCceeecCCcCceEEecCcEEEEEcCChhHHHHHHHHHHHHHHHhhhhhCCC
Q 030209            2 SITEYNGSALVAMVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDRLFIGLSGLATDSQTLYQRLVFRHKLYQLREERD   81 (181)
Q Consensus         2 ~~~~~~g~TvIgi~~~dgVvla~d~~~s~g~~i~~~~~~Ki~~I~~~i~~~~sG~~aD~~~l~~~~~~~~~~~~~~~~~~   81 (181)
                      |||.++|+|+|||+++||||||+|++.+++.++.+++.+|||+|+++++++++|..||++.+.+++|.+++.|++++|.+
T Consensus         2 ~~~~~~G~Tvigik~~dgVvlaaD~r~~~~~~~~~~~~~KI~~I~~~i~~~~sG~~aD~~~l~~~~r~~~~~~~~~~g~~   81 (212)
T cd03757           2 SPYTDNGGTVLAIAGNDFAVIAGDTRLSEGYSILSRDSPKIFKLTDKCVLGSSGFQADILALTKRLKARIKMYKYSHNKE   81 (212)
T ss_pred             CCccCCCccEEEEEcCCEEEEEECCccccCCEeEeCCCCeEEEcCCCEEEEccchHHHHHHHHHHHHHHHHHHhHHhCCC
Confidence            79999999999999999999999999999988888999999999999999999999999999999999999999999999


Q ss_pred             CCHHHHHHHHHHHHHhccCCccceEEEEEEEcCCCCcEEEEECCCCceeecCcc----chhhHHHHHHhhCC--------
Q 030209           82 MKPETFASLVSALLYEKRFGPYFCQPVIAGLSDEDKPFICTMDSIGAKYVGSLQ----KILLLLELLESLFM--------  149 (181)
Q Consensus        82 i~~~~la~~is~~ly~~r~rP~~vs~ii~G~D~~~~p~Ly~iD~~G~~~~~~~~----g~~~~~~~Le~~~~--------  149 (181)
                      |+++.+|+++++++|++|.+||+|++||||||++++|+||++||+|++.+++++    |+.+++++||+.|+        
T Consensus        82 i~~~~la~~ls~~ly~~R~~P~~~~~iiaG~D~~~~p~Ly~~D~~G~~~~~~~~a~G~g~~~~~~~Le~~~~~~~~~~~~  161 (212)
T cd03757          82 MSTEAIAQLLSTILYSRRFFPYYVFNILAGIDEEGKGVVYSYDPVGSYERETYSAGGSASSLIQPLLDNQVGRKNQNNVE  161 (212)
T ss_pred             CCHHHHHHHHHHHHHhhcCCCeEEEEEEEEEcCCCCEEEEEEcCccCeeecCEEEEeecHHHHHHHHHHHHHhhccCcCC
Confidence            999999999999999988889999999999998778999999999999999987    89999999999874        


Q ss_pred             -CChhh--hhHHHhhhHHHHH-HHHHHhh
Q 030209          150 -VPVRQ--CSSLIWNPMSCLK-LYLKLCY  174 (181)
Q Consensus       150 -~~l~~--~~~l~~~~~~~~~-~~~~~~~  174 (181)
                       ++|++  |.+++.   +|++ ...|+|.
T Consensus       162 ~~~ms~eea~~l~~---~~l~~~~~rd~~  187 (212)
T cd03757         162 RTPLSLEEAVSLVK---DAFTSAAERDIY  187 (212)
T ss_pred             CCCCCHHHHHHHHH---HHHHHHHHhCcc
Confidence             66775  455555   5555 3334554

The 20S proteasome, multisubunit proteolytic complex, is the central enzyme of nonlysosomal protein degradation in both the cytosol and nucleus. It is composed of 28 subunits arranged as four homoheptameric rings that stack on top of one another forming an elongated alpha-beta-beta-alpha cylinder with a central cavity. The proteasome alpha and beta subunits are members of the N-terminal nucleophile (Ntn)-hydrolase superfamily. Their N-terminal threonine residues are exposed as a nucleophile in peptide bond hydrolysis. Mammals have 7 alpha and 7 beta proteasome subunits while archaea have one of each.
>cd03759 proteasome_beta_type_3 proteasome beta type-3 subunit Back     alignment and domain information
>cd03760 proteasome_beta_type_4 proteasome beta type-4 subunit Back     alignment and domain information
>cd03761 proteasome_beta_type_5 proteasome beta type-5 subunit Back     alignment and domain information
>TIGR03634 arc_protsome_B proteasome endopeptidase complex, archaeal, beta subunit Back     alignment and domain information
>cd03758 proteasome_beta_type_2 proteasome beta type-2 subunit Back     alignment and domain information
>COG0638 PRE1 20S proteasome, alpha and beta subunits [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03764 proteasome_beta_archeal Archeal proteasome, beta subunit Back     alignment and domain information
>TIGR03690 20S_bact_beta proteasome, beta subunit, bacterial type Back     alignment and domain information
>cd03755 proteasome_alpha_type_7 proteasome_alpha_type_7 Back     alignment and domain information
>cd03762 proteasome_beta_type_6 proteasome beta type-6 subunit Back     alignment and domain information
>PTZ00488 Proteasome subunit beta type-5; Provisional Back     alignment and domain information
>cd03751 proteasome_alpha_type_3 proteasome_alpha_type_3 Back     alignment and domain information
>cd03752 proteasome_alpha_type_4 proteasome_alpha_type_4 Back     alignment and domain information
>cd03750 proteasome_alpha_type_2 proteasome_alpha_type_2 Back     alignment and domain information
>cd01912 proteasome_beta proteasome beta subunit Back     alignment and domain information
>cd03763 proteasome_beta_type_7 proteasome beta type-7 subunit Back     alignment and domain information
>cd03754 proteasome_alpha_type_6 proteasome_alpha_type_6 Back     alignment and domain information
>cd03749 proteasome_alpha_type_1 proteasome_alpha_type_1 Back     alignment and domain information
>cd01911 proteasome_alpha proteasome alpha subunit Back     alignment and domain information
>cd03756 proteasome_alpha_archeal proteasome_alpha_archeal Back     alignment and domain information
>PTZ00246 proteasome subunit alpha; Provisional Back     alignment and domain information
>cd01906 proteasome_protease_HslV proteasome_protease_HslV Back     alignment and domain information
>TIGR03633 arc_protsome_A proteasome endopeptidase complex, archaeal, alpha subunit Back     alignment and domain information
>PF00227 Proteasome: Proteasome subunit; InterPro: IPR001353 ATP-dependent protease complexes are present in all three kingdoms of life, where they rid the cell of misfolded or damaged proteins and control the level of certain regulatory proteins Back     alignment and domain information
>cd03753 proteasome_alpha_type_5 proteasome_alpha_type_5 Back     alignment and domain information
>PRK03996 proteasome subunit alpha; Provisional Back     alignment and domain information
>cd03765 proteasome_beta_bacterial Bacterial proteasome, beta subunit Back     alignment and domain information
>KOG0179 consensus 20S proteasome, regulatory subunit beta type PSMB1/PRE7 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0177 consensus 20S proteasome, regulatory subunit beta type PSMB2/PRE1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03691 20S_bact_alpha proteasome, alpha subunit, bacterial type Back     alignment and domain information
>KOG0176 consensus 20S proteasome, regulatory subunit alpha type PSMA5/PUP2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0185 consensus 20S proteasome, regulatory subunit beta type PSMB4/PRE4 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0178 consensus 20S proteasome, regulatory subunit alpha type PSMA4/PRE9 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0182 consensus 20S proteasome, regulatory subunit alpha type PSMA6/SCL1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0181 consensus 20S proteasome, regulatory subunit alpha type PSMA2/PRE8 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0175 consensus 20S proteasome, regulatory subunit beta type PSMB5/PSMB8/PRE2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0174 consensus 20S proteasome, regulatory subunit beta type PSMB6/PSMB9/PRE3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0184 consensus 20S proteasome, regulatory subunit alpha type PSMA3/PRE10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0180 consensus 20S proteasome, regulatory subunit beta type PSMB3/PUP3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05456 ATP-dependent protease subunit HslV; Provisional Back     alignment and domain information
>KOG0183 consensus 20S proteasome, regulatory subunit alpha type PSMA7/PRE6 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01913 protease_HslV Protease HslV and the ATPase/chaperone HslU are part of an ATP-dependent proteolytic system that is the prokaryotic homolog of the proteasome Back     alignment and domain information
>cd01901 Ntn_hydrolase The Ntn hydrolases (N-terminal nucleophile) are a diverse superfamily of of enzymes that are activated autocatalytically via an N-terminally lcated nucleophilic amino acid Back     alignment and domain information
>TIGR03692 ATP_dep_HslV ATP-dependent protease HslVU, peptidase subunit Back     alignment and domain information
>KOG0173 consensus 20S proteasome, regulatory subunit beta type PSMB7/PSMB10/PUP1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0863 consensus 20S proteasome, regulatory subunit alpha type PSMA1/PRE5 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5405 HslV ATP-dependent protease HslVU (ClpYQ), peptidase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3484 Predicted proteasome-type protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query181
3unb_I205 Mouse Constitutive 20s Proteasome In Complex With P 3e-42
1iru_J205 Crystal Structure Of The Mammalian 20s Proteasome A 4e-42
1g0u_I205 A Gated Channel Into The Proteasome Core Particle L 6e-29
1ryp_J204 Crystal Structure Of The 20s Proteasome From Yeast 7e-29
1iru_M213 Crystal Structure Of The Mammalian 20s Proteasome A 3e-14
3unb_L213 Mouse Constitutive 20s Proteasome In Complex With P 4e-14
1j2q_H202 20s Proteasome In Complex With Calpain-inhibitor I 2e-08
3h4p_a219 Proteasome 20s Core Particle From Methanocaldococcu 3e-08
1g0u_L241 A Gated Channel Into The Proteasome Core Particle L 3e-08
1ryp_M222 Crystal Structure Of The 20s Proteasome From Yeast 3e-08
1ya7_H217 Implications For Interactions Of Proteasome With Pa 8e-08
1pma_B211 Proteasome From Thermoplasma Acidophilum Length = 2 8e-08
3c91_H203 Thermoplasma Acidophilum 20s Proteasome With An Ope 6e-07
1fnt_D254 Crystal Structure Of The 20s Proteasome From Yeast 3e-05
1ryp_D241 Crystal Structure Of The 20s Proteasome From Yeast 4e-05
1g0u_C243 A Gated Channel Into The Proteasome Core Particle L 4e-05
1vsy_D227 Proteasome Activator Complex Length = 227 5e-05
>pdb|3UNB|I Chain I, Mouse Constitutive 20s Proteasome In Complex With Pr-957 Length = 205 Back     alignment and structure 
Iteration: 1

 Score =  167 bits (423), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 80/132 (60%), Positives = 100/132 (75%), Gaps = 1/132 (0%)
Query: 1   MSITEYNGSALVAMVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDRLFIGLSGLATDS 60
           MSI  YNG A++AM GKNC AIA+DRR G+Q Q + TDFQ+I  + DRL+IGL+GLATD 
Sbjct: 1   MSIMSYNGGAVMAMKGKNCVAIAADRRFGIQAQMVTTDFQKIFPMGDRLYIGLAGLATDV 60
Query: 61  QTLYQRLVFRHKLYQLREERDMKPETFASLVSALLYEKRFGPYFCQPVIAGLSDED-KPF 119
           QT+ QRL FR  LY+L+E R +KP T  S+V+ LLYEKRFGPY+ +PVIAGL  +  KPF
Sbjct: 61  QTVAQRLKFRLNLYELKEGRQIKPYTLMSMVANLLYEKRFGPYYTEPVIAGLDPKTFKPF 120
Query: 120 ICTMDSIGAKYV 131
           IC++D IG   V
Sbjct: 121 ICSLDLIGCPMV 132
>pdb|1IRU|J Chain J, Crystal Structure Of The Mammalian 20s Proteasome At 2.75 A Resolution Length = 205 Back     alignment and structure
>pdb|1G0U|I Chain I, A Gated Channel Into The Proteasome Core Particle Length = 205 Back     alignment and structure
>pdb|1RYP|J Chain J, Crystal Structure Of The 20s Proteasome From Yeast At 2.4 Angstroms Resolution Length = 204 Back     alignment and structure
>pdb|1IRU|M Chain M, Crystal Structure Of The Mammalian 20s Proteasome At 2.75 A Resolution Length = 213 Back     alignment and structure
>pdb|3UNB|L Chain L, Mouse Constitutive 20s Proteasome In Complex With Pr-957 Length = 213 Back     alignment and structure
>pdb|1J2Q|H Chain H, 20s Proteasome In Complex With Calpain-inhibitor I From Archaeoglobus Fulgidus Length = 202 Back     alignment and structure
>pdb|3H4P|AA Chain a, Proteasome 20s Core Particle From Methanocaldococcus Jannaschii Length = 219 Back     alignment and structure
>pdb|1G0U|L Chain L, A Gated Channel Into The Proteasome Core Particle Length = 241 Back     alignment and structure
>pdb|1RYP|M Chain M, Crystal Structure Of The 20s Proteasome From Yeast At 2.4 Angstroms Resolution Length = 222 Back     alignment and structure
>pdb|1YA7|H Chain H, Implications For Interactions Of Proteasome With Pan And Pa700 From The 1.9 A Structure Of A Proteasome-11s Activator Complex Length = 217 Back     alignment and structure
>pdb|1PMA|B Chain B, Proteasome From Thermoplasma Acidophilum Length = 211 Back     alignment and structure
>pdb|3C91|H Chain H, Thermoplasma Acidophilum 20s Proteasome With An Open Gate Length = 203 Back     alignment and structure
>pdb|1FNT|D Chain D, Crystal Structure Of The 20s Proteasome From Yeast In Complex With The Proteasome Activator Pa26 From Trypanosome Brucei At 3.2 Angstroms Resolution Length = 254 Back     alignment and structure
>pdb|1RYP|D Chain D, Crystal Structure Of The 20s Proteasome From Yeast At 2.4 Angstroms Resolution Length = 241 Back     alignment and structure
>pdb|1G0U|C Chain C, A Gated Channel Into The Proteasome Core Particle Length = 243 Back     alignment and structure
>pdb|1VSY|D Chain D, Proteasome Activator Complex Length = 227 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query181
1iru_J205 20S proteasome; cell cycle, immune response, prote 2e-52
1iru_M213 20S proteasome; cell cycle, immune response, prote 1e-48
1ryp_J204 20S proteasome; multicatalytic proteinase, protein 2e-45
1ryp_M222 20S proteasome; multicatalytic proteinase, protein 2e-43
1j2q_H202 Proteasome beta subunit; ubiquitin, CP, hydrolase; 1e-39
3h4p_A264 Proteasome subunit alpha; core particle, cytoplasm 2e-39
1g0u_M266 Proteasome component PRE4; ubiquitin, degradation, 6e-39
1ryp_N233 20S proteasome; multicatalytic proteinase, protein 9e-36
3unf_N199 Proteasome subunit beta type-9; antigen presentati 1e-35
1iru_K201 20S proteasome; cell cycle, immune response, prote 8e-34
1ryp_K198 20S proteasome; multicatalytic proteinase, protein 6e-33
3nzj_K287 Proteasome component PRE2; ubiquitin, protein degr 1e-32
1ryp_L212 20S proteasome; multicatalytic proteinase, protein 2e-32
1iru_H205 20S proteasome; cell cycle, immune response, prote 3e-27
1ryp_H205 20S proteasome; multicatalytic proteinase, protein 3e-25
1iru_L204 20S proteasome; cell cycle, immune response, prote 9e-22
1iru_N219 20S proteasome; cell cycle, immune response, prote 2e-18
1yar_H217 Proteasome beta subunit; proteasome 20S, PA26 prot 2e-16
1iru_I234 20S proteasome; cell cycle, immune response, prote 2e-15
3nzj_H261 Proteasome component PUP1; ubiquitin, protein degr 4e-15
2jay_A291 Proteasome; hydrolase; 1.99A {Mycobacterium tuberc 6e-15
1ryp_I222 20S proteasome; multicatalytic proteinase, protein 9e-15
1q5q_A259 Proteasome alpha-type subunit 1; proteasome assemb 3e-13
1q5r_H294 Proteasome beta-type subunit 1; proteasome assembl 3e-12
1q5q_H235 Proteasome beta-type subunit 1; proteasome assembl 2e-11
3unf_H234 Proteasome subunit beta type-10; antigen presentat 4e-10
3mi0_A248 Proteasome subunit alpha; enzyme inhibitors, lacto 7e-09
1iru_C261 20S proteasome; cell cycle, immune response, prote 1e-05
1ryp_C244 20S proteasome; multicatalytic proteinase, protein 2e-05
1iru_D248 20S proteasome; cell cycle, immune response, prote 1e-04
1iru_F263 20S proteasome; cell cycle, immune response, prote 2e-04
3nzj_F288 Proteasome component C1; ubiquitin, protein degrad 3e-04
1ryp_B250 20S proteasome; multicatalytic proteinase, protein 3e-04
1iru_B233 20S proteasome; cell cycle, immune response, prote 3e-04
1ryp_G244 20S proteasome; multicatalytic proteinase, protein 3e-04
1iru_G254 20S proteasome; cell cycle, immune response, prote 3e-04
1ryp_E242 20S proteasome; multicatalytic proteinase, protein 5e-04
1yar_A233 Proteasome alpha subunit; proteasome 20S, PA26 pro 8e-04
>1iru_J 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_I* 3une_I 3unf_I* 3unh_I Length = 205 Back     alignment and structure
 Score =  165 bits (421), Expect = 2e-52
 Identities = 80/133 (60%), Positives = 99/133 (74%), Gaps = 1/133 (0%)

Query: 1   MSITEYNGSALVAMVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDRLFIGLSGLATDS 60
           MSI  YNG A++AM GKNC AIA+DRR G+Q Q + TDFQ+I  + DRL+IGL+GLATD 
Sbjct: 1   MSIMSYNGGAVMAMKGKNCVAIAADRRFGIQAQLVTTDFQKIFPMGDRLYIGLAGLATDV 60

Query: 61  QTLYQRLVFRHKLYQLREERDMKPETFASLVSALLYEKRFGPYFCQPVIAGL-SDEDKPF 119
           QT+ QRL FR  LY+L+E R +KP T  S+V+ LLYEKRFGPY+ +PVIAGL     KPF
Sbjct: 61  QTVAQRLKFRLNLYELKEGRQIKPYTLMSMVANLLYEKRFGPYYTEPVIAGLDPKTFKPF 120

Query: 120 ICTMDSIGAKYVG 132
           IC++D IG   V 
Sbjct: 121 ICSLDLIGCPMVT 133
>1iru_M 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_L* 3une_L 3unf_L* 3unh_L Length = 213 Back     alignment and structure
>1ryp_J 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_I* 1g65_I 1vsy_J 2f16_I* 2fak_I* 2fny_I* 2gpl_I* 3d29_I* 3dy3_I* 3dy4_I* 3e47_I* 3gpj_I* 3gpt_I* 3gpw_I* 3hye_I* 3l5q_N 3mg0_I* 3mg4_I* 3oeu_I* 3oev_I* ... Length = 204 Back     alignment and structure
>1ryp_M 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_M* 1jd2_L* 1g65_L 1vsy_M 1z7q_M 2f16_L* 2fak_L* 2fny_L* 2gpl_L* 3d29_L* 3dy3_L* 3dy4_L* 3e47_L* 3gpj_L* 3gpt_L* 3gpw_L* 3hye_L* 3l5q_Q 3mg0_L* 3mg4_L* ... Length = 222 Back     alignment and structure
>1j2q_H Proteasome beta subunit; ubiquitin, CP, hydrolase; HET: CIB; 2.83A {Archaeoglobus fulgidus} SCOP: d.153.1.4 Length = 202 Back     alignment and structure
>3h4p_A Proteasome subunit alpha; core particle, cytoplasm, hydrolase, protease, threonine protease; 4.10A {Methanocaldococcus jannaschii} Length = 264 Back     alignment and structure
>1g0u_M Proteasome component PRE4; ubiquitin, degradation, protease, NTN-hydrolase; 2.40A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 2zcy_M* 3bdm_M* 3mg6_M* 3mg7_M* 3mg8_M* 3nzj_M* 3nzw_M* 3nzx_M* Length = 266 Back     alignment and structure
>1ryp_N 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_N* 1jd2_M* 1g65_M 1vsy_N 1z7q_N 2f16_M* 2fak_M* 2fny_M* 2gpl_M* 3d29_M* 3dy3_M* 3dy4_M* 3e47_M* 3gpj_M* 3gpt_M* 3gpw_M* 3hye_M* 3l5q_R 3mg0_M* 3mg4_M* ... Length = 233 Back     alignment and structure
>3unf_N Proteasome subunit beta type-9; antigen presentation, drug development, protein degradation, hydrolase-hydrolase inhibitor complex; HET: 04C; 2.90A {Mus musculus} PDB: 3unh_N Length = 199 Back     alignment and structure
>1iru_K 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_J* 3une_J 3unf_J* 3unh_J Length = 201 Back     alignment and structure
>1ryp_K 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_K 1g0u_J* 1jd2_J* 1g65_J 1vsy_K 1z7q_K 2f16_J* 2fak_J* 2fny_J* 2gpl_J* 2zcy_J* 3bdm_J* 3d29_J* 3dy3_J* 3dy4_J* 3e47_J* 3gpj_J* 3gpt_J* 3gpw_J* 3hye_J* ... Length = 198 Back     alignment and structure
>3nzj_K Proteasome component PRE2; ubiquitin, protein degradation, N-terminal nucleophilic HYDR 19S regulatory particle; HET: TY5 TRO MES; 2.40A {Saccharomyces cerevisiae} PDB: 3nzw_K* 3nzx_K* Length = 287 Back     alignment and structure
>1ryp_L 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_L 1vsy_L 1z7q_L 3l5q_P 1g65_K* 1g0u_K* 1jd2_K* 2f16_K* 2fak_K* 2fny_K* 2gpl_K* 2zcy_K* 3bdm_K* 3d29_K* 3dy3_K* 3dy4_K* 3e47_K* 3gpj_K* 3gpt_K* 3gpw_K* ... Length = 212 Back     alignment and structure
>1iru_H 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_N* 3une_N Length = 205 Back     alignment and structure
>1ryp_H 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 3nzj_N* 3nzw_N* 3nzx_N* 1vsy_H 3l5q_B 1g65_N* 1fnt_H 1g0u_N* 1jd2_N* 1z7q_H 2f16_N* 2fak_N* 2fny_N* 2gpl_N* 2zcy_N* 3bdm_N* 3d29_N* 3dy3_N* 3dy4_N* 3e47_N* ... Length = 205 Back     alignment and structure
>1iru_L 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_K* 3une_K 3unf_K* 3unh_K Length = 204 Back     alignment and structure
>1iru_N 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_M* 3une_M 3unf_M* 3unh_M Length = 219 Back     alignment and structure
>1yar_H Proteasome beta subunit; proteasome 20S, PA26 proteasome activator 11S, hydrolase-HYD activator complex; 1.90A {Thermoplasma acidophilum} SCOP: d.153.1.4 PDB: 1ya7_H 1yau_H 3ipm_H 1pma_B 3jrm_H 3c92_H 3c91_H 3jse_H 3jtl_H Length = 217 Back     alignment and structure
>1iru_I 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_H* 3une_H Length = 234 Back     alignment and structure
>3nzj_H Proteasome component PUP1; ubiquitin, protein degradation, N-terminal nucleophilic HYDR 19S regulatory particle; HET: TY5 TRO MES; 2.40A {Saccharomyces cerevisiae} PDB: 3nzw_H* 3nzx_H* Length = 261 Back     alignment and structure
>2jay_A Proteasome; hydrolase; 1.99A {Mycobacterium tuberculosis} PDB: 3mka_C 3mi0_C* 2fhg_H* 2fhh_H 3krd_C* 3mfe_G 3hfa_H* 3h6i_C 3h6f_C 3hf9_H 3mfe_H Length = 291 Back     alignment and structure
>1ryp_I 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1g0u_H* 1jd2_H* 1g65_H 1vsy_I 1z7q_I 2f16_H* 2fak_H* 2fny_H* 2gpl_H* 3d29_H* 3dy3_H* 3dy4_H* 3e47_H* 3gpj_H* 3gpt_H* 3gpw_H* 3hye_H* 3l5q_M 3mg0_H* 3mg4_H* ... Length = 222 Back     alignment and structure
>1q5q_A Proteasome alpha-type subunit 1; proteasome assembly, Pro-peptide, inter-subunit contacts, RH erythropolis, hydrolase; 2.60A {Rhodococcus erythropolis} SCOP: d.153.1.4 PDB: 2h6j_A 1q5r_A Length = 259 Back     alignment and structure
>1q5r_H Proteasome beta-type subunit 1; proteasome assembly, Pro-peptide, inter-subunit contacts, hydrolase; 3.10A {Rhodococcus erythropolis} SCOP: d.153.1.4 PDB: 2h6j_H Length = 294 Back     alignment and structure
>1q5q_H Proteasome beta-type subunit 1; proteasome assembly, Pro-peptide, inter-subunit contacts, RH erythropolis, hydrolase; 2.60A {Rhodococcus erythropolis} SCOP: d.153.1.4 Length = 235 Back     alignment and structure
>3unf_H Proteasome subunit beta type-10; antigen presentation, drug development, protein degradation, hydrolase-hydrolase inhibitor complex; HET: 04C; 2.90A {Mus musculus} PDB: 3unh_H Length = 234 Back     alignment and structure
>3mi0_A Proteasome subunit alpha; enzyme inhibitors, lactones, proteasome endopeptidase comple mycobacterium tuberculosis, hydrolase; HET: SA6; 2.20A {Mycobacterium tuberculosis} PDB: 3h6f_A 3krd_A* 3h6i_A* 3mka_A 2fhh_A* 2fhg_A 3hfa_D 3hf9_A 3mfe_D Length = 248 Back     alignment and structure
>1iru_C 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_B* 3une_B 3unf_B* 3unh_B Length = 261 Back     alignment and structure
>1ryp_C 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_B* 1g65_B 2f16_B* 2fak_B* 2fny_B* 2gpl_B* 3d29_B* 3dy3_B* 3dy4_B* 3e47_B* 3gpj_B* 3gpt_B* 3gpw_B* 3hye_B* 3mg0_B* 3mg4_B* 3okj_B* 3shj_B* 3tdd_B* 3nzj_B* ... Length = 244 Back     alignment and structure
>1iru_D 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unf_C* 3une_C* 3unh_C 3unb_C* Length = 248 Back     alignment and structure
>1iru_F 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_E* 3une_E 3unf_E* 3unh_E Length = 263 Back     alignment and structure
>3nzj_F Proteasome component C1; ubiquitin, protein degradation, N-terminal nucleophilic HYDR 19S regulatory particle; HET: TY5 TRO MES; 2.40A {Saccharomyces cerevisiae} PDB: 1z7q_G* 3nzw_F* 3nzx_F* 3un4_F* 3un8_F* 3bdm_F* 1fnt_G* 2zcy_F* Length = 288 Back     alignment and structure
>1ryp_B 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_B 1g0u_A* 1jd2_A* 1g65_A 1z7q_B 2f16_A* 2fak_A* 2fny_A* 2gpl_A* 2zcy_A* 3bdm_A* 3d29_A* 3dy3_A* 3dy4_A* 3e47_A* 3gpj_A* 3gpt_A* 3gpw_A* 3hye_A* 3mg0_A* ... Length = 250 Back     alignment and structure
>1iru_B 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_A* 3une_A 3unf_A* 3unh_A Length = 233 Back     alignment and structure
>1ryp_G 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_F* 1g65_F 1vsy_G 2f16_F* 2fak_F* 2fny_F* 2gpl_F* 3d29_F* 3dy3_F* 3dy4_F* 3e47_F* 3gpj_F* 3gpt_F* 3gpw_F* 3hye_F* 3l5q_L 3mg0_F* 3mg4_F* 3okj_F* 3shj_F* ... Length = 244 Back     alignment and structure
>1iru_G 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_F* 3une_F 3unf_F* 3unh_F Length = 254 Back     alignment and structure
>1ryp_E 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_D* 1g65_D 2f16_D* 2fak_D* 2fny_D* 2gpl_D* 3d29_D* 3dy3_D* 3dy4_D* 3e47_D* 3gpj_D* 3gpt_D* 3gpw_D* 3hye_D* 3mg0_D* 3mg4_D* 3okj_D* 3shj_D* 3tdd_D* 2z5c_C ... Length = 242 Back     alignment and structure
>1yar_A Proteasome alpha subunit; proteasome 20S, PA26 proteasome activator 11S, hydrolase-HYD activator complex; 1.90A {Thermoplasma acidophilum} SCOP: d.153.1.4 PDB: 1ya7_A 1pma_A 3c91_A 3c92_A 3ipm_A 2ku1_A 2ku2_A 1yau_A 3jrm_A 3jse_A 3jtl_A Length = 233 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query181
1iru_M213 20S proteasome; cell cycle, immune response, prote 100.0
1yar_H217 Proteasome beta subunit; proteasome 20S, PA26 prot 100.0
1ryp_M222 20S proteasome; multicatalytic proteinase, protein 100.0
1iru_J205 20S proteasome; cell cycle, immune response, prote 100.0
1ryp_J204 20S proteasome; multicatalytic proteinase, protein 100.0
3h4p_a219 Proteasome subunit beta; core particle, cytoplasm, 100.0
1j2q_H202 Proteasome beta subunit; ubiquitin, CP, hydrolase; 100.0
1ryp_A243 20S proteasome; multicatalytic proteinase, protein 100.0
1ryp_N233 20S proteasome; multicatalytic proteinase, protein 100.0
1iru_N219 20S proteasome; cell cycle, immune response, prote 100.0
1ryp_K198 20S proteasome; multicatalytic proteinase, protein 100.0
1ryp_H205 20S proteasome; multicatalytic proteinase, protein 100.0
1ryp_L212 20S proteasome; multicatalytic proteinase, protein 100.0
1iru_H205 20S proteasome; cell cycle, immune response, prote 100.0
3nzj_K287 Proteasome component PRE2; ubiquitin, protein degr 100.0
1iru_L204 20S proteasome; cell cycle, immune response, prote 100.0
1ryp_D241 20S proteasome; multicatalytic proteinase, protein 100.0
1g0u_M266 Proteasome component PRE4; ubiquitin, degradation, 100.0
1ryp_C244 20S proteasome; multicatalytic proteinase, protein 100.0
1iru_A246 20S proteasome; cell cycle, immune response, prote 100.0
1iru_K201 20S proteasome; cell cycle, immune response, prote 100.0
1yar_A233 Proteasome alpha subunit; proteasome 20S, PA26 pro 100.0
1iru_C261 20S proteasome; cell cycle, immune response, prote 100.0
1iru_D248 20S proteasome; cell cycle, immune response, prote 100.0
1iru_B233 20S proteasome; cell cycle, immune response, prote 100.0
1ryp_E242 20S proteasome; multicatalytic proteinase, protein 100.0
1iru_G254 20S proteasome; cell cycle, immune response, prote 100.0
1q5q_H235 Proteasome beta-type subunit 1; proteasome assembl 100.0
3nzj_H261 Proteasome component PUP1; ubiquitin, protein degr 100.0
1iru_E241 20S proteasome; cell cycle, immune response, prote 100.0
3unf_H234 Proteasome subunit beta type-10; antigen presentat 100.0
1ryp_I222 20S proteasome; multicatalytic proteinase, protein 100.0
1q5r_H294 Proteasome beta-type subunit 1; proteasome assembl 100.0
3h4p_A264 Proteasome subunit alpha; core particle, cytoplasm 100.0
1ryp_B250 20S proteasome; multicatalytic proteinase, protein 100.0
1j2p_A246 Alpha-ring, proteasome alpha subunit; hydrolase; 2 100.0
1ryp_G244 20S proteasome; multicatalytic proteinase, protein 100.0
3nzj_F288 Proteasome component C1; ubiquitin, protein degrad 100.0
3unf_N199 Proteasome subunit beta type-9; antigen presentati 100.0
3mi0_A248 Proteasome subunit alpha; enzyme inhibitors, lacto 100.0
2jay_A291 Proteasome; hydrolase; 1.99A {Mycobacterium tuberc 100.0
1iru_I234 20S proteasome; cell cycle, immune response, prote 100.0
1ryp_F233 20S proteasome; multicatalytic proteinase, protein 100.0
1iru_F263 20S proteasome; cell cycle, immune response, prote 100.0
1q5q_A259 Proteasome alpha-type subunit 1; proteasome assemb 100.0
1m4y_A171 ATP-dependent protease HSLV; N-terminal catalytic 100.0
2z3b_A180 ATP-dependent protease HSLV; N-terminal nucleophIl 100.0
1g3k_A174 ATP-dependent protease HSLV; hydrolase; 1.90A {Hae 100.0
>1iru_M 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_L* 3une_L 3unf_L* 3unh_L Back     alignment and structure
Probab=100.00  E-value=3.2e-42  Score=274.70  Aligned_cols=163  Identities=28%  Similarity=0.472  Sum_probs=151.4

Q ss_pred             CCcccccCceEEEEEeCCEEEEeEeCCcccCceeecCCcCceEEecCcEEEEEcCChhHHHHHHHHHHHHHHHhhhhhCC
Q 030209            1 MSITEYNGSALVAMVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDRLFIGLSGLATDSQTLYQRLVFRHKLYQLREER   80 (181)
Q Consensus         1 ~~~~~~~g~TvIgi~~~dgVvla~d~~~s~g~~i~~~~~~Ki~~I~~~i~~~~sG~~aD~~~l~~~~~~~~~~~~~~~~~   80 (181)
                      .|||.++|+|+|||+++||||||+|+|.+.|.++.+++.+|||+|+++++++++|..||++.++++++.+++.|+++++.
T Consensus         2 ~~p~v~~Gtt~vgi~~~dgVvlaaD~r~~~g~~~~~~~~~Ki~~i~~~i~~~~aG~~aD~~~l~~~~~~~~~~~~~~~~~   81 (213)
T 1iru_M            2 FSPYVFNGGTILAIAGEDFAIVASDTRLSEGFSIHTRDSPKCYKLTDKTVIGCSGFHGDCLTLTKIIEARLKMYKHSNNK   81 (213)
T ss_dssp             CCSCCCCCCEEEEEEETTEEEEEEECCEEETTEEEESCCCCEEEEETTEEEEEEECHHHHHHHHHHHHHHHHHHHHHHSS
T ss_pred             CCCccCCCCcEEEEEeCCEEEEEECCCcccCCEEecCCCCcEEEcCCCEEEEccccHHHHHHHHHHHHHHHHHHHHhcCC
Confidence            47999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCHHHHHHHHHHHHHhccCCccceEEEEEEEcCCCCcEEEEECCCCceeecCcc----chhhHHHHHHhh---------
Q 030209           81 DMKPETFASLVSALLYEKRFGPYFCQPVIAGLSDEDKPFICTMDSIGAKYVGSLQ----KILLLLELLESL---------  147 (181)
Q Consensus        81 ~i~~~~la~~is~~ly~~r~rP~~vs~ii~G~D~~~~p~Ly~iD~~G~~~~~~~~----g~~~~~~~Le~~---------  147 (181)
                      +++++.+|+++++++|++|+|||++++||||||++++|+||.+||+|++.+++++    |+.+++++||+.         
T Consensus        82 ~~~v~~la~~l~~~~y~~r~~P~~v~~lvaG~D~~g~p~Ly~id~~G~~~~~~~~aiGsg~~~a~~~Le~~~~~~~~~~~  161 (213)
T 1iru_M           82 AMTTGAIAAMLSTILYSRRFFPYYVYNIIGGLDEEGKGAVYSFDPVGSYQRDSFKAGGSASAMLQPLLDNQVGFKNMQNV  161 (213)
T ss_dssp             CCCHHHHHHHHHHHHHHTTTSCCCEEEEEEEECTTSCEEEEEECTTSCEEEESEEEEETTHHHHHHHHHHHTTCCSCSSC
T ss_pred             CCCHHHHHHHHHHHHHhhCCCCceEEEEEEEEcCCCCEEEEEECCCCCEEECCEEEEeeCHHHHHHHHhhcccccccccc
Confidence            9999999999999999988999999999999998778999999999999999887    779999999999         


Q ss_pred             CCCChhh--hhHHHhhhH
Q 030209          148 FMVPVRQ--CSSLIWNPM  163 (181)
Q Consensus       148 ~~~~l~~--~~~l~~~~~  163 (181)
                      |+++|+.  +.+++.+++
T Consensus       162 ~~~~~s~eea~~l~~~al  179 (213)
T 1iru_M          162 EHVPLSLDRAMRLVKDVF  179 (213)
T ss_dssp             CCCCCCHHHHHHHHHHHH
T ss_pred             CCCCCCHHHHHHHHHHHH
Confidence            6677764  555555443
>1yar_H Proteasome beta subunit; proteasome 20S, PA26 proteasome activator 11S, hydrolase-HYD activator complex; 1.90A {Thermoplasma acidophilum} SCOP: d.153.1.4 PDB: 1ya7_H 1yau_H 3ipm_H 1pma_B 3jrm_H 3c92_H 3c91_H 3jse_H 3jtl_H Back     alignment and structure
>1ryp_M 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_M* 1jd2_L* 1g65_L 1vsy_M 1z7q_M 2f16_L* 2fak_L* 2fny_L* 2gpl_L* 3d29_L* 3dy3_L* 3dy4_L* 3e47_L* 3gpj_L* 3gpt_L* 3gpw_L* 3hye_L* 3l5q_Q 3mg0_L* 3mg4_L* ... Back     alignment and structure
>1iru_J 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_I* 3une_I 3unf_I* 3unh_I Back     alignment and structure
>1ryp_J 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_I* 1g65_I 1vsy_J 2f16_I* 2fak_I* 2fny_I* 2gpl_I* 3d29_I* 3dy3_I* 3dy4_I* 3e47_I* 3gpj_I* 3gpt_I* 3gpw_I* 3hye_I* 3l5q_N 3mg0_I* 3mg4_I* 3oeu_I* 3oev_I* ... Back     alignment and structure
>3h4p_a Proteasome subunit beta; core particle, cytoplasm, hydrolase, protease, threonine protease; 4.10A {Methanocaldococcus jannaschii} Back     alignment and structure
>1j2q_H Proteasome beta subunit; ubiquitin, CP, hydrolase; HET: CIB; 2.83A {Archaeoglobus fulgidus} SCOP: d.153.1.4 Back     alignment and structure
>1ryp_A 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_G* 1g65_G 1vsy_A 2f16_G* 2fak_G* 2fny_G* 2gpl_G* 3d29_G* 3dy3_G* 3dy4_G* 3e47_G* 3gpj_G* 3gpt_G* 3gpw_G* 3hye_G* 3l5q_A 3mg0_G* 3mg4_G* 3oeu_G* 3oev_G* ... Back     alignment and structure
>1ryp_N 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_N* 1jd2_M* 1g65_M 1vsy_N 1z7q_N 2f16_M* 2fak_M* 2fny_M* 2gpl_M* 3d29_M* 3dy3_M* 3dy4_M* 3e47_M* 3gpj_M* 3gpt_M* 3gpw_M* 3hye_M* 3l5q_R 3mg0_M* 3mg4_M* ... Back     alignment and structure
>1iru_N 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_M* 3une_M 3unf_M* 3unh_M Back     alignment and structure
>1ryp_K 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_K 1g0u_J* 1jd2_J* 1g65_J 1vsy_K 1z7q_K 2f16_J* 2fak_J* 2fny_J* 2gpl_J* 2zcy_J* 3bdm_J* 3d29_J* 3dy3_J* 3dy4_J* 3e47_J* 3gpj_J* 3gpt_J* 3gpw_J* 3hye_J* ... Back     alignment and structure
>1ryp_H 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 3nzj_N* 3nzw_N* 3nzx_N* 1vsy_H 3l5q_B 1g65_N* 1fnt_H 1g0u_N* 1jd2_N* 1z7q_H 2f16_N* 2fak_N* 2fny_N* 2gpl_N* 2zcy_N* 3bdm_N* 3d29_N* 3dy3_N* 3dy4_N* 3e47_N* ... Back     alignment and structure
>1ryp_L 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_L 1vsy_L 1z7q_L 3l5q_P 1g65_K* 1g0u_K* 1jd2_K* 2f16_K* 2fak_K* 2fny_K* 2gpl_K* 2zcy_K* 3bdm_K* 3d29_K* 3dy3_K* 3dy4_K* 3e47_K* 3gpj_K* 3gpt_K* 3gpw_K* ... Back     alignment and structure
>1iru_H 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_N* 3une_N Back     alignment and structure
>3nzj_K Proteasome component PRE2; ubiquitin, protein degradation, N-terminal nucleophilic HYDR 19S regulatory particle; HET: TY5 TRO MES; 2.40A {Saccharomyces cerevisiae} PDB: 3nzw_K* 3nzx_K* 4b4t_5 Back     alignment and structure
>1iru_L 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_K* 3une_K 3unf_K* 3unh_K Back     alignment and structure
>1ryp_D 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_C* 1g65_C 2f16_C* 2fak_C* 2fny_C* 2gpl_C* 3d29_C* 3dy3_C* 3dy4_C* 3e47_C* 3gpj_C* 3gpt_C* 3gpw_C* 3hye_C* 3mg0_C* 3mg4_C* 3oeu_C* 3oev_C* 3okj_C* 3shj_C* ... Back     alignment and structure
>1g0u_M Proteasome component PRE4; ubiquitin, degradation, protease, NTN-hydrolase; 2.40A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 2zcy_M* 3bdm_M* 3mg6_M* 3mg7_M* 3mg8_M* 3nzj_M* 3nzw_M* 3nzx_M* Back     alignment and structure
>1ryp_C 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_B* 1g65_B 2f16_B* 2fak_B* 2fny_B* 2gpl_B* 3d29_B* 3dy3_B* 3dy4_B* 3e47_B* 3gpj_B* 3gpt_B* 3gpw_B* 3hye_B* 3mg0_B* 3mg4_B* 3okj_B* 3shj_B* 3tdd_B* 3nzj_B* ... Back     alignment and structure
>1iru_A 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_G* 3une_G 3unf_G* 3unh_G Back     alignment and structure
>1iru_K 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_J* 3une_J 3unf_J* 3unh_J Back     alignment and structure
>1yar_A Proteasome alpha subunit; proteasome 20S, PA26 proteasome activator 11S, hydrolase-HYD activator complex; 1.90A {Thermoplasma acidophilum} SCOP: d.153.1.4 PDB: 1ya7_A 1pma_A 3c91_A 3c92_A 3ipm_A 2ku1_A 2ku2_A 1yau_A 3jrm_A 3jse_A 3jtl_A Back     alignment and structure
>1iru_C 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_B* 3une_B 3unf_B* 3unh_B Back     alignment and structure
>1iru_D 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unf_C* 3une_C* 3unh_C 3unb_C* Back     alignment and structure
>1iru_B 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_A* 3une_A 3unf_A* 3unh_A Back     alignment and structure
>1ryp_E 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_D* 1g65_D 2f16_D* 2fak_D* 2fny_D* 2gpl_D* 3d29_D* 3dy3_D* 3dy4_D* 3e47_D* 3gpj_D* 3gpt_D* 3gpw_D* 3hye_D* 3mg0_D* 3mg4_D* 3okj_D* 3shj_D* 3tdd_D* 2z5c_C ... Back     alignment and structure
>1iru_G 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_F* 3une_F 3unf_F* 3unh_F Back     alignment and structure
>1q5q_H Proteasome beta-type subunit 1; proteasome assembly, Pro-peptide, inter-subunit contacts, RH erythropolis, hydrolase; 2.60A {Rhodococcus erythropolis} SCOP: d.153.1.4 Back     alignment and structure
>3nzj_H Proteasome component PUP1; ubiquitin, protein degradation, N-terminal nucleophilic HYDR 19S regulatory particle; HET: TY5 TRO MES; 2.40A {Saccharomyces cerevisiae} PDB: 3nzw_H* 3nzx_H* 4b4t_2 Back     alignment and structure
>1iru_E 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_D* 3une_D 3unf_D* 3unh_D Back     alignment and structure
>3unf_H Proteasome subunit beta type-10; antigen presentation, drug development, protein degradation, hydrolase-hydrolase inhibitor complex; HET: 04C; 2.90A {Mus musculus} PDB: 3unh_H Back     alignment and structure
>1ryp_I 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1g0u_H* 1jd2_H* 1g65_H 1vsy_I 1z7q_I 2f16_H* 2fak_H* 2fny_H* 2gpl_H* 3d29_H* 3dy3_H* 3dy4_H* 3e47_H* 3gpj_H* 3gpt_H* 3gpw_H* 3hye_H* 3l5q_M 3mg0_H* 3mg4_H* ... Back     alignment and structure
>1q5r_H Proteasome beta-type subunit 1; proteasome assembly, Pro-peptide, inter-subunit contacts, hydrolase; 3.10A {Rhodococcus erythropolis} SCOP: d.153.1.4 PDB: 2h6j_H Back     alignment and structure
>3h4p_A Proteasome subunit alpha; core particle, cytoplasm, hydrolase, protease, threonine protease; 4.10A {Methanocaldococcus jannaschii} Back     alignment and structure
>1ryp_B 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_B 1g0u_A* 1jd2_A* 1g65_A 1z7q_B 2f16_A* 2fak_A* 2fny_A* 2gpl_A* 2zcy_A* 3bdm_A* 3d29_A* 3dy3_A* 3dy4_A* 3e47_A* 3gpj_A* 3gpt_A* 3gpw_A* 3hye_A* 3mg0_A* ... Back     alignment and structure
>1j2p_A Alpha-ring, proteasome alpha subunit; hydrolase; 2.60A {Archaeoglobus fulgidus} SCOP: d.153.1.4 PDB: 1j2q_A* Back     alignment and structure
>1ryp_G 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_F* 1g65_F 1vsy_G 2f16_F* 2fak_F* 2fny_F* 2gpl_F* 3d29_F* 3dy3_F* 3dy4_F* 3e47_F* 3gpj_F* 3gpt_F* 3gpw_F* 3hye_F* 3l5q_L 3mg0_F* 3mg4_F* 3okj_F* 3shj_F* ... Back     alignment and structure
>3nzj_F Proteasome component C1; ubiquitin, protein degradation, N-terminal nucleophilic HYDR 19S regulatory particle; HET: TY5 TRO MES; 2.40A {Saccharomyces cerevisiae} PDB: 1z7q_G* 3nzw_F* 3nzx_F* 3un4_F* 3un8_F* 4b4t_G 4g4s_G* 3bdm_F* 1fnt_G* 2zcy_F* Back     alignment and structure
>3unf_N Proteasome subunit beta type-9; antigen presentation, drug development, protein degradation, hydrolase-hydrolase inhibitor complex; HET: 04C; 2.90A {Mus musculus} PDB: 3unh_N Back     alignment and structure
>3mi0_A Proteasome subunit alpha; enzyme inhibitors, lactones, proteasome endopeptidase comple mycobacterium tuberculosis, hydrolase; HET: SA6; 2.20A {Mycobacterium tuberculosis} SCOP: d.153.1.4 PDB: 3h6f_A 3krd_A* 3h6i_A* 3mka_A 2fhh_A* 2fhg_A 3hfa_D 3hf9_A 3mfe_D Back     alignment and structure
>2jay_A Proteasome; hydrolase; 1.99A {Mycobacterium tuberculosis} PDB: 3mka_C 3mi0_C* 2fhg_H* 2fhh_H 3krd_C* 3mfe_G 3hfa_H* 3h6i_C 3h6f_C 3hf9_H 3mfe_H Back     alignment and structure
>1iru_I 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_H* 3une_H Back     alignment and structure
>1ryp_F 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_E* 1g65_E 2f16_E* 2fak_E* 2fny_E* 2gpl_E* 3d29_E* 3dy3_E* 3dy4_E* 3e47_E* 3gpj_E* 3gpt_E* 3gpw_E* 3hye_E* 3mg0_E* 3mg4_E* 3oeu_E* 3oev_E* 3okj_E* 3shj_E* ... Back     alignment and structure
>1iru_F 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_E* 3une_E 3unf_E* 3unh_E Back     alignment and structure
>1q5q_A Proteasome alpha-type subunit 1; proteasome assembly, Pro-peptide, inter-subunit contacts, RH erythropolis, hydrolase; 2.60A {Rhodococcus erythropolis} SCOP: d.153.1.4 PDB: 2h6j_A 1q5r_A Back     alignment and structure
>1m4y_A ATP-dependent protease HSLV; N-terminal catalytic threonine residue, hydrolase; 2.10A {Thermotoga maritima} SCOP: d.153.1.4 Back     alignment and structure
>2z3b_A ATP-dependent protease HSLV; N-terminal nucleophIle hydrolase; 2.50A {Bacillus subtilis} SCOP: d.153.1.4 PDB: 2z3a_A 1yyf_D* 3ty6_A Back     alignment and structure
>1g3k_A ATP-dependent protease HSLV; hydrolase; 1.90A {Haemophilus influenzae} SCOP: d.153.1.4 PDB: 1g3i_G 1jjw_A 1kyi_G* 1ofh_G* 1ofi_G* 1e94_A* 1g4a_B* 1g4b_M 1hqy_A* 1ht1_C* 1ht2_A* 1ned_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 181
d1iruj_204 d.153.1.4 (J:) Proteasome beta subunit (catalytic) 7e-24
d1rypj_204 d.153.1.4 (J:) Proteasome beta subunit (catalytic) 2e-22
d1ryp1_222 d.153.1.4 (1:) Proteasome beta subunit (catalytic) 8e-22
d1iru1_213 d.153.1.4 (1:) Proteasome beta subunit (catalytic) 6e-20
d1rypk_198 d.153.1.4 (K:) Proteasome beta subunit (catalytic) 6e-19
d1rypl_212 d.153.1.4 (L:) Proteasome beta subunit (catalytic) 7e-19
d1ryp2_233 d.153.1.4 (2:) Proteasome beta subunit (catalytic) 9e-19
d1ryph_205 d.153.1.4 (H:) Proteasome beta subunit (catalytic) 7e-18
d1irul_201 d.153.1.4 (L:) Proteasome beta subunit (catalytic) 9e-18
d1yarh1203 d.153.1.4 (H:1-203) Proteasome beta subunit (catal 2e-17
d1rypc_244 d.153.1.4 (C:) Proteasome alpha subunit (non-catal 2e-17
d1iruh_202 d.153.1.4 (H:) Proteasome beta subunit (catalytic) 3e-17
d1irue_234 d.153.1.4 (E:) Proteasome alpha subunit (non-catal 1e-16
d1j2qh_202 d.153.1.4 (H:) Proteasome beta subunit (catalytic) 1e-16
d1iruc_250 d.153.1.4 (C:) Proteasome alpha subunit (non-catal 3e-16
d1irug_245 d.153.1.4 (G:) Proteasome alpha subunit (non-catal 6e-16
d1q5qa_227 d.153.1.4 (A:) Proteasome alpha subunit (non-catal 9e-16
d1irui_220 d.153.1.4 (I:) Proteasome beta subunit (catalytic) 4e-15
d1rype_242 d.153.1.4 (E:) Proteasome alpha subunit (non-catal 5e-15
d1iru2_217 d.153.1.4 (2:) Proteasome beta subunit (catalytic) 6e-15
d1yara1221 d.153.1.4 (A:13-233) Proteasome alpha subunit (non 1e-14
d1iruk_199 d.153.1.4 (K:) Proteasome beta subunit (catalytic) 2e-14
d1rypf_233 d.153.1.4 (F:) Proteasome alpha subunit (non-catal 5e-14
d1rypa_243 d.153.1.4 (A:) Proteasome alpha subunit (non-catal 6e-14
d1rypb_250 d.153.1.4 (B:) Proteasome alpha subunit (non-catal 6e-14
d1rypd_241 d.153.1.4 (D:) Proteasome alpha subunit (non-catal 9e-14
d1rypg_244 d.153.1.4 (G:) Proteasome alpha subunit (non-catal 1e-13
d1rypi_222 d.153.1.4 (I:) Proteasome beta subunit (catalytic) 1e-13
d1irud_243 d.153.1.4 (D:) Proteasome alpha subunit (non-catal 7e-13
d1irua_244 d.153.1.4 (A:) Proteasome alpha subunit (non-catal 9e-13
d1q5qh_224 d.153.1.4 (H:) Proteasome beta subunit (catalytic) 1e-12
d1j2pa_243 d.153.1.4 (A:) Proteasome alpha subunit (non-catal 2e-12
d1iruf_238 d.153.1.4 (F:) Proteasome alpha subunit (non-catal 2e-12
d1irub_233 d.153.1.4 (B:) Proteasome alpha subunit (non-catal 4e-11
d1m4ya_171 d.153.1.4 (A:) HslV (ClpQ) protease {Thermotoga ma 1e-06
d2z3ba1180 d.153.1.4 (A:1-180) HslV (ClpQ) protease {Bacillus 2e-06
d1g3ka_173 d.153.1.4 (A:) HslV (ClpQ) protease {Haemophilus i 0.003
>d1iruj_ d.153.1.4 (J:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 204 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ntn hydrolase-like
superfamily: N-terminal nucleophile aminohydrolases (Ntn hydrolases)
family: Proteasome subunits
domain: Proteasome beta subunit (catalytic)
species: Cow (Bos taurus) [TaxId: 9913]

 Score = 91.1 bits (225), Expect = 7e-24
 Identities = 76/130 (58%), Positives = 96/130 (73%), Gaps = 1/130 (0%)

Query: 2   SITEYNGSALVAMVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDRLFIGLSGLATDSQ 61
           SI  YNG A++AM GKNC AIA+DRR G+Q Q + TDFQ+I  + DRL+IGL+GLATD Q
Sbjct: 1   SIMSYNGGAVMAMKGKNCVAIAADRRFGIQAQLVTTDFQKIFPMGDRLYIGLAGLATDVQ 60

Query: 62  TLYQRLVFRHKLYQLREERDMKPETFASLVSALLYEKRFGPYFCQPVIAGLSDEDKP-FI 120
           T+ QRL FR  LY+L+E R +KP T  S+V+ LLYEKRFGPY+ +PVIAGL  +    FI
Sbjct: 61  TVAQRLKFRLNLYELKEGRQIKPYTLMSMVANLLYEKRFGPYYTEPVIAGLDPKTFKPFI 120

Query: 121 CTMDSIGAKY 130
           C++D IG   
Sbjct: 121 CSLDLIGCPM 130
>d1rypj_ d.153.1.4 (J:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 204 Back     information, alignment and structure
>d1ryp1_ d.153.1.4 (1:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 222 Back     information, alignment and structure
>d1iru1_ d.153.1.4 (1:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 213 Back     information, alignment and structure
>d1rypk_ d.153.1.4 (K:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 198 Back     information, alignment and structure
>d1rypl_ d.153.1.4 (L:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 212 Back     information, alignment and structure
>d1ryp2_ d.153.1.4 (2:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 233 Back     information, alignment and structure
>d1ryph_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 205 Back     information, alignment and structure
>d1irul_ d.153.1.4 (L:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 201 Back     information, alignment and structure
>d1yarh1 d.153.1.4 (H:1-203) Proteasome beta subunit (catalytic) {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 203 Back     information, alignment and structure
>d1rypc_ d.153.1.4 (C:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 244 Back     information, alignment and structure
>d1iruh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 202 Back     information, alignment and structure
>d1irue_ d.153.1.4 (E:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 234 Back     information, alignment and structure
>d1j2qh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 202 Back     information, alignment and structure
>d1iruc_ d.153.1.4 (C:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 250 Back     information, alignment and structure
>d1irug_ d.153.1.4 (G:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 245 Back     information, alignment and structure
>d1q5qa_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Rhodococcus erythropolis [TaxId: 1833]} Length = 227 Back     information, alignment and structure
>d1irui_ d.153.1.4 (I:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 220 Back     information, alignment and structure
>d1rype_ d.153.1.4 (E:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 242 Back     information, alignment and structure
>d1iru2_ d.153.1.4 (2:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 217 Back     information, alignment and structure
>d1yara1 d.153.1.4 (A:13-233) Proteasome alpha subunit (non-catalytic) {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 221 Back     information, alignment and structure
>d1iruk_ d.153.1.4 (K:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 199 Back     information, alignment and structure
>d1rypf_ d.153.1.4 (F:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 233 Back     information, alignment and structure
>d1rypa_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 243 Back     information, alignment and structure
>d1rypb_ d.153.1.4 (B:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 250 Back     information, alignment and structure
>d1rypd_ d.153.1.4 (D:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 241 Back     information, alignment and structure
>d1rypg_ d.153.1.4 (G:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 244 Back     information, alignment and structure
>d1rypi_ d.153.1.4 (I:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 222 Back     information, alignment and structure
>d1irud_ d.153.1.4 (D:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 243 Back     information, alignment and structure
>d1irua_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 244 Back     information, alignment and structure
>d1q5qh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Rhodococcus erythropolis [TaxId: 1833]} Length = 224 Back     information, alignment and structure
>d1j2pa_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 243 Back     information, alignment and structure
>d1iruf_ d.153.1.4 (F:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 238 Back     information, alignment and structure
>d1irub_ d.153.1.4 (B:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 233 Back     information, alignment and structure
>d1m4ya_ d.153.1.4 (A:) HslV (ClpQ) protease {Thermotoga maritima [TaxId: 2336]} Length = 171 Back     information, alignment and structure
>d2z3ba1 d.153.1.4 (A:1-180) HslV (ClpQ) protease {Bacillus subtilis [TaxId: 1423]} Length = 180 Back     information, alignment and structure
>d1g3ka_ d.153.1.4 (A:) HslV (ClpQ) protease {Haemophilus influenzae [TaxId: 727]} Length = 173 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query181
d1ryph_205 Proteasome beta subunit (catalytic) {Baker's yeast 100.0
d1ryp1_222 Proteasome beta subunit (catalytic) {Baker's yeast 100.0
d1irul_201 Proteasome beta subunit (catalytic) {Cow (Bos taur 100.0
d1rypk_198 Proteasome beta subunit (catalytic) {Baker's yeast 100.0
d1rypj_204 Proteasome beta subunit (catalytic) {Baker's yeast 100.0
d1rypl_212 Proteasome beta subunit (catalytic) {Baker's yeast 100.0
d1yarh1203 Proteasome beta subunit (catalytic) {Archaeon Ther 100.0
d1iruj_204 Proteasome beta subunit (catalytic) {Cow (Bos taur 100.0
d1irug_245 Proteasome alpha subunit (non-catalytic) {Cow (Bos 100.0
d1iruh_202 Proteasome beta subunit (catalytic) {Cow (Bos taur 100.0
d1iruc_250 Proteasome alpha subunit (non-catalytic) {Cow (Bos 100.0
d1irud_243 Proteasome alpha subunit (non-catalytic) {Cow (Bos 100.0
d1rypc_244 Proteasome alpha subunit (non-catalytic) {Baker's 100.0
d1rypd_241 Proteasome alpha subunit (non-catalytic) {Baker's 100.0
d1yara1221 Proteasome alpha subunit (non-catalytic) {Archaeon 100.0
d1rype_242 Proteasome alpha subunit (non-catalytic) {Baker's 100.0
d1irui_220 Proteasome beta subunit (catalytic) {Cow (Bos taur 100.0
d1j2qh_202 Proteasome beta subunit (catalytic) {Archaeon Arch 100.0
d1ryp2_233 Proteasome beta subunit (catalytic) {Baker's yeast 100.0
d1rypa_243 Proteasome alpha subunit (non-catalytic) {Baker's 100.0
d1irue_234 Proteasome alpha subunit (non-catalytic) {Cow (Bos 100.0
d1iru1_213 Proteasome beta subunit (catalytic) {Cow (Bos taur 100.0
d1rypb_250 Proteasome alpha subunit (non-catalytic) {Baker's 100.0
d1irua_244 Proteasome alpha subunit (non-catalytic) {Cow (Bos 100.0
d1rypg_244 Proteasome alpha subunit (non-catalytic) {Baker's 100.0
d1j2pa_243 Proteasome alpha subunit (non-catalytic) {Archaeon 100.0
d1rypi_222 Proteasome beta subunit (catalytic) {Baker's yeast 100.0
d1iruf_238 Proteasome alpha subunit (non-catalytic) {Cow (Bos 100.0
d1iru2_217 Proteasome beta subunit (catalytic) {Cow (Bos taur 100.0
d1rypf_233 Proteasome alpha subunit (non-catalytic) {Baker's 100.0
d1irub_233 Proteasome alpha subunit (non-catalytic) {Cow (Bos 100.0
d1q5qa_227 Proteasome alpha subunit (non-catalytic) {Rhodococ 100.0
d1iruk_199 Proteasome beta subunit (catalytic) {Cow (Bos taur 100.0
d1q5qh_224 Proteasome beta subunit (catalytic) {Rhodococcus e 100.0
d1m4ya_171 HslV (ClpQ) protease {Thermotoga maritima [TaxId: 99.87
d2z3ba1180 HslV (ClpQ) protease {Bacillus subtilis [TaxId: 14 99.87
d1g3ka_173 HslV (ClpQ) protease {Haemophilus influenzae [TaxI 99.86
>d1ryph_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ntn hydrolase-like
superfamily: N-terminal nucleophile aminohydrolases (Ntn hydrolases)
family: Proteasome subunits
domain: Proteasome beta subunit (catalytic)
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=100.00  E-value=9.5e-40  Score=257.51  Aligned_cols=165  Identities=18%  Similarity=0.212  Sum_probs=149.4

Q ss_pred             ccccCceEEEEEeCCEEEEeEeCCcccCceeecCCcCceEEecCcEEEEEcCChhHHHHHHHHHHHHHHHhhhhhCCCCC
Q 030209            4 TEYNGSALVAMVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDRLFIGLSGLATDSQTLYQRLVFRHKLYQLREERDMK   83 (181)
Q Consensus         4 ~~~~g~TvIgi~~~dgVvla~d~~~s~g~~i~~~~~~Ki~~I~~~i~~~~sG~~aD~~~l~~~~~~~~~~~~~~~~~~i~   83 (181)
                      ...+|+|+|||+++||||||+|+|.+.+.++.+++.+|||+|++|++|+++|..+|++.+.++++.+++.|+++++.+ +
T Consensus         5 ~v~~GtTivgi~~~dgVvlaaD~r~s~g~~i~~~~~~ki~~i~~~i~~~~sG~~aD~~~l~~~~~~~~~~~~~~~~~~-~   83 (205)
T d1ryph_           5 EVSLGASIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAIADIVQYHLELYTSQYGTP-S   83 (205)
T ss_dssp             CCBCCCCEEEEEETTEEEEEECCCEEETTEEEESSCCCEEEEETTEEEEEEEBHHHHHHHHHHHHHHHHHHHHHHSSC-C
T ss_pred             cccCcceEEEEEECCEEEEEECCccccCceeeccccceEEEccCceEEeeccchhHHHHHHHHHHHHHHHHHHHcCCc-c
Confidence            467899999999999999999999999999999999999999999999999999999999999999999999999965 5


Q ss_pred             HHHHHHHHHHHHHhccCCccceEEEEEEEcCCCCcEEEEECCCCceeecCcc----chhhHHHHHHhhCCCChhh--hhH
Q 030209           84 PETFASLVSALLYEKRFGPYFCQPVIAGLSDEDKPFICTMDSIGAKYVGSLQ----KILLLLELLESLFMVPVRQ--CSS  157 (181)
Q Consensus        84 ~~~la~~is~~ly~~r~rP~~vs~ii~G~D~~~~p~Ly~iD~~G~~~~~~~~----g~~~~~~~Le~~~~~~l~~--~~~  157 (181)
                      +..+++++++++|.++ +||++++|+||||++++|+||++||+|++.+++++    |+.+++++||+.|+++|++  |.+
T Consensus        84 ~~~~~~~~~~~~~~~~-~p~~~~~lvaG~d~~~~p~Ly~~d~~G~~~~~~~~a~G~g~~~~~~~Le~~~~~~ms~~ea~~  162 (205)
T d1ryph_          84 TETAASVFKELCYENK-DNLTAGIIVAGYDDKNKGEVYTIPLGGSVHKLPYAIAGSGSTFIYGYCDKNFRENMSKEETVD  162 (205)
T ss_dssp             HHHHHHHHHHHHHHTT-TTCCEEEEEEEEETTTEEEEEEECTTSCCEEESEEEESGGGGGGHHHHHHHCCTTCCHHHHHH
T ss_pred             HHHHHHHHHHHHHhCc-cCceEEEEEEeecCCCCcEEEEECCCCcEEecCeEEeecCcHHHHHHHHhhhhcccCHHHHHH
Confidence            8899999999999875 79999999999998889999999999999999987    8899999999999999886  455


Q ss_pred             HHhhhHHHHH-HHHHHh
Q 030209          158 LIWNPMSCLK-LYLKLC  173 (181)
Q Consensus       158 l~~~~~~~~~-~~~~~~  173 (181)
                      ++.   +|++ ...++|
T Consensus       163 l~~---~al~~a~~rD~  176 (205)
T d1ryph_         163 FIK---HSLSQAIKWDG  176 (205)
T ss_dssp             HHH---HHHHHHHHHBT
T ss_pred             HHH---HHHHHHHHhcC
Confidence            555   5555 334455
>d1ryp1_ d.153.1.4 (1:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1irul_ d.153.1.4 (L:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rypk_ d.153.1.4 (K:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rypj_ d.153.1.4 (J:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rypl_ d.153.1.4 (L:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yarh1 d.153.1.4 (H:1-203) Proteasome beta subunit (catalytic) {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1iruj_ d.153.1.4 (J:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1irug_ d.153.1.4 (G:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1iruh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1iruc_ d.153.1.4 (C:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1irud_ d.153.1.4 (D:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rypc_ d.153.1.4 (C:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rypd_ d.153.1.4 (D:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yara1 d.153.1.4 (A:13-233) Proteasome alpha subunit (non-catalytic) {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1rype_ d.153.1.4 (E:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1irui_ d.153.1.4 (I:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1j2qh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1ryp2_ d.153.1.4 (2:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rypa_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1irue_ d.153.1.4 (E:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1iru1_ d.153.1.4 (1:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rypb_ d.153.1.4 (B:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1irua_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rypg_ d.153.1.4 (G:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1j2pa_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1rypi_ d.153.1.4 (I:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iruf_ d.153.1.4 (F:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1iru2_ d.153.1.4 (2:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rypf_ d.153.1.4 (F:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1irub_ d.153.1.4 (B:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1q5qa_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Rhodococcus erythropolis [TaxId: 1833]} Back     information, alignment and structure
>d1iruk_ d.153.1.4 (K:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1q5qh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Rhodococcus erythropolis [TaxId: 1833]} Back     information, alignment and structure
>d1m4ya_ d.153.1.4 (A:) HslV (ClpQ) protease {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2z3ba1 d.153.1.4 (A:1-180) HslV (ClpQ) protease {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1g3ka_ d.153.1.4 (A:) HslV (ClpQ) protease {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure