Citrus Sinensis ID: 030551


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-----
MGEFFLHVSADDRPSLTSPGRKATIREFYGVILPSLQRLHSNLRELDDAKIENLEIGSFDRMRGDSQVGSADLEREDECGICLEPCTKMVLPNCCHAMCIKCYRNWNTKSESCPFCRGSMKRVNSEDLWVLTCTDDVIDPETVSKEDLLRFYLYINSLPKDYPDALFVVYYEYLI
ccEEEEEEEcccccccccHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHcccccEEccccccccccccccccccccEEcccccccccccccccccHHHHHHHHccccccccccccccccccccccEEEcccccccccccccHHHHHHHHHcccccccccccccccccccccc
cccEEEEEEcccccccccHcHHccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccccccccccccHcHHHHcccEccccccEEcccccHHHHHHHHHHHHHccccccccHHHccccccccEEEEEcccccccHHHHcHHHHHHHHHHHHHcccccccHHHHHHHHHcc
MGEFFLHvsaddrpsltspgrkaTIREFYGVILPSLQRLHSNLRelddakienleigsfdrmrgdsqvgsadleredecgiclepctkmvlpncchamcikcyrnwntksescpfcrgsmkrvnsedlwvltctddvidpetvskeDLLRFYLYINslpkdypdaLFVVYYEYLI
mgefflhvsaddrpsltspgrkATIREFYGVILPSLQRLHSNLRELDDAKIEnleigsfdrmrgDSQVGSADLEREDECGICLEPCTKMVLPNCCHAMCIKCYRNWNTKSESCPFCRGSMKRVNSEDLWVLTCTDDVIDPETVSKEDLLRFYLYInslpkdypdaLFVVYYEYLI
MGEFFLHVSADDRPSLTSPGRKATIREFYGVILPSLQRLHSNLRELDDAKIENLEIGSFDRMRGDSQVGSADLEREDECGICLEPCTKMVLPNCCHAMCIKCYRNWNTKSESCPFCRGSMKRVNSEDLWVLTCTDDVIDPETVSKEDLLRFYLYINSLPKDYPDALFVVYYEYLI
**********************ATIREFYGVILPSLQRLHSNLRELDDAKIENLEI********************DECGICLEPCTKMVLPNCCHAMCIKCYRNWNTKSESCPFCRGSMKRVNSEDLWVLTCTDDVIDPETVSKEDLLRFYLYINSLPKDYPDALFVVYYEYL*
MGEFFLHVSADDRPSLTSPGRKATIREFYGVILPSLQ***************************************DECGICLEPCTKMVLPNCCHAMCIKCYRNWNTKSESCPFCRGSMKRVNSEDLWVLTCTDDVIDPETVSKEDLLRFYLYINSLPKDYPDALFVVYYEYLI
MGEFFLHVSADDRPSLTSPGRKATIREFYGVILPSLQRLHSNLRELDDAKIENLEIGSFDRMRG************DECGICLEPCTKMVLPNCCHAMCIKCYRNWNTKSESCPFCRGSMKRVNSEDLWVLTCTDDVIDPETVSKEDLLRFYLYINSLPKDYPDALFVVYYEYLI
*GEFFLHVSADDRPSLTSPGRKATIREFYGVILPSLQRLHSNLRELDDAKIENLEIGSFD***GDSQVGSADLEREDECGICLEPCTKMVLPNCCHAMCIKCYRNWNTKSESCPFCRGSMKRVNSEDLWVLTCTDDVIDPETVSKEDLLRFYLYINSLPKDYPDALFVVYYEYLI
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGEFFLHVSADDRPSLTSPGRKATIREFYGVILPSLQRLHSNLRELDDAKIENLEIGSFDRMRGDSQVGSADLEREDECGICLEPCTKMVLPNCCHAMCIKCYRNWNTKSESCPFCRGSMKRVNSEDLWVLTCTDDVIDPETVSKEDLLRFYLYINSLPKDYPDALFVVYYEYLI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query175 2.2.26 [Sep-21-2011]
Q7ZX20540 E3 ubiquitin-protein liga N/A no 0.377 0.122 0.328 1e-05
Q6NRG0532 E3 ubiquitin-protein liga N/A no 0.377 0.124 0.328 1e-05
Q5ZM74230 RING finger protein 141 O yes no 0.308 0.234 0.385 2e-05
Q6IV56222 RING finger protein 141 O yes no 0.325 0.256 0.366 2e-05
Q32L15230 RING finger protein 141 O yes no 0.325 0.247 0.366 3e-05
Q5R7K8230 RING finger protein 141 O yes no 0.325 0.247 0.366 4e-05
Q8WVD5230 RING finger protein 141 O yes no 0.325 0.247 0.366 4e-05
Q2XNS1231 RING finger protein 141 O yes no 0.325 0.246 0.366 4e-05
Q6IV57230 RING finger protein 141 O yes no 0.325 0.247 0.366 4e-05
Q99MB7230 RING finger protein 141 O yes no 0.325 0.247 0.366 4e-05
>sp|Q7ZX20|RNF8A_XENLA E3 ubiquitin-protein ligase RNF8-A OS=Xenopus laevis GN=rnf8-a PE=2 SV=1 Back     alignment and function desciption
 Score = 49.7 bits (117), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 22/67 (32%), Positives = 34/67 (50%), Gaps = 1/67 (1%)

Query: 73  LEREDECGICLEPCTKMVLPNCCHAMCIKCYRNWNTKSESCPFCRGSMKRVNSEDLWVLT 132
           L+ E +C IC E   + V  NC H+ C  C ++W  + E CP CR  +    +  L +  
Sbjct: 376 LDNELQCIICSEHFIEAVTLNCAHSFCSYCIKSWKKRKEECPICRQEIV-TETRSLVLDN 434

Query: 133 CTDDVID 139
           C D ++D
Sbjct: 435 CIDSMVD 441




E3 ubiquitin-protein ligase required for assembly of repair proteins to sites of DNA damage. Catalyzes the 'Lys-63'-linked ubiquitination of histone H2A and H2AX. Following DNA double-strand breaks (DSBs), it is recruited to the sites of damage by ATM-phosphorylated mdc1, mediates the ubiquitination of histones H2A and H2AX, thereby promoting the formation of tp53bp1 and brca1 ionizing radiation-induced foci (IRIF). Promotes the formation of 'Lys-63'-linked polyubiquitin chains and functions with the specific ubiquitin-conjugating ubc13 (ube2n). Substrates that are polyubiquitinated at 'Lys-63' are usually not targeted for degradation. Ubiquitination of histone H2A requires UBC13 but not mms2 (ube2v2). May also ubiquitinate histone H2B.
Xenopus laevis (taxid: 8355)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|Q6NRG0|RNF8B_XENLA E3 ubiquitin-protein ligase RNF8-B OS=Xenopus laevis GN=rnf8-b PE=2 SV=1 Back     alignment and function description
>sp|Q5ZM74|RN141_CHICK RING finger protein 141 OS=Gallus gallus GN=RNF141 PE=2 SV=1 Back     alignment and function description
>sp|Q6IV56|RN141_DANRE RING finger protein 141 OS=Danio rerio GN=rnf141 PE=2 SV=2 Back     alignment and function description
>sp|Q32L15|RN141_BOVIN RING finger protein 141 OS=Bos taurus GN=RNF141 PE=2 SV=1 Back     alignment and function description
>sp|Q5R7K8|RN141_PONAB RING finger protein 141 OS=Pongo abelii GN=RNF141 PE=2 SV=1 Back     alignment and function description
>sp|Q8WVD5|RN141_HUMAN RING finger protein 141 OS=Homo sapiens GN=RNF141 PE=1 SV=1 Back     alignment and function description
>sp|Q2XNS1|RN141_CANFA RING finger protein 141 OS=Canis familiaris GN=RNF141 PE=2 SV=1 Back     alignment and function description
>sp|Q6IV57|RN141_RAT RING finger protein 141 OS=Rattus norvegicus GN=Rnf141 PE=2 SV=1 Back     alignment and function description
>sp|Q99MB7|RN141_MOUSE RING finger protein 141 OS=Mus musculus GN=Rnf141 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query175
255547928254 ubiquitin-protein ligase, putative [Rici 0.96 0.661 0.758 2e-72
224107701254 predicted protein [Populus trichocarpa] 0.96 0.661 0.741 2e-70
224100091254 predicted protein [Populus trichocarpa] 0.96 0.661 0.741 3e-70
356512343256 PREDICTED: uncharacterized protein LOC10 0.96 0.656 0.715 3e-66
449435023253 PREDICTED: uncharacterized protein LOC10 0.982 0.679 0.672 4e-66
225425930254 PREDICTED: uncharacterized protein LOC10 0.96 0.661 0.7 1e-65
388501306254 unknown [Medicago truncatula] 0.96 0.661 0.710 2e-65
356525120256 PREDICTED: uncharacterized protein LOC10 0.954 0.652 0.705 3e-65
297851138251 protein binding protein [Arabidopsis lyr 0.954 0.665 0.716 4e-65
18395478251 RING/U-box domain-containing protein [Ar 0.954 0.665 0.716 6e-65
>gi|255547928|ref|XP_002515021.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223546072|gb|EEF47575.1| ubiquitin-protein ligase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  276 bits (707), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 129/170 (75%), Positives = 150/170 (88%), Gaps = 2/170 (1%)

Query: 8   VSADDRPSLTSPGRKATIREFYGVILPSLQRLHSNLRELDDAKIENLEIGSF--DRMRGD 65
           V AD RP+L++ GRKATI+EFYGVILPSLQRLHSNL EL+D K  +L + S    ++ GD
Sbjct: 85  VYADGRPNLSTHGRKATIKEFYGVILPSLQRLHSNLEELEDIKDGHLRMDSLAKKKVEGD 144

Query: 66  SQVGSADLEREDECGICLEPCTKMVLPNCCHAMCIKCYRNWNTKSESCPFCRGSMKRVNS 125
            ++ + DLEREDECGICLEPC KMVLPNCCHAMCIKCYRNWNT+SESCPFCRGS+KRVNS
Sbjct: 145 FRLANIDLEREDECGICLEPCQKMVLPNCCHAMCIKCYRNWNTRSESCPFCRGSLKRVNS 204

Query: 126 EDLWVLTCTDDVIDPETVSKEDLLRFYLYINSLPKDYPDALFVVYYEYLI 175
           EDLWVLTC +DV+D +T++KEDLLRFYLYINSLPKDYPDALF+VYYEYL+
Sbjct: 205 EDLWVLTCNNDVVDTKTITKEDLLRFYLYINSLPKDYPDALFLVYYEYLM 254




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224107701|ref|XP_002314569.1| predicted protein [Populus trichocarpa] gi|222863609|gb|EEF00740.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224100091|ref|XP_002311740.1| predicted protein [Populus trichocarpa] gi|222851560|gb|EEE89107.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356512343|ref|XP_003524879.1| PREDICTED: uncharacterized protein LOC100790422 [Glycine max] Back     alignment and taxonomy information
>gi|449435023|ref|XP_004135295.1| PREDICTED: uncharacterized protein LOC101206911 [Cucumis sativus] gi|449512970|ref|XP_004164192.1| PREDICTED: uncharacterized protein LOC101223721 [Cucumis sativus] Back     alignment and taxonomy information
>gi|225425930|ref|XP_002272699.1| PREDICTED: uncharacterized protein LOC100240870 [Vitis vinifera] gi|297738321|emb|CBI27522.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|388501306|gb|AFK38719.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|356525120|ref|XP_003531175.1| PREDICTED: uncharacterized protein LOC100499999 [Glycine max] Back     alignment and taxonomy information
>gi|297851138|ref|XP_002893450.1| protein binding protein [Arabidopsis lyrata subsp. lyrata] gi|297339292|gb|EFH69709.1| protein binding protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|18395478|ref|NP_564218.1| RING/U-box domain-containing protein [Arabidopsis thaliana] gi|9743332|gb|AAF97956.1|AC000103_6 F21J9.10 [Arabidopsis thaliana] gi|21553664|gb|AAM62757.1| unknown [Arabidopsis thaliana] gi|24030317|gb|AAN41327.1| unknown protein [Arabidopsis thaliana] gi|332192409|gb|AEE30530.1| RING/U-box domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query175
TAIR|locus:2024026251 AT1G24440 [Arabidopsis thalian 0.954 0.665 0.716 8.5e-65
TAIR|locus:505006120260 AT1G13195 [Arabidopsis thalian 0.948 0.638 0.704 5.5e-61
TAIR|locus:2149750242 AIRP2 "ABA Insensitive RING Pr 0.914 0.661 0.456 1.3e-36
TAIR|locus:505006703242 AT5G58787 "AT5G58787" [Arabido 0.897 0.648 0.430 1.2e-35
UNIPROTKB|Q5ZM74230 RNF141 "RING finger protein 14 0.308 0.234 0.385 3.4e-08
ZFIN|ZDB-GENE-040625-71222 rnf141 "ring finger protein 14 0.428 0.337 0.329 2e-07
UNIPROTKB|E1BTQ2136 RNF8 "Uncharacterized protein" 0.377 0.485 0.328 3.8e-07
UNIPROTKB|Q32L15230 RNF141 "RING finger protein 14 0.325 0.247 0.366 3.8e-07
UNIPROTKB|F1Q4F0230 RNF141 "RING finger protein 14 0.325 0.247 0.366 3.8e-07
UNIPROTKB|Q8WVD5230 RNF141 "RING finger protein 14 0.325 0.247 0.366 3.8e-07
TAIR|locus:2024026 AT1G24440 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 660 (237.4 bits), Expect = 8.5e-65, P = 8.5e-65
 Identities = 124/173 (71%), Positives = 141/173 (81%)

Query:     8 VSADDRPSLTSPGRKATIREFYGVILPSLQRLHSNLRELDDAKI-----ENLEIGSFDRM 62
             V AD R + +  GRKATIREFYGVILPSL+RLH N  +L D  +     + +    +D +
Sbjct:    80 VRADGRWNRSRYGRKATIREFYGVILPSLERLHINFADLPDESLWYPNPKAITKKQYD-I 138

Query:    63 RGDSQVGSADLEREDECGICLEPCTKMVLPNCCHAMCIKCYRNWNTKSESCPFCRGSMKR 122
              G   + S DLEREDECGICLEPCTKMVLPNCCHAMCIKCYRNWNTKSESCPFCRGS+KR
Sbjct:   139 EGSRYMNSIDLEREDECGICLEPCTKMVLPNCCHAMCIKCYRNWNTKSESCPFCRGSIKR 198

Query:   123 VNSEDLWVLTCTDDVIDPETVSKEDLLRFYLYINSLPKDYPDALFVVYYEYLI 175
             VNSEDLWVLTC +DV+DPETV+KEDLLRFYL+INSLPKDYP+A F+VY EYLI
Sbjct:   199 VNSEDLWVLTCDEDVVDPETVTKEDLLRFYLHINSLPKDYPEAAFLVYNEYLI 251




GO:0005634 "nucleus" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA
TAIR|locus:505006120 AT1G13195 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2149750 AIRP2 "ABA Insensitive RING Protein 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:505006703 AT5G58787 "AT5G58787" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZM74 RNF141 "RING finger protein 141" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040625-71 rnf141 "ring finger protein 141" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E1BTQ2 RNF8 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q32L15 RNF141 "RING finger protein 141" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1Q4F0 RNF141 "RING finger protein 141" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q8WVD5 RNF141 "RING finger protein 141" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer6.3.2LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query175
PHA02929238 PHA02929, PHA02929, N1R/p28-like protein; Provisio 3e-07
pfam1363946 pfam13639, zf-RING_2, Ring finger domain 5e-07
cd0016245 cd00162, RING, RING-finger (Really Interesting New 6e-07
pfam1392345 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI 3e-06
smart0018440 smart00184, RING, Ring finger 1e-05
pfam1392049 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RI 7e-05
pfam0009740 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING 2e-04
PHA02926242 PHA02926, PHA02926, zinc finger-like protein; Prov 0.001
>gnl|CDD|222944 PHA02929, PHA02929, N1R/p28-like protein; Provisional Back     alignment and domain information
 Score = 48.2 bits (115), Expect = 3e-07
 Identities = 17/54 (31%), Positives = 25/54 (46%), Gaps = 8/54 (14%)

Query: 72  DLEREDECGICLEPCTKM--------VLPNCCHAMCIKCYRNWNTKSESCPFCR 117
           +  ++ EC IC+E             +L NC H  CI+C   W  +  +CP CR
Sbjct: 170 NRSKDKECAICMEKVYDKEIKNMYFGILSNCNHVFCIECIDIWKKEKNTCPVCR 223


Length = 238

>gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain Back     alignment and domain information
>gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|214546 smart00184, RING, Ring finger Back     alignment and domain information
>gnl|CDD|222454 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|215715 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|165237 PHA02926, PHA02926, zinc finger-like protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 175
PHA02929238 N1R/p28-like protein; Provisional 99.38
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 99.31
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 99.31
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 99.3
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 99.27
PHA02926242 zinc finger-like protein; Provisional 99.26
KOG1039344 consensus Predicted E3 ubiquitin ligase [Posttrans 99.23
KOG0823230 consensus Predicted E3 ubiquitin ligase [Posttrans 99.22
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 99.17
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 99.17
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 99.13
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 99.12
COG5243491 HRD1 HRD ubiquitin ligase complex, ER membrane com 99.03
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 99.01
smart0050463 Ubox Modified RING finger domain. Modified RING fi 99.01
cd0016245 RING RING-finger (Really Interesting New Gene) dom 99.0
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 98.96
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 98.95
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 98.93
PF1463444 zf-RING_5: zinc-RING finger domain 98.9
KOG0287 442 consensus Postreplication repair protein RAD18 [Re 98.9
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 98.88
KOG2164 513 consensus Predicted E3 ubiquitin ligase [Posttrans 98.84
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 98.82
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 98.79
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 98.78
KOG1002 791 consensus Nucleotide excision repair protein RAD16 98.61
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 98.57
KOG0802 543 consensus E3 ubiquitin ligase [Posttranslational m 98.54
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 98.54
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 98.51
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 98.45
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 98.45
TIGR00570 309 cdk7 CDK-activating kinase assembly factor MAT1. A 98.43
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 98.39
KOG2177 386 consensus Predicted E3 ubiquitin ligase [Posttrans 98.37
KOG1734328 consensus Predicted RING-containing E3 ubiquitin l 98.32
KOG149384 consensus Anaphase-promoting complex (APC), subuni 98.28
KOG4265349 consensus Predicted E3 ubiquitin ligase [Posttrans 98.27
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 98.16
KOG1785563 consensus Tyrosine kinase negative regulator CBL [ 98.14
KOG4159 398 consensus Predicted E3 ubiquitin ligase [Posttrans 98.07
KOG0824 324 consensus Predicted E3 ubiquitin ligase [Posttrans 98.07
KOG0297 391 consensus TNF receptor-associated factor [Signal t 97.95
KOG0804 493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 97.95
COG52191525 Uncharacterized conserved protein, contains RING Z 97.9
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 97.89
COG5152259 Uncharacterized conserved protein, contains RING a 97.82
KOG0311 381 consensus Predicted E3 ubiquitin ligase [Posttrans 97.82
KOG4692489 consensus Predicted E3 ubiquitin ligase [Posttrans 97.74
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 97.73
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 97.73
PHA03096284 p28-like protein; Provisional 97.64
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 97.6
KOG2930114 consensus SCF ubiquitin ligase, Rbx1 component [Po 97.59
KOG0825 1134 consensus PHD Zn-finger protein [General function 97.57
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 97.54
KOG2660 331 consensus Locus-specific chromosome binding protei 97.52
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 97.5
KOG1645 463 consensus RING-finger-containing E3 ubiquitin liga 97.38
KOG4275350 consensus Predicted E3 ubiquitin ligase [Posttrans 97.34
KOG1001 674 consensus Helicase-like transcription factor HLTF/ 97.23
KOG4739 233 consensus Uncharacterized protein involved in syna 97.02
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 96.95
COG5236 493 Uncharacterized conserved protein, contains RING Z 96.93
KOG1571355 consensus Predicted E3 ubiquitin ligase [Posttrans 96.71
KOG3002 299 consensus Zn finger protein [General function pred 96.7
KOG4185 296 consensus Predicted E3 ubiquitin ligase [Posttrans 96.66
KOG1428 3738 consensus Inhibitor of type V adenylyl cyclases/Ne 96.4
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 96.34
KOG3039303 consensus Uncharacterized conserved protein [Funct 96.33
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 96.3
COG5222427 Uncharacterized conserved protein, contains RING Z 96.08
KOG4445 368 consensus Uncharacterized conserved protein, conta 96.05
PF07800162 DUF1644: Protein of unknown function (DUF1644); In 95.86
PF10272358 Tmpp129: Putative transmembrane protein precursor; 95.83
PF04641260 Rtf2: Rtf2 RING-finger 95.78
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 95.72
KOG1941518 consensus Acetylcholine receptor-associated protei 95.67
KOG0826357 consensus Predicted E3 ubiquitin ligase involved i 95.64
COG5175 480 MOT2 Transcriptional repressor [Transcription] 95.61
PHA02825162 LAP/PHD finger-like protein; Provisional 95.39
KOG1814 445 consensus Predicted E3 ubiquitin ligase [Posttrans 95.2
PHA02862156 5L protein; Provisional 95.12
KOG2932 389 consensus E3 ubiquitin ligase involved in ubiquiti 94.78
KOG3268234 consensus Predicted E3 ubiquitin ligase [Posttrans 94.71
KOG2034911 consensus Vacuolar sorting protein PEP3/VPS18 [Int 94.51
KOG3970 299 consensus Predicted E3 ubiquitin ligase [Posttrans 94.22
KOG3800 300 consensus Predicted E3 ubiquitin ligase containing 93.92
KOG1100207 consensus Predicted E3 ubiquitin ligase [Posttrans 93.92
KOG1952 950 consensus Transcription factor NF-X1, contains NFX 93.8
KOG0298 1394 consensus DEAD box-containing helicase-like transc 93.23
PF0874643 zf-RING-like: RING-like domain; InterPro: IPR01485 93.19
PF05290140 Baculo_IE-1: Baculovirus immediate-early protein ( 92.83
KOG4367 699 consensus Predicted Zn-finger protein [Function un 92.59
COG5220 314 TFB3 Cdk activating kinase (CAK)/RNA polymerase II 92.25
PF1456980 zf-UDP: Zinc-binding RING-finger; PDB: 1WEO_A. 92.07
PF1290647 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A. 91.8
KOG3053 293 consensus Uncharacterized conserved protein [Funct 91.69
KOG1940276 consensus Zn-finger protein [General function pred 91.55
KOG1812 384 consensus Predicted E3 ubiquitin ligase [Posttrans 91.38
KOG2817394 consensus Predicted E3 ubiquitin ligase [Posttrans 90.8
KOG3899381 consensus Uncharacterized conserved protein [Funct 90.3
KOG4362 684 consensus Transcriptional regulator BRCA1 [Replica 90.23
PF05883134 Baculo_RING: Baculovirus U-box/Ring-like domain; I 89.96
KOG03091081 consensus Conserved WD40 repeat-containing protein 89.05
PLN02638 1079 cellulose synthase A (UDP-forming), catalytic subu 88.84
KOG3039 303 consensus Uncharacterized conserved protein [Funct 88.52
PLN02189 1040 cellulose synthase 88.28
PF0385450 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc 88.09
PLN02436 1094 cellulose synthase A 88.04
KOG1815 444 consensus Predicted E3 ubiquitin ligase [Posttrans 86.44
PLN02400 1085 cellulose synthase 86.14
KOG3161 861 consensus Predicted E3 ubiquitin ligase [Posttrans 86.06
PF0289150 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR0041 84.98
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 82.58
KOG3579352 consensus Predicted E3 ubiquitin ligase [Posttrans 82.49
COG5183 1175 SSM4 Protein involved in mRNA turnover and stabili 82.32
KOG1812384 consensus Predicted E3 ubiquitin ligase [Posttrans 81.23
PLN02915 1044 cellulose synthase A [UDP-forming], catalytic subu 81.17
PF04216290 FdhE: Protein involved in formate dehydrogenase fo 80.11
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
Probab=99.38  E-value=2.3e-13  Score=109.56  Aligned_cols=56  Identities=32%  Similarity=0.894  Sum_probs=47.9

Q ss_pred             CCCCcceecccCCCC--------ccccCCCCccchhhHHhhcCCCCCCcccccccccccCCCce
Q 030551           74 EREDECGICLEPCTK--------MVLPNCCHAMCIKCYRNWNTKSESCPFCRGSMKRVNSEDLW  129 (175)
Q Consensus        74 ~~~~~C~IC~~~~~~--------~~~~~C~H~fc~~Ci~~w~~~~~~CP~CR~~i~~~~~~~~~  129 (175)
                      ..+.+|+||++.+..        +++++|+|.||..||.+|+..+.+||+||.++..+.++..|
T Consensus       172 ~~~~eC~ICle~~~~~~~~~~~~~vl~~C~H~FC~~CI~~Wl~~~~tCPlCR~~~~~v~~~r~~  235 (238)
T PHA02929        172 SKDKECAICMEKVYDKEIKNMYFGILSNCNHVFCIECIDIWKKEKNTCPVCRTPFISVIKSRFF  235 (238)
T ss_pred             CCCCCCccCCcccccCccccccceecCCCCCcccHHHHHHHHhcCCCCCCCCCEeeEEeeeeee
Confidence            345899999998654        36778999999999999999889999999999987777655



>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA03096 p28-like protein; Provisional Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3002 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms] Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] Back     alignment and domain information
>PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function Back     alignment and domain information
>PF10272 Tmpp129: Putative transmembrane protein precursor; InterPro: IPR018801 This entry consists of proteins conserved from worms to humans Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>PHA02825 LAP/PHD finger-like protein; Provisional Back     alignment and domain information
>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02862 5L protein; Provisional Back     alignment and domain information
>KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3268 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2034 consensus Vacuolar sorting protein PEP3/VPS18 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3970 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3800 consensus Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1100 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1952 consensus Transcription factor NF-X1, contains NFX-type Zn2+-binding and R3H domains [Transcription] Back     alignment and domain information
>KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair] Back     alignment and domain information
>PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO) Back     alignment and domain information
>PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 Back     alignment and domain information
>KOG4367 consensus Predicted Zn-finger protein [Function unknown] Back     alignment and domain information
>COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PF14569 zf-UDP: Zinc-binding RING-finger; PDB: 1WEO_A Back     alignment and domain information
>PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A Back     alignment and domain information
>KOG3053 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1940 consensus Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG1812 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3899 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4362 consensus Transcriptional regulator BRCA1 [Replication, recombination and repair; Transcription] Back     alignment and domain information
>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PLN02638 cellulose synthase A (UDP-forming), catalytic subunit Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN02189 cellulose synthase Back     alignment and domain information
>PF03854 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PLN02436 cellulose synthase A Back     alignment and domain information
>KOG1815 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02400 cellulose synthase Back     alignment and domain information
>KOG3161 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF02891 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3579 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5183 SSM4 Protein involved in mRNA turnover and stability [RNA processing and modification] Back     alignment and domain information
>KOG1812 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02915 cellulose synthase A [UDP-forming], catalytic subunit Back     alignment and domain information
>PF04216 FdhE: Protein involved in formate dehydrogenase formation; InterPro: IPR006452 This family of sequences describe an accessory protein required for the assembly of formate dehydrogenase of certain proteobacteria although not present in the final complex [] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query175
4epo_C149 Crystal Structure Of Rnf8 Bound To The Ubc13MMS2 HE 1e-04
2ecn_A70 Solution Structure Of The Ring Domain Of The Human 2e-04
4ayc_B138 Rnf8 Ring Domain Structure Length = 138 5e-04
4ayc_A138 Rnf8 Ring Domain Structure Length = 138 8e-04
>pdb|4EPO|C Chain C, Crystal Structure Of Rnf8 Bound To The Ubc13MMS2 HETERODIMER Length = 149 Back     alignment and structure

Iteration: 1

Score = 42.4 bits (98), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 30/112 (26%), Positives = 46/112 (41%), Gaps = 11/112 (9%) Query: 16 LTSPGRKATIREFYGVILPSLQRLHSNLRELDDAKIENLEIGSFDRMRGDSQVGSA---- 71 L SPG + + ++ L R + + AK + LE ++ + +Q Sbjct: 3 LGSPGFQE-----HWALMEELNRSKKDFEAIIQAKNKELEQTKEEKEKMQAQKEEVLSHM 57 Query: 72 --DLEREDECGICLEPCTKMVLPNCCHAMCIKCYRNWNTKSESCPFCRGSMK 121 LE E +C IC E + V NC H+ C C W + CP CR +K Sbjct: 58 NDVLENELQCIICSEYFIEAVTLNCAHSFCSYCINEWMKRKIECPICRKDIK 109
>pdb|2ECN|A Chain A, Solution Structure Of The Ring Domain Of The Human Ring Finger Protein 141 Length = 70 Back     alignment and structure
>pdb|4AYC|B Chain B, Rnf8 Ring Domain Structure Length = 138 Back     alignment and structure
>pdb|4AYC|A Chain A, Rnf8 Ring Domain Structure Length = 138 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query175
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 1e-18
4epo_C149 E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 3e-18
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 2e-12
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 6e-08
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 9e-08
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 1e-07
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 2e-07
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 2e-07
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 4e-07
2ecm_A55 Ring finger and CHY zinc finger domain- containing 9e-07
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 2e-06
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 3e-06
1z6u_A150 NP95-like ring finger protein isoform B; structura 4e-06
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 7e-06
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 1e-05
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 2e-05
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 2e-05
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 2e-05
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 4e-05
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 6e-05
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 6e-05
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 6e-05
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 1e-04
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 1e-04
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 2e-04
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 2e-04
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 2e-04
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 2e-04
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 2e-04
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 4e-04
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 4e-04
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 5e-04
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 5e-04
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 6e-04
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 7e-04
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
 Score = 74.4 bits (183), Expect = 1e-18
 Identities = 20/55 (36%), Positives = 29/55 (52%), Gaps = 1/55 (1%)

Query: 72  DLEREDECGICLEPCTKMVLPNCCHAMCIKCYRNWNTKSESCPFCRGSMKRVNSE 126
            L  E+EC IC++    ++LP C H+ C KC   W+ +  +CP CR  M   N  
Sbjct: 11  QLTDEEECCICMDGRADLILP-CAHSFCQKCIDKWSDRHRNCPICRLQMTGANES 64


>4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Length = 55 Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150 Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Length = 64 Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 117 Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Length = 63 Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Length = 165 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Length = 141 Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Length = 116 Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 112 Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118 Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Length = 79 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Length = 170 Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Length = 78 Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query175
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 99.46
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 99.46
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 99.46
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 99.45
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 99.44
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 99.44
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 99.42
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 99.42
2ysl_A73 Tripartite motif-containing protein 31; ring-type 99.42
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 99.42
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 99.42
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 99.41
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 99.41
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 99.4
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 99.4
2ecm_A55 Ring finger and CHY zinc finger domain- containing 99.4
2ect_A78 Ring finger protein 126; metal binding protein, st 99.4
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 99.39
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 99.38
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 99.38
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 99.38
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 99.36
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 99.35
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 99.35
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 99.35
2ecw_A85 Tripartite motif-containing protein 30; metal bind 99.35
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 99.34
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 99.34
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 99.33
2ysj_A63 Tripartite motif-containing protein 31; ring-type 99.32
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 99.3
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 99.3
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 99.29
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 99.29
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 99.28
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 99.27
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 99.27
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 99.27
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 99.26
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 99.25
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 99.25
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 99.25
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 99.23
1z6u_A150 NP95-like ring finger protein isoform B; structura 99.22
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 99.22
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 99.18
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 99.17
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 99.17
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 99.17
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 99.16
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 99.15
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 99.14
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 99.13
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.11
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 99.1
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 99.09
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 99.03
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 99.03
2ea5_A68 Cell growth regulator with ring finger domain prot 99.02
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 99.02
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 98.99
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 98.97
2f42_A179 STIP1 homology and U-box containing protein 1; cha 98.94
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 98.92
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 98.8
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 98.78
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 98.65
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 98.62
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 98.57
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 98.44
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 98.42
3nw0_A238 Non-structural maintenance of chromosomes element 97.72
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 96.15
2ko5_A99 Ring finger protein Z; lassa fever virus-Z, negati 95.04
1weo_A93 Cellulose synthase, catalytic subunit (IRX3); stru 92.93
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 92.92
3u5n_A207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 89.8
3m62_A968 Ubiquitin conjugation factor E4; armadillo-like re 89.47
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 89.46
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 87.58
2cs3_A93 Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, s 87.53
2yql_A56 PHD finger protein 21A; PHD domain, structural gen 87.51
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 87.36
1wil_A89 KIAA1045 protein; ring finger domain, structural g 83.63
2zet_C153 Melanophilin; complex, GTP-binding protein, GTPase 82.65
1xwh_A66 Autoimmune regulator; PHD domain, Zn binding domai 81.95
1wd2_A60 Ariadne-1 protein homolog; ring, IBR, triad, zinc 81.11
2puy_A60 PHD finger protein 21A; PHD finger, histone CODE, 80.09
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
Probab=99.46  E-value=3.1e-14  Score=93.17  Aligned_cols=50  Identities=28%  Similarity=0.668  Sum_probs=45.0

Q ss_pred             CCCCCcceecccCCCCccccCCCCccchhhHHhhcCCCCCCccccccccc
Q 030551           73 LEREDECGICLEPCTKMVLPNCCHAMCIKCYRNWNTKSESCPFCRGSMKR  122 (175)
Q Consensus        73 ~~~~~~C~IC~~~~~~~~~~~C~H~fc~~Ci~~w~~~~~~CP~CR~~i~~  122 (175)
                      ..+...|+||++.+.+++.++|||.||..|+.+|+.....||+||.++..
T Consensus        12 ~~~~~~C~IC~~~~~~~~~~~CgH~fC~~Ci~~~~~~~~~CP~Cr~~~~~   61 (71)
T 2d8t_A           12 SLTVPECAICLQTCVHPVSLPCKHVFCYLCVKGASWLGKRCALCRQEIPE   61 (71)
T ss_dssp             SSSCCBCSSSSSBCSSEEEETTTEEEEHHHHHHCTTCSSBCSSSCCBCCH
T ss_pred             CCCCCCCccCCcccCCCEEccCCCHHHHHHHHHHHHCCCcCcCcCchhCH
Confidence            34568999999999998888999999999999999888899999999863



>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure
>1weo_A Cellulose synthase, catalytic subunit (IRX3); structure genomics, ring-finger, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: g.44.1.1 Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Back     alignment and structure
>3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2cs3_A Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.3 Back     alignment and structure
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Back     alignment and structure
>1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 Back     alignment and structure
>2zet_C Melanophilin; complex, GTP-binding protein, GTPase, G-protein, RAB, RAB27B, effector, SLP homology domain, acetylation, lipoprotein, membrane; HET: GTP; 3.00A {Mus musculus} Back     alignment and structure
>1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Back     alignment and structure
>1wd2_A Ariadne-1 protein homolog; ring, IBR, triad, zinc finger, ligase; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 175
d1iyma_55 g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati 2e-08
d1chca_68 g.44.1.1 (A:) Immediate early protein, IEEHV {Equi 4e-08
d1fbva479 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta 5e-08
d1rmda286 g.44.1.1 (A:1-86) V(D)J recombination activating p 7e-08
d1bora_56 g.44.1.1 (A:) Acute promyelocytic leukaemia proto- 4e-06
d1jm7a_103 g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie 7e-06
d3dplr188 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of S 2e-05
d1g25a_65 g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi 1e-04
d1jm7b_97 g.44.1.1 (B:) bard1 RING domain {Human (Homo sapie 2e-04
d1t1ha_78 g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cre 3e-04
d2baya156 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 { 0.001
d1wgma_98 g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Hu 0.002
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: EL5 RING-H2 domain
species: Rice (Oryza sativa) [TaxId: 4530]
 Score = 46.4 bits (110), Expect = 2e-08
 Identities = 14/49 (28%), Positives = 19/49 (38%), Gaps = 4/49 (8%)

Query: 73  LEREDECGICLEP----CTKMVLPNCCHAMCIKCYRNWNTKSESCPFCR 117
           ++   EC +CL           LP C H    +C   W     +CP CR
Sbjct: 2   MDDGVECAVCLAELEDGEEARFLPRCGHGFHAECVDMWLGSHSTCPLCR 50


>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 78 Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56 Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query175
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 99.56
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 99.52
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 99.48
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 99.41
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 99.39
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 99.38
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 99.38
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 99.35
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 99.34
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 99.31
d2c2la280 STIP1 homology and U box-containing protein 1, STU 99.28
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 99.24
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 99.22
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 99.21
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 99.06
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 99.06
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 98.4
d1weoa_93 Cellulose synthase A catalytic subunit 7, IRX3 {Th 95.28
d1mm2a_61 Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 90.39
d2cs3a180 Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [ 89.77
d1fp0a170 Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo 89.06
d1zbdb_124 Effector domain of rabphilin-3a {Rat (Rattus norve 85.93
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 85.57
d1y02a251 Rififylin (FYVE-RING finger protein Sakura) {Human 85.33
d1wila_89 Hypothetical protein KIAA1045 {Human (Homo sapiens 84.62
d1z60a159 TFIIH p44 subunit cysteine-rich domain {Human (Hom 81.47
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: EL5 RING-H2 domain
species: Rice (Oryza sativa) [TaxId: 4530]
Probab=99.56  E-value=8.8e-16  Score=94.81  Aligned_cols=47  Identities=30%  Similarity=0.808  Sum_probs=40.6

Q ss_pred             CCCCcceecccCCCC----ccccCCCCccchhhHHhhcCCCCCCccccccc
Q 030551           74 EREDECGICLEPCTK----MVLPNCCHAMCIKCYRNWNTKSESCPFCRGSM  120 (175)
Q Consensus        74 ~~~~~C~IC~~~~~~----~~~~~C~H~fc~~Ci~~w~~~~~~CP~CR~~i  120 (175)
                      +++.+|+||++.+..    ..++.|+|.||..|+.+|+..+.+||+||+++
T Consensus         3 ed~~~C~ICl~~~~~~~~~~~l~~C~H~Fh~~Ci~~Wl~~~~~CP~CR~~i   53 (55)
T d1iyma_           3 DDGVECAVCLAELEDGEEARFLPRCGHGFHAECVDMWLGSHSTCPLCRLTV   53 (55)
T ss_dssp             CCSCCCTTTCCCCCTTSCCEECSSSCCEECTTHHHHTTTTCCSCSSSCCCS
T ss_pred             CCCCCCeEECccccCCCEEEEeCCCCCcccHHHHHHHHHhCCcCCCCCCEe
Confidence            345689999999875    34567999999999999999999999999986



>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weoa_ g.44.1.1 (A:) Cellulose synthase A catalytic subunit 7, IRX3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cs3a1 g.44.1.3 (A:8-87) Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zbdb_ g.50.1.1 (B:) Effector domain of rabphilin-3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y02a2 g.50.1.1 (A:20-70) Rififylin (FYVE-RING finger protein Sakura) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z60a1 g.49.1.2 (A:328-386) TFIIH p44 subunit cysteine-rich domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure