Citrus Sinensis ID: 030594

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-----
MATALLILLLVAPAVYAVEYTVGDTSGWTQGFDYTSWVSGKTFKVGDVLVFNYGGLHKVDRVSESDYNNCASSNALESHDDGNTRINLKAPGTQYFICPTAGHCPGGMKLAVTVVAASPPGTNTPSGSPPSTPATTGTPPSTTSSPPNGAACFFCSLYYNVMAVLFSFLVVAVMG
cHHHHHHHHHHHccccEEEEEEcccccccccccccccccccEEEEccEEEEEEcccccEEEEcHHHccccccccccccccccccEEEEcccccEEEEcccccccccccEEEEEEEcccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcc
cHHHHHHHHHHHHHHccEEEEEcccccccccccHHHHHcccEEEEccEEEEEEcccccEEEEcHHHHHHccccccccEccccccEEEEcccEEEEEEcccccccccccEEEEEEEccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHc
MATALLILLLVAPAVYAVEytvgdtsgwtqgfdytswvsgktfkvgDVLVFNygglhkvdrvsesdynncassnaleshddgntrinlkapgtqyficptaghcpggmKLAVTVVAasppgtntpsgsppstpattgtppsttssppngaacfFCSLYYNVMAVLFSFLVVAVMG
MATALLILLLVAPAVYAVEYTVGDTSGWTQGFDYTSWVSGKTFKVGDVLVFNYGGLHKVDRVSESDYNNCASsnaleshddgnTRINLKAPGTQYFICPTAGHCPGGMKLAVTVVAASPPGtntpsgsppstPATTGTPPSTTSSPPNGAACFFCSLYYNVMAVLFSFLVVAVMG
MatallilllvapavyavEYTVGDTSGWTQGFDYTSWVSGKTFKVGDVLVFNYGGLHKVDRVSESDYNNCASSNALESHDDGNTRINLKAPGTQYFICPTAGHCPGGMKLAVTVVAasppgtntpsgsppstpattgtppsttssppngaaCFFCSLYYNVMAVLFSFLVVAVMG
***ALLILLLVAPAVYAVEYTVGDTSGWTQGFDYTSWVSGKTFKVGDVLVFNYGGLHKVDRVS*********************RINLKAPGTQYFICPTAGHCPGGMKLAVTVVA*********************************AACFFCSLYYNVMAVLFSFLVVAV**
MATALLILLLVAPAVYAVEYTVGDTSGWTQGFDYTSWVSGKTFKVGDVLVFNYGGLHKVDRVSESDYNNCASSNALESHDDGNTRINLKAPGTQYFICPTAGHCPGGMKLAVT****************************************FCSLYYNVMAVLFSFLVVAVMG
MATALLILLLVAPAVYAVEYTVGDTSGWTQGFDYTSWVSGKTFKVGDVLVFNYGGLHKVDRVSESDYNNCASSNALESHDDGNTRINLKAPGTQYFICPTAGHCPGGMKLAVTVVAASP***************************PNGAACFFCSLYYNVMAVLFSFLVVAVMG
MATALLILLLVAPAVYAVEYTVGDTSGWTQGFDYTSWVSGKTFKVGDVLVFNYGGLHKVDRVSESDYNNCASSNALESHDDGNTRINLKAPGTQYFICPTAGHCPGGMKLAVTVVAA*******************************GAACFFCSLYYNVMAVLFSFLVVAVMG
iiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiii
iiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHi
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiii
SSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHi
SSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATALLILLLVAPAVYAVEYTVGDTSGWTQGFDYTSWVSGKTFKVGDVLVFNYGGLHKVDRVSESDYNNCASSNALESHDDGNTRINLKAPGTQYFICPTAGHCPGGMKLAVTVVAASPPGTNTPSGSPPSTPATTGTPPSTTSSPPNGAACFFCSLYYNVMAVLFSFLVVAVMG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query175 2.2.26 [Sep-21-2011]
O80517202 Uclacyanin-2 OS=Arabidops no no 0.594 0.514 0.518 2e-26
Q41001189 Blue copper protein OS=Pi N/A no 0.628 0.582 0.540 3e-26
Q07488196 Blue copper protein OS=Ar no no 0.68 0.607 0.424 1e-18
P00302107 Stellacyanin OS=Toxicoden N/A no 0.565 0.925 0.428 7e-18
Q8LG89129 Basic blue protein OS=Ara no no 0.622 0.844 0.442 9e-18
P60496126 Chemocyanin OS=Lilium lon N/A no 0.537 0.746 0.479 2e-16
P80728108 Mavicyanin OS=Cucurbita p N/A no 0.56 0.907 0.415 4e-15
Q9SK27182 Early nodulin-like protei no no 0.651 0.626 0.358 4e-14
Q39131172 Lamin-like protein OS=Ara no no 0.782 0.796 0.323 3e-13
P0030396 Basic blue protein OS=Cuc N/A no 0.531 0.968 0.391 1e-12
>sp|O80517|BCB2_ARATH Uclacyanin-2 OS=Arabidopsis thaliana GN=At2g44790 PE=1 SV=1 Back     alignment and function desciption
 Score =  118 bits (295), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 57/110 (51%), Positives = 73/110 (66%), Gaps = 6/110 (5%)

Query: 11  VAPAVYAVEYTVGDTSGWTQGFDYTSWVSGKTFKVGDVLVFNYGGLHKVDRVSESDYNNC 70
           + P   AV YT+     WT G DY+ W +GKTF+VGD+L F YG  H VD V ++ Y+ C
Sbjct: 23  IVPGAVAVTYTIE----WTTGVDYSGWATGKTFRVGDILEFKYGSSHTVDVVDKAGYDGC 78

Query: 71  ASSNALESHDDGNTRINLKAPGTQYFICPTAGHCP--GGMKLAVTVVAAS 118
            +S++ E+H DG+T+I+LK  G  YFIC T GHC   GGMKLAV VVA S
Sbjct: 79  DASSSTENHSDGDTKIDLKTVGINYFICSTPGHCRTNGGMKLAVNVVAGS 128
Probably acts as an electron carrier involved in oxygen activation and/or lignin formation.
Arabidopsis thaliana (taxid: 3702)
>sp|Q41001|BCP_PEA Blue copper protein OS=Pisum sativum PE=2 SV=1 Back     alignment and function description
>sp|Q07488|BCB1_ARATH Blue copper protein OS=Arabidopsis thaliana GN=BCB PE=1 SV=2 Back     alignment and function description
>sp|P00302|STEL_TOXVR Stellacyanin OS=Toxicodendron vernicifluum PE=1 SV=1 Back     alignment and function description
>sp|Q8LG89|BABL_ARATH Basic blue protein OS=Arabidopsis thaliana GN=ARPN PE=1 SV=2 Back     alignment and function description
>sp|P60496|BABL_LILLO Chemocyanin OS=Lilium longiflorum PE=1 SV=1 Back     alignment and function description
>sp|P80728|MAVI_CUCPE Mavicyanin OS=Cucurbita pepo PE=1 SV=1 Back     alignment and function description
>sp|Q9SK27|ENL1_ARATH Early nodulin-like protein 1 OS=Arabidopsis thaliana GN=At2g25060 PE=1 SV=2 Back     alignment and function description
>sp|Q39131|LAML_ARATH Lamin-like protein OS=Arabidopsis thaliana GN=At5g15350 PE=1 SV=1 Back     alignment and function description
>sp|P00303|BABL_CUCSA Basic blue protein OS=Cucumis sativus PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query175
255633792187 unknown [Glycine max] 0.668 0.625 0.538 3e-34
356504559187 PREDICTED: stellacyanin-like [Glycine ma 0.668 0.625 0.538 3e-34
224137124192 predicted protein [Populus trichocarpa] 0.971 0.885 0.487 4e-33
255545840186 Blue copper protein precursor, putative 0.708 0.666 0.566 4e-33
356520768185 PREDICTED: stellacyanin-like [Glycine ma 0.662 0.627 0.525 5e-33
319433441177 copper binding protein 3 [Gossypium hirs 0.571 0.564 0.66 7e-33
449469831208 PREDICTED: blue copper protein-like [Cuc 0.702 0.591 0.552 2e-32
388510588199 unknown [Medicago truncatula] 0.668 0.587 0.563 4e-32
217071046199 unknown [Medicago truncatula] gi|3885227 0.668 0.587 0.563 4e-32
449436978195 PREDICTED: blue copper protein-like [Cuc 0.742 0.666 0.526 8e-31
>gi|255633792|gb|ACU17256.1| unknown [Glycine max] Back     alignment and taxonomy information
 Score =  150 bits (378), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 63/117 (53%), Positives = 86/117 (73%)

Query: 1   MATALLILLLVAPAVYAVEYTVGDTSGWTQGFDYTSWVSGKTFKVGDVLVFNYGGLHKVD 60
           +A + L+LLL  P V+  ++ VGDTSGW  G +Y +W SGKTF VGD LVF Y   H+VD
Sbjct: 5   IAASFLVLLLAFPTVFGADHEVGDTSGWALGVNYNTWASGKTFAVGDTLVFKYDSTHQVD 64

Query: 61  RVSESDYNNCASSNALESHDDGNTRINLKAPGTQYFICPTAGHCPGGMKLAVTVVAA 117
            V ES YN+C+SSN+++++ DGN++I L +PG +YF+CP +GHC GGMKL + V AA
Sbjct: 65  EVDESGYNSCSSSNSIKNYQDGNSKIELTSPGKRYFLCPISGHCAGGMKLQINVAAA 121

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356504559|ref|XP_003521063.1| PREDICTED: stellacyanin-like [Glycine max] Back     alignment and taxonomy information
>gi|224137124|ref|XP_002327030.1| predicted protein [Populus trichocarpa] gi|222835345|gb|EEE73780.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255545840|ref|XP_002513980.1| Blue copper protein precursor, putative [Ricinus communis] gi|223547066|gb|EEF48563.1| Blue copper protein precursor, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356520768|ref|XP_003529032.1| PREDICTED: stellacyanin-like [Glycine max] Back     alignment and taxonomy information
>gi|319433441|gb|ADV57638.1| copper binding protein 3 [Gossypium hirsutum] Back     alignment and taxonomy information
>gi|449469831|ref|XP_004152622.1| PREDICTED: blue copper protein-like [Cucumis sativus] gi|449503905|ref|XP_004162222.1| PREDICTED: blue copper protein-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|388510588|gb|AFK43360.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|217071046|gb|ACJ83883.1| unknown [Medicago truncatula] gi|388522709|gb|AFK49416.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|449436978|ref|XP_004136269.1| PREDICTED: blue copper protein-like [Cucumis sativus] gi|449530626|ref|XP_004172295.1| PREDICTED: blue copper protein-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query175
TAIR|locus:2081957222 UCC3 "uclacyanin 3" [Arabidops 0.554 0.436 0.546 5.2e-26
TAIR|locus:2042426202 UCC2 "uclacyanin 2" [Arabidops 0.525 0.455 0.553 4.6e-25
TAIR|locus:2081952187 AT3G60270 [Arabidopsis thalian 0.554 0.518 0.525 6.8e-24
TAIR|locus:2206986181 AT1G72230 [Arabidopsis thalian 0.508 0.491 0.573 8.7e-24
TAIR|locus:2009552174 AT1G22480 [Arabidopsis thalian 0.525 0.528 0.532 1e-22
TAIR|locus:504956334192 AT5G07475 [Arabidopsis thalian 0.542 0.494 0.442 5.7e-20
TAIR|locus:2086518174 AT3G27200 [Arabidopsis thalian 0.554 0.557 0.428 6.5e-19
TAIR|locus:2062525261 UCC1 "uclacyanin 1" [Arabidops 0.554 0.371 0.428 1.1e-18
TAIR|locus:2043833206 AT2G26720 [Arabidopsis thalian 0.548 0.466 0.438 2.2e-18
TAIR|locus:2149249196 BCB "blue-copper-binding prote 0.56 0.5 0.431 1.6e-17
TAIR|locus:2081957 UCC3 "uclacyanin 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 294 (108.6 bits), Expect = 5.2e-26, P = 5.2e-26
 Identities = 53/97 (54%), Positives = 68/97 (70%)

Query:    20 YTVGDTSGWTQGFDYTSWVSGKTFKVGDVLVFNYGGLHKVDRVSESDYNNCASSNALESH 79
             + VGD SGWT   DYT W++GKTF+VGD L F YG  H V  V ++ Y+NC SS A ++ 
Sbjct:    24 FKVGDISGWTSNLDYTVWLTGKTFRVGDTLEFVYGLSHSVSVVDKAGYDNCDSSGATQNF 83

Query:    80 DDGNTRINLKAPGTQYFICPTAGHCPGGMKLAVTVVA 116
              DG+T+I+L   GT +F+CPT GHC  GMKLAV V+A
Sbjct:    84 ADGDTKIDLTTVGTMHFLCPTFGHCKNGMKLAVPVLA 120
GO:0005507 "copper ion binding" evidence=IEA;ISS
GO:0005886 "plasma membrane" evidence=ISM
GO:0009055 "electron carrier activity" evidence=IEA
GO:0031225 "anchored to membrane" evidence=TAS
TAIR|locus:2042426 UCC2 "uclacyanin 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2081952 AT3G60270 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2206986 AT1G72230 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2009552 AT1G22480 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504956334 AT5G07475 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2086518 AT3G27200 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2062525 UCC1 "uclacyanin 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2043833 AT2G26720 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2149249 BCB "blue-copper-binding protein" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query175
pfam0229884 pfam02298, Cu_bind_like, Plastocyanin-like domain 3e-32
PLN03148167 PLN03148, PLN03148, Blue copper-like protein; Prov 3e-17
>gnl|CDD|216965 pfam02298, Cu_bind_like, Plastocyanin-like domain Back     alignment and domain information 
 Score =  110 bits (277), Expect = 3e-32
 Identities = 42/84 (50%), Positives = 51/84 (60%), Gaps = 3/84 (3%)

Query: 28  WT--QGFDYTSWVSGKTFKVGDVLVFNYG-GLHKVDRVSESDYNNCASSNALESHDDGNT 84
           WT     DYT W SGKTF+VGD LVFNY  G H V  V+++DY +C +S  + ++  GN 
Sbjct: 1   WTVPLNADYTLWASGKTFRVGDTLVFNYDKGFHNVVEVTKADYESCNTSKPIRTYTTGND 60

Query: 85  RINLKAPGTQYFICPTAGHCPGGM 108
            I L  PG  YFIC   GHC GG 
Sbjct: 61  IIPLTKPGQHYFICGVPGHCKGGQ 84

This family represents a domain found in flowering plants related to the copper binding protein plastocyanin. Some members of this family may not bind copper due to the lack of key residues. Length = 84
>gnl|CDD|178693 PLN03148, PLN03148, Blue copper-like protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 175
PLN03148167 Blue copper-like protein; Provisional 100.0
PF0229885 Cu_bind_like: Plastocyanin-like domain; InterPro: 99.97
PRK02710119 plastocyanin; Provisional 98.55
TIGR0265699 cyanin_plasto plastocyanin. Members of this family 98.47
PF0012799 Copper-bind: Copper binding proteins, plastocyanin 98.31
TIGR03102115 halo_cynanin halocyanin domain. Halocyanins are bl 98.21
TIGR02375116 pseudoazurin pseudoazurin. Pseudoazurin, also call 98.04
COG3794128 PetE Plastocyanin [Energy production and conversio 97.97
TIGR0265783 amicyanin amicyanin. Members of this family are am 97.3
TIGR03095148 rusti_cyanin rusticyanin. Rusticyanin is a blue co 96.96
KOG3858233 consensus Ephrin, ligand for Eph receptor tyrosine 96.79
PF06525196 SoxE: Sulfocyanin (SoxE); InterPro: IPR010532 Memb 96.6
PF00812145 Ephrin: Ephrin; InterPro: IPR001799 Ephrins are a 96.33
TIGR03094195 sulfo_cyanin sulfocyanin. Members of this family a 94.52
TIGR03096135 nitroso_cyanin nitrosocyanin. Nitrosocyanin, as de 94.13
COG4454158 Uncharacterized copper-binding protein [Inorganic 92.58
PF13473104 Cupredoxin_1: Cupredoxin-like domain; PDB: 1IBZ_D 91.33
PRK02888635 nitrous-oxide reductase; Validated 88.0
TIGR02866201 CoxB cytochrome c oxidase, subunit II. Cytochrome 85.68
TIGR02376 311 Cu_nitrite_red nitrite reductase, copper-containin 85.14
PF00116120 COX2: Cytochrome C oxidase subunit II, periplasmic 85.1
PF07732117 Cu-oxidase_3: Multicopper oxidase; InterPro: IPR01 84.18
COG1622247 CyoA Heme/copper-type cytochrome/quinol oxidases, 81.11
>PLN03148 Blue copper-like protein; Provisional Back     alignment and domain information 
Probab=100.00  E-value=1.2e-42  Score=279.15  Aligned_cols=108  Identities=35%  Similarity=0.683  Sum_probs=101.6

Q ss_pred             HHHhhccccceEEEecCCCCCcCCCCcccccCCCceEeCCEEEEEECCC-CeEEEeCcccCCCCCCCCCCCCCCCCCcEE
Q 030594            8 LLLVAPAVYAVEYTVGDTSGWTQGFDYTSWVSGKTFKVGDVLVFNYGGL-HKVDRVSESDYNNCASSNALESHDDGNTRI   86 (175)
Q Consensus         8 ~~~l~~~a~a~~~~VGg~~GWt~~~~Y~~Wa~~~~F~vGDsLvF~y~~~-HsV~~V~~~~Y~~C~~~~~~~~~s~G~~~v   86 (175)
                      ++++...+.+++|+|||+.||+...||++|+++++|++||+|+|+|+++ |+|+||++++|++|+.++++..+++|++.|
T Consensus        11 ~~~~~~~~~a~~~~VGd~~GW~~~~~Y~~WA~~k~F~VGD~LvF~Y~~~~hnV~~V~~~~Y~~C~~~~pi~~~tsG~d~v   90 (167)
T PLN03148         11 ALFSASATTATDHIVGANKGWNPGINYTLWANNQTFYVGDLISFRYQKTQYNVFEVNQTGYDNCTTEGAAGNWTSGKDFI   90 (167)
T ss_pred             HHHhhhhccceEEEeCCCCCcCCCCChhHhhcCCCCccCCEEEEEecCCCceEEEEChHHcCcccCCCCcceecCCCcEE
Confidence            3345567889999999999999888999999999999999999999999 999999999999999999999999999999


Q ss_pred             EecCCccEEEEcCCCCCCCCCCeEEEEeec
Q 030594           87 NLKAPGTQYFICPTAGHCPGGMKLAVTVVA  116 (175)
Q Consensus        87 ~l~~~G~~YFiC~v~~HC~~GmKl~I~V~~  116 (175)
                      +|+++|+|||||+ .+||++||||.|+|.+
T Consensus        91 ~L~~~G~~YFIcg-~ghC~~GmKl~I~V~~  119 (167)
T PLN03148         91 PLNKAKRYYFICG-NGQCFNGMKVTILVHP  119 (167)
T ss_pred             EecCCccEEEEcC-CCccccCCEEEEEEcC
Confidence            9999999999999 5899999999999964

>PF02298 Cu_bind_like: Plastocyanin-like domain; InterPro: IPR003245 Blue (type 1) copper proteins are small proteins which bind a single copper atom and which are characterised by an intense electronic absorption band near 600 nm [, ] Back     alignment and domain information
>PRK02710 plastocyanin; Provisional Back     alignment and domain information
>TIGR02656 cyanin_plasto plastocyanin Back     alignment and domain information
>PF00127 Copper-bind: Copper binding proteins, plastocyanin/azurin family; InterPro: IPR000923 Blue (type 1) copper proteins are small proteins which bind a single copper atom and which are characterised by an intense electronic absorption band near 600 nm [, ] Back     alignment and domain information
>TIGR03102 halo_cynanin halocyanin domain Back     alignment and domain information
>TIGR02375 pseudoazurin pseudoazurin Back     alignment and domain information
>COG3794 PetE Plastocyanin [Energy production and conversion] Back     alignment and domain information
>TIGR02657 amicyanin amicyanin Back     alignment and domain information
>TIGR03095 rusti_cyanin rusticyanin Back     alignment and domain information
>KOG3858 consensus Ephrin, ligand for Eph receptor tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF06525 SoxE: Sulfocyanin (SoxE); InterPro: IPR010532 Members of this family are blue-copper redox proteins designated sulfocyanin, from the archaeal genera Sulfolobus, Ferroplasma, and Picrophilus Back     alignment and domain information
>PF00812 Ephrin: Ephrin; InterPro: IPR001799 Ephrins are a family of proteins [] that are ligands of class V (EPH-related) receptor protein-tyrosine kinases (see IPR001426 from INTERPRO) Back     alignment and domain information
>TIGR03094 sulfo_cyanin sulfocyanin Back     alignment and domain information
>TIGR03096 nitroso_cyanin nitrosocyanin Back     alignment and domain information
>COG4454 Uncharacterized copper-binding protein [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF13473 Cupredoxin_1: Cupredoxin-like domain; PDB: 1IBZ_D 1IC0_E 1IBY_D Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>TIGR02866 CoxB cytochrome c oxidase, subunit II Back     alignment and domain information
>TIGR02376 Cu_nitrite_red nitrite reductase, copper-containing Back     alignment and domain information
>PF00116 COX2: Cytochrome C oxidase subunit II, periplasmic domain This family corresponds to chains b and o Back     alignment and domain information
>PF07732 Cu-oxidase_3: Multicopper oxidase; InterPro: IPR011707 Copper is one of the most prevalent transition metals in living organisms and its biological function is intimately related to its redox properties Back     alignment and domain information
>COG1622 CyoA Heme/copper-type cytochrome/quinol oxidases, subunit 2 [Energy production and conversion] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query175
1ws7_A109 Crystal Structure Of Mavicyanin From Cucurbita Pepo 4e-16
2cbp_A96 Cucumber Basic Protein, A Blue Copper Protein Lengt 1e-13
1x9r_A116 Umecyanin From Horse Raddish- Crystal Structure Of 1e-13
1f56_A91 Spinach Plantacyanin Length = 91 4e-11
1jer_A138 Cucumber Stellacyanin, Cu2+, Ph 7.0 Length = 138 2e-09
>pdb|1WS7|A Chain A, Crystal Structure Of Mavicyanin From Cucurbita Pepo Medullosa (Zucchini) Length = 109 Back     alignment and structure 
Iteration: 1

 Score = 80.5 bits (197), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 41/98 (41%), Positives = 55/98 (56%), Gaps = 3/98 (3%)
Query: 20  YTVGDTSGWTQ--GFDYTSWVSGKTFKVGDVLVFNYGG-LHKVDRVSESDYNNCASSNAL 76
           + VGD++GWT    +DY  W S   F VGD L+FNY    H V +V +  + +C SS+  
Sbjct: 5   HKVGDSTGWTTLVPYDYAKWASSNKFHVGDSLLFNYNNKFHNVLQVDQEQFKSCNSSSPA 64
Query: 77  ESHDDGNTRINLKAPGTQYFICPTAGHCPGGMKLAVTV 114
            S+  G   I LK PGT YF+C   GHC  G K+ + V
Sbjct: 65  ASYTSGADSIPLKRPGTFYFLCGIPGHCQLGQKVEIKV 102
>pdb|2CBP|A Chain A, Cucumber Basic Protein, A Blue Copper Protein Length = 96 Back     alignment and structure
>pdb|1X9R|A Chain A, Umecyanin From Horse Raddish- Crystal Structure Of The Oxidised Form Length = 116 Back     alignment and structure
>pdb|1F56|A Chain A, Spinach Plantacyanin Length = 91 Back     alignment and structure
>pdb|1JER|A Chain A, Cucumber Stellacyanin, Cu2+, Ph 7.0 Length = 138 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query175
1ws8_A109 Mavicyanin; oxidized form, phytocyanin, cupredoxin 5e-39
1x9u_A116 Umecyanin; cupredoxin, phytocyanin, copper binding 4e-38
2cbp_A96 Cucumber basic protein; electron transport, phytoc 1e-35
1jer_A138 Cucumber stellacyanin; electron transport, copper, 4e-35
1f56_A91 Plantacyanin; cupredoxin, copper protein, beta bar 3e-33
>1ws8_A Mavicyanin; oxidized form, phytocyanin, cupredoxin, electron transport; 1.60A {Cucurbita pepo} SCOP: b.6.1.1 PDB: 1ws7_A Length = 109 Back     alignment and structure
 Score =  127 bits (321), Expect = 5e-39
 Identities = 43/108 (39%), Positives = 57/108 (52%), Gaps = 3/108 (2%)

Query: 17  AVEYTVGDTSGWTQG--FDYTSWVSGKTFKVGDVLVFNY-GGLHKVDRVSESDYNNCASS 73
           A  + VGD++GWT    +DY  W S   F VGD L+FNY    H V +V +  + +C SS
Sbjct: 2   ATVHKVGDSTGWTTLVPYDYAKWASSNKFHVGDSLLFNYNNKFHNVLQVDQEQFKSCNSS 61

Query: 74  NALESHDDGNTRINLKAPGTQYFICPTAGHCPGGMKLAVTVVAASPPG 121
           +   S+  G   I LK PGT YF+C   GHC  G K+ + V   S   
Sbjct: 62  SPAASYTSGADSIPLKRPGTFYFLCGIPGHCQLGQKVEIKVDPGSSSA 109
>1x9u_A Umecyanin; cupredoxin, phytocyanin, copper binding site, beta barrel, electron transport; 1.80A {Armoracia rusticana} PDB: 1x9r_A Length = 116 Back     alignment and structure
>2cbp_A Cucumber basic protein; electron transport, phytocyanin, type 1 copper protein; 1.80A {Cucumis sativus} SCOP: b.6.1.1 Length = 96 Back     alignment and structure
>1jer_A Cucumber stellacyanin; electron transport, copper, glycoprotein, hydroxylation; 1.60A {Cucumis sativus} SCOP: b.6.1.1 Length = 138 Back     alignment and structure
>1f56_A Plantacyanin; cupredoxin, copper protein, beta barrel, plant protein; 2.05A {Spinacia oleracea} SCOP: b.6.1.1 Length = 91 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query175
1jer_A138 Cucumber stellacyanin; electron transport, copper, 100.0
1ws8_A109 Mavicyanin; oxidized form, phytocyanin, cupredoxin 100.0
1x9u_A116 Umecyanin; cupredoxin, phytocyanin, copper binding 100.0
2cbp_A96 Cucumber basic protein; electron transport, phytoc 100.0
1f56_A91 Plantacyanin; cupredoxin, copper protein, beta bar 100.0
1qhq_A140 Protein (auracyanin); electron transfer, cupredoxi 99.31
1bxv_A91 Plastocyanin; copper protein, electron transfer; 1 99.21
2cal_A154 Rusticyanin; iron respiratory electron transport c 99.1
1pmy_A123 Pseudoazurin; electron transfer(cuproprotein); 1.5 98.96
2gim_A106 Plastocyanin; beta sheet, Cu, helix, electron tran 98.96
1paz_A123 Pseudoazurin precursor; electron transfer(cupropro 98.94
1iuz_A98 Plastocyanin; electron transport; 1.60A {Ulva pert 98.92
1plc_A99 Plastocyanin; electron transport; 1.33A {Populus n 98.92
2aan_A139 Auracyanin A; cupredoxin fold, electron transport; 98.86
1kdj_A102 Plastocyanin; electron transfer, photosystem, PAI- 98.85
3erx_A123 Pseudoazurin; copper protein, high-resolution, E t 98.84
1b3i_A97 PETE protein, protein (plastocyanin); electron tra 98.84
1byp_A99 Protein (plastocyanin); electron transfer, photosy 98.81
3tu6_A127 Pseudoazurin (blue copper protein); cupredoxins, b 98.81
3ef4_A124 Pseudoazurin, blue copper protein; electron transf 98.75
2plt_A98 Plastocyanin; electron transport; 1.50A {Chlamydom 98.74
1pcs_A98 Plastocyanin; electron transport; 2.15A {Synechocy 98.67
3cvb_A105 Plastocyanin; cupredoxin, SELF assembly, copper, e 98.29
2ux6_A122 Pseudoazurin; type-1 copper, metal-binding, redox 98.15
3c75_A132 Amicyanin; copper proteins, electron transfer comp 98.14
4hci_A100 Cupredoxin 1; structural genomics, niaid, national 98.08
2ov0_A105 Amicyanin; beta-sandwich, electron transport; 0.75 98.07
1id2_A106 Amicyanin; beta barrel, type-1 blue copper protein 97.93
3ay2_A167 Lipid modified azurin protein; beta sandwich, bact 97.93
1cuo_A129 Protein (azurin ISO-2); beta barrel, periplasmic, 97.89
1iko_P178 Ephrin-B2; greek KEY, glycosylation, signaling pro 97.77
2iaa_C128 Azurin; quinoprotein, tryptophan tryptophylquinone 97.58
1nwp_A128 Azurin; electron transport, cupredoxin, electron t 97.55
2ccw_A129 Azurin II, AZN-2; electron transport (cuproprotein 97.54
2cua_A135 Protein (CUA); CUA center, electron transport; 1.6 97.29
1iby_A112 Nitrosocyanin; RED copper, cupredoxin, beta hairpi 97.18
3czu_B182 Ephrin-A1; ATP-binding, kinase, nucleotide-binding 97.06
3d12_B141 Ephrin-B3; beta propeller, protein-receptor comple 96.91
1shx_A138 Ephrin-A5; ephrin signaling, hormone-growth factor 96.85
2x11_B177 Ephrin-A5; receptor-signaling protein complex, dev 96.83
2vsm_B140 Ephrin-B2; developmental protein, henipavirus, neu 96.68
2wo3_B157 Ephrin-A2; transferase-signaling protein complex, 95.97
2dv6_A 447 Nitrite reductase; electron transfer, reduction, d 95.25
3s8f_B168 Cytochrome C oxidase subunit 2; complex IV, respir 95.24
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 94.18
3sbq_A638 Nitrous-oxide reductase; beta-propeller, cupredoxi 94.03
3hei_B132 Ephrin-A1; EPH receptor tyrosine kinase, cell memb 93.74
3fsa_A125 Azurin; copper, cupredoxin fold, metal-binding, pr 93.47
1oe1_A 336 Dissimilatory copper-containing nitrite reductase; 83.39
1mzy_A 333 Copper-containing nitrite reductase; mutant M182T, 83.26
>1jer_A Cucumber stellacyanin; electron transport, copper, glycoprotein, hydroxylation; 1.60A {Cucumis sativus} SCOP: b.6.1.1 Back     alignment and structure
Probab=100.00  E-value=1.8e-43  Score=275.48  Aligned_cols=105  Identities=33%  Similarity=0.681  Sum_probs=99.6

Q ss_pred             cceEEEecCCCCCcCC---CCcccccCCCceEeCCEEEEEECCC-CeEEEe-CcccCCCCCCCCCCCCCCCCCcEEEe-c
Q 030594           16 YAVEYTVGDTSGWTQG---FDYTSWVSGKTFKVGDVLVFNYGGL-HKVDRV-SESDYNNCASSNALESHDDGNTRINL-K   89 (175)
Q Consensus        16 ~a~~~~VGg~~GWt~~---~~Y~~Wa~~~~F~vGDsLvF~y~~~-HsV~~V-~~~~Y~~C~~~~~~~~~s~G~~~v~l-~   89 (175)
                      +|++|+|||+.||+++   .||++||++++|+|||+|+|+|..+ |+|+|| ++++|+.|+..+++..+++|+++|+| +
T Consensus         2 ~a~~~~VGg~~GW~~~~~~~~Y~~Wa~~~~F~vGD~LvF~y~~~~HsV~~V~~~~~y~~C~~s~p~~~~~~G~~~v~L~~   81 (138)
T 1jer_A            2 QSTVHIVGDNTGWSVPSSPNFYSQWAAGKTFRVGDSLQFNFPANAHNVHEMETKQSFDACNFVNSDNDVERTSPVIERLD   81 (138)
T ss_dssp             CCCEEETTGGGCSSCCSSTTHHHHHHHTCCEETTCEEEECCCTTTCCCEEESCHHHHHHTCCTTSCCCCCCCSCEEEECC
T ss_pred             CceEEEECCcCcCcCCCCccchhhhhcCCcCcCCCEEEEeecCCCceEEEeCchhhcCccCCCCccccccCCCeEEEecc
Confidence            5789999999999999   6899999999999999999999988 999999 99999999999999999999999999 9


Q ss_pred             CCccEEEEcCCCCCCCCCCeEEEEeecCCCC
Q 030594           90 APGTQYFICPTAGHCPGGMKLAVTVVAASPP  120 (175)
Q Consensus        90 ~~G~~YFiC~v~~HC~~GmKl~I~V~~~~~~  120 (175)
                      ++|++||||++++||++||||+|+|.+..++
T Consensus        82 ~~G~~YFicg~~gHC~~GmKl~I~V~~~~~~  112 (138)
T 1jer_A           82 ELGMHYFVCTVGTHCSNGQKLSINVVAANAT  112 (138)
T ss_dssp             SSEEEEEECCSTTTGGGTCEEEEEEECCC--
T ss_pred             CCcCEEEEcCCCCccccCCEEEEEEcCCCCC
Confidence            9999999999999999999999999988765
>1ws8_A Mavicyanin; oxidized form, phytocyanin, cupredoxin, electron transport; 1.60A {Cucurbita pepo} SCOP: b.6.1.1 PDB: 1ws7_A Back     alignment and structure
>1x9u_A Umecyanin; cupredoxin, phytocyanin, copper binding site, beta barrel, electron transport; 1.80A {Armoracia rusticana} PDB: 1x9r_A Back     alignment and structure
>2cbp_A Cucumber basic protein; electron transport, phytocyanin, type 1 copper protein; 1.80A {Cucumis sativus} SCOP: b.6.1.1 Back     alignment and structure
>1f56_A Plantacyanin; cupredoxin, copper protein, beta barrel, plant protein; 2.05A {Spinacia oleracea} SCOP: b.6.1.1 Back     alignment and structure
>1qhq_A Protein (auracyanin); electron transfer, cupredoxin, blue copper protein, azurin-L thermophIle; 1.55A {Chloroflexus aurantiacus} SCOP: b.6.1.1 PDB: 1ov8_A Back     alignment and structure
>1bxv_A Plastocyanin; copper protein, electron transfer; 1.80A {Synechococcus elongatus} SCOP: b.6.1.1 PDB: 1bxu_A Back     alignment and structure
>2cal_A Rusticyanin; iron respiratory electron transport chain, blue protein, electron transport, metal- binding, periplasmic; 1.10A {Thiobacillus ferrooxidans} PDB: 1cur_A 1gy2_A 1a3z_A 1e30_A 1gy1_A 1rcy_A 1a8z_A 2cak_A Back     alignment and structure
>1pmy_A Pseudoazurin; electron transfer(cuproprotein); 1.50A {Methylobacterium extorquens} SCOP: b.6.1.1 Back     alignment and structure
>2gim_A Plastocyanin; beta sheet, Cu, helix, electron transport; 1.60A {Anabaena variabilis} SCOP: b.6.1.1 PDB: 1fa4_A 1nin_A 1tu2_A* 2cj3_A Back     alignment and structure
>1paz_A Pseudoazurin precursor; electron transfer(cuproprotein); 1.55A {Alcaligenes faecalis} SCOP: b.6.1.1 PDB: 1pza_A 1pzb_A 1pzc_A 2p80_D 3nyk_A 3paz_A 8paz_A 4paz_A 5paz_A 6paz_A 7paz_A 1py0_A* Back     alignment and structure
>1iuz_A Plastocyanin; electron transport; 1.60A {Ulva pertusa} SCOP: b.6.1.1 PDB: 7pcy_A Back     alignment and structure
>1plc_A Plastocyanin; electron transport; 1.33A {Populus nigra} SCOP: b.6.1.1 PDB: 1pnc_A 1pnd_A 1tkw_A* 2pcy_A 3pcy_A 4pcy_A 5pcy_A 6pcy_A 1jxg_A 1ag6_A 1ylb_B 2pcf_A* 1oow_A 1tef_A 9pcy_A 1teg_A 1byo_A Back     alignment and structure
>2aan_A Auracyanin A; cupredoxin fold, electron transport; 1.85A {Chloroflexus aurantiacus} Back     alignment and structure
>1kdj_A Plastocyanin; electron transfer, photosystem, PAI-PAI stacking; 1.70A {Adiantum capillus-veneris} SCOP: b.6.1.1 PDB: 1kdi_A 2bz7_A 2bzc_A Back     alignment and structure
>3erx_A Pseudoazurin; copper protein, high-resolution, E transport, metal-binding, transport; 1.25A {Paracoccus pantotrophus} SCOP: b.6.1.1 PDB: 1adw_A Back     alignment and structure
>1b3i_A PETE protein, protein (plastocyanin); electron transport, type I copper protein, photosynthesis; NMR {Prochlorothrix hollandica} SCOP: b.6.1.1 PDB: 2b3i_A 2jxm_A* Back     alignment and structure
>1byp_A Protein (plastocyanin); electron transfer, photosynthesis, acidic patch, double mutant, electron transport; 1.75A {Silene latifolia subsp} SCOP: b.6.1.1 PDB: 1pla_A 1plb_A Back     alignment and structure
>3tu6_A Pseudoazurin (blue copper protein); cupredoxins, beta barrel, electron transfer, redox, electron transport; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>3ef4_A Pseudoazurin, blue copper protein; electron transfer, electron transport; HET: PO4; 1.18A {Hyphomicrobium denitrificans} SCOP: b.6.1.0 Back     alignment and structure
>2plt_A Plastocyanin; electron transport; 1.50A {Chlamydomonas reinhardtii} SCOP: b.6.1.1 Back     alignment and structure
>1pcs_A Plastocyanin; electron transport; 2.15A {Synechocystis SP} SCOP: b.6.1.1 PDB: 1m9w_A 1j5c_A 1j5d_A 1jxd_A 1jxf_A Back     alignment and structure
>3cvb_A Plastocyanin; cupredoxin, SELF assembly, copper, electron transport, metal-binding, transport; 1.40A {Phormidium laminosum} PDB: 3cvc_A 3cvd_A 2w8c_A 2w88_A 2q5b_A 1baw_A 3bqv_A Back     alignment and structure
>2ux6_A Pseudoazurin; type-1 copper, metal-binding, redox potential, copper, transport, cupredoxin, periplasmic, electron transport; 1.3A {Achromobacter cycloclastes} PDB: 2ux7_A 2uxf_A 2uxg_A 1bqk_A 1bqr_A 1zia_A 1zib_A 2jkw_A Back     alignment and structure
>3c75_A Amicyanin; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>4hci_A Cupredoxin 1; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.63A {Bacillus anthracis} PDB: 4hcg_A 4hcf_A Back     alignment and structure
>2ov0_A Amicyanin; beta-sandwich, electron transport; 0.75A {Paracoccus denitrificans} SCOP: b.6.1.1 PDB: 1aaj_A 1aan_A 1aac_A 1mg2_C* 1mg3_C* 1t5k_A 2gc4_C* 2gc7_C* 2j55_A* 2j56_A* 2j57_A* 2mta_A* 1bxa_A 2rac_A 3l45_A 3ie9_A 3iea_A 2idq_A 2ids_A 1sf3_A ... Back     alignment and structure
>1id2_A Amicyanin; beta barrel, type-1 blue copper protein, electron transfer protein, electron transport; 2.15A {Paracoccus versutus} SCOP: b.6.1.1 Back     alignment and structure
>3ay2_A Lipid modified azurin protein; beta sandwich, bacterial protein, anticancer, anti-HIV/AIDS, antiparasitic activity, antitumor protein; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>1cuo_A Protein (azurin ISO-2); beta barrel, periplasmic, electron transport; 1.60A {Methylomonas SP} SCOP: b.6.1.1 PDB: 1uat_A Back     alignment and structure
>1iko_P Ephrin-B2; greek KEY, glycosylation, signaling protein; HET: NAG MAN; 1.92A {Mus musculus} SCOP: b.6.1.5 Back     alignment and structure
>2iaa_C Azurin; quinoprotein, tryptophan tryptophylquinone, cupredoxin, electron transfer, oxidoreductase/electron transport comple; HET: TRQ; 1.95A {Alcaligenes faecalis} PDB: 2h47_C* 2h3x_C* Back     alignment and structure
>1nwp_A Azurin; electron transport, cupredoxin, electron transfer; 1.60A {Pseudomonas putida} SCOP: b.6.1.1 PDB: 1nwo_A 1joi_A Back     alignment and structure
>2ccw_A Azurin II, AZN-2; electron transport (cuproprotein), alcaligenes xylosoxidans, electron transfer, cupredoxin, electron transport; 1.13A {Alcaligenes xylosoxydans} SCOP: b.6.1.1 PDB: 1dz0_A 1dyz_A 1aiz_A 1azb_A 1azc_A 1uri_A 2aza_A 1a4a_A 1a4b_A 1a4c_A Back     alignment and structure
>2cua_A Protein (CUA); CUA center, electron transport; 1.60A {Thermus thermophilus} SCOP: b.6.1.2 PDB: 2fwl_B* Back     alignment and structure
>1iby_A Nitrosocyanin; RED copper, cupredoxin, beta hairpin, metal binding protein; 1.65A {Nitrosomonas europaea} SCOP: b.6.1.4 PDB: 1ibz_A 1ic0_A Back     alignment and structure
>3czu_B Ephrin-A1; ATP-binding, kinase, nucleotide-binding, receptor, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG MAN; 2.65A {Homo sapiens} PDB: 3mbw_B* Back     alignment and structure
>3d12_B Ephrin-B3; beta propeller, protein-receptor complex, envelope protein, glycoprotein, hemagglutinin, hydrolase, membrane, signal-AN transmembrane; HET: NAG BMA MAN BGC LXZ NGA GL0 GLC LXB NGZ GXL; 3.00A {Mus musculus} Back     alignment and structure
>1shx_A Ephrin-A5; ephrin signaling, hormone-growth factor complex; HET: NAG; 2.10A {Mus musculus} SCOP: b.6.1.5 PDB: 1shw_A* 3mx0_B* Back     alignment and structure
>2x11_B Ephrin-A5; receptor-signaling protein complex, developmental protein, signaling platform, kinase, transferase, neurogenesis, receptor, cataract; 4.83A {Homo sapiens} Back     alignment and structure
>2vsm_B Ephrin-B2; developmental protein, henipavirus, neurogenesis, glycoprotein, paramyxovirus, envelope protein, cell surface receptor, hendra, virion; HET: NAG; 1.80A {Homo sapiens} PDB: 2wo2_B* 2i85_A 3gxu_B 2vsk_B 2hle_B 1kgy_E Back     alignment and structure
>2wo3_B Ephrin-A2; transferase-signaling protein complex, EFN, EPHA4, KINA ephrin, complex, membrane, cell surface receptor, tyrosine- kinase, glycoprotein; HET: NAG; 2.35A {Homo sapiens} Back     alignment and structure
>2dv6_A Nitrite reductase; electron transfer, reduction, denitrification, oxidoreductase; 2.20A {Hyphomicrobium denitrificans} Back     alignment and structure
>3s8f_B Cytochrome C oxidase subunit 2; complex IV, respiratory chain, lipid cubic phase, monoolein, peroxide, electron transport, proton pump; HET: HEM HAS OLC; 1.80A {Thermus thermophilus} PDB: 1ehk_B* 2qpd_B* 3qjq_B* 3qjr_B* 3qju_B* 3qjv_B* 1xme_B* 3s8g_B* 4esl_B* 4ev3_B* 4f05_B* 4fa7_B* 4faa_B* 3qjs_B* 3bvd_B* 2qpe_B* 3qjt_B* 3s3b_B* 3s33_B* 3s39_B* ... Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>3sbq_A Nitrous-oxide reductase; beta-propeller, cupredoxin domain, copper-contain periplasmic, oxidoreductase; 1.70A {Pseudomonas stutzeri} PDB: 3sbp_A 3sbr_A 1qni_A Back     alignment and structure
>3hei_B Ephrin-A1; EPH receptor tyrosine kinase, cell membrane, disulfi glycoprotein, GPI-anchor, lipoprotein, membrane, ATP-bindin kinase; 2.00A {Homo sapiens} SCOP: b.6.1.0 Back     alignment and structure
>3fsa_A Azurin; copper, cupredoxin fold, metal-binding, protein-protein interaction, metal binding protein; 0.98A {Pseudomonas aeruginosa} SCOP: b.6.1.1 PDB: 2xv2_A 2xv0_A 3fs9_A 2fta_A* 2hx7_A 2hx8_A 2hx9_A 2hxa_A 1cc3_A 2ft6_A 2ft7_A 2ft8_A 1azn_A 3n2j_A 2iwe_A 2ghz_A 2gi0_A 1jzg_A* 1azu_A* 1bex_A ... Back     alignment and structure
>1oe1_A Dissimilatory copper-containing nitrite reductase; denitrification; HET: PG4; 1.04A {Alcaligenes xylosoxidans} SCOP: b.6.1.3 b.6.1.3 PDB: 1oe3_A* 2xwz_A* 2vn3_A 2zon_A* 1haw_A 1hau_A* 2vm4_A* 2vw4_A* 2vw6_A* 2vw7_A* 2vm3_A* 1oe2_A* 2jl0_A* 2xx1_A 2xxg_A* 2xxf_A* 1gs8_A 1wa1_X* 1wa2_X* 2jl3_A* ... Back     alignment and structure
>1mzy_A Copper-containing nitrite reductase; mutant M182T, gating mechanism, electron oxidoreductase; 1.46A {Rhodobacter sphaeroides} SCOP: b.6.1.3 b.6.1.3 PDB: 1mzz_A 1n70_A 1zv2_A 2a3t_A 2dws_A 2dwt_A 2dy2_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 175
d2cbpa_96 b.6.1.1 (A:) Plantacyanin {Cucumber (Cucumis sativ 2e-36
d1ws8a_104 b.6.1.1 (A:) Mavicyanin {Zucchini (Cucurbita pepo) 8e-35
d1jera_110 b.6.1.1 (A:) Stellacyanin {Cucumber (Cucumis sativ 2e-30
d1f56a_91 b.6.1.1 (A:) Plantacyanin {Spinach (Spinacia olera 9e-30
>d2cbpa_ b.6.1.1 (A:) Plantacyanin {Cucumber (Cucumis sativus) [TaxId: 3659]} Length = 96 Back     information, alignment and structure

class: All beta proteins
fold: Cupredoxin-like
superfamily: Cupredoxins
family: Plastocyanin/azurin-like
domain: Plantacyanin
species: Cucumber (Cucumis sativus) [TaxId: 3659]

 Score =  119 bits (300), Expect = 2e-36
 Identities = 38/97 (39%), Positives = 54/97 (55%), Gaps = 4/97 (4%)

Query: 20  YTVGDTSGWTQGFDYTSWVSGKTFKVGDVLVFNYG-GLHKVDRVSESDYNNCASSNALES 78
           Y VG + GWT  F+  SW  GK F+ GD+L+FNY   +H V  V++  ++ C +    + 
Sbjct: 3   YVVGGSGGWT--FNTESWPKGKRFRAGDILLFNYNPSMHNVVVVNQGGFSTCNTPAGAKV 60

Query: 79  HDDGNTRINLKAPGTQYFICPTAGHCPGGMKLAVTVV 115
           +  G  +I L   G  YFIC   GHC  GMK+AV  +
Sbjct: 61  YTSGRDQIKLP-KGQSYFICNFPGHCQSGMKIAVNAL 96
>d1ws8a_ b.6.1.1 (A:) Mavicyanin {Zucchini (Cucurbita pepo) [TaxId: 3663]} Length = 104 Back     information, alignment and structure
>d1jera_ b.6.1.1 (A:) Stellacyanin {Cucumber (Cucumis sativus) [TaxId: 3659]} Length = 110 Back     information, alignment and structure
>d1f56a_ b.6.1.1 (A:) Plantacyanin {Spinach (Spinacia oleracea) [TaxId: 3562]} Length = 91 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query175
d1ws8a_104 Mavicyanin {Zucchini (Cucurbita pepo) [TaxId: 3663 100.0
d2cbpa_96 Plantacyanin {Cucumber (Cucumis sativus) [TaxId: 3 100.0
d1jera_110 Stellacyanin {Cucumber (Cucumis sativus) [TaxId: 3 100.0
d1f56a_91 Plantacyanin {Spinach (Spinacia oleracea) [TaxId: 99.97
d1bypa_99 Plastocyanin {White campion (Silene pratensis) [Ta 99.17
d1iuza_98 Plastocyanin {Ulva pertusa, a sea lettuce [TaxId: 99.06
d1kdja_102 Plastocyanin {Fern (Adiantum capillus-veneris) [Ta 98.99
d2plta_98 Plastocyanin {Green alga (Chlamydomonas reinhardti 98.94
d2jxma197 Plastocyanin {Photosynthetic prokaryote (Prochloro 98.89
d2cj3a1105 Plastocyanin {Anabaena variabilis [TaxId: 1172]} 98.89
d2q5ba1105 Plastocyanin {Cyanobacterium (Phormidium laminosum 98.83
d1adwa_123 Pseudoazurin {Thiosphaera pantotropha [TaxId: 8236 98.83
d1plca_99 Plastocyanin {Poplar (Populus nigra), variant ital 98.82
d1paza_120 Pseudoazurin {Alcaligenes faecalis, strain s-6 [Ta 98.82
d1pmya_123 Pseudoazurin {Methylobacterium extorquens, strain 98.65
d1bqka_124 Pseudoazurin {Achromobacter cycloclastes [TaxId: 2 98.62
d1pcsa_98 Plastocyanin {Cyanobacterium (Synechocystis sp.), 98.59
d1bxua_91 Plastocyanin {Cyanobacterium (Synechocystis sp.), 98.52
d1qhqa_139 Auracyanin {Chloroflexus aurantiacus [TaxId: 1108] 98.51
d2ov0a1105 Amicyanin {Paracoccus denitrificans [TaxId: 266]} 98.38
d1id2a_106 Amicyanin {Paracoccus versutus (Thiobacillus versu 98.15
d1cuoa_129 Azurin {Methylomonas sp. j [TaxId: 32038]} 97.59
d1ibya_112 Red copper protein nitrosocyanin {Nitrosomonas eur 97.43
d2ccwa1129 Azurin {Alcaligenes xylosoxidans, NCIMB (11015), d 97.36
d1e30a_153 Rusticyanin {Thiobacillus ferrooxidans [TaxId: 920 97.25
d1shxa1138 Ephrin-a5 {Mouse (Mus musculus) [TaxId: 10090]} 97.04
d1ikop_141 Ephrin-b2 ectodomain {Mouse (Mus musculus) [TaxId: 96.87
d2cuaa_122 Cytochrome c oxidase {Thermus thermophilus, ba3 ty 96.82
d1jzga_128 Azurin {Pseudomonas aeruginosa [TaxId: 287]} 96.5
d1qnia1131 Nitrous oxide reductase, C-terminal domain {Pseudo 96.19
d1nwpa_128 Azurin {Pseudomonas putida [TaxId: 303]} 96.13
d1fwxa1132 Nitrous oxide reductase, C-terminal domain {Paraco 96.0
d1kbva1151 Nitrite reductase, NIR {Neisseria gonorrhoeae, Ani 95.15
d1aoza1129 Ascorbate oxidase {Zucchini (Cucurbita pepo var. m 94.25
d1oe2a1159 Nitrite reductase, NIR {Alcaligenes xylosoxidans [ 94.07
d1mzya1153 Nitrite reductase, NIR {Rhodobacter sphaeroides [T 91.47
d2bw4a1157 Nitrite reductase, NIR {Alcaligenes xylosoxidans [ 91.26
d1gyca1130 Laccase {Trametes versicolor, laccase 2 [TaxId: 53 90.26
d1hfua1131 Laccase {Inky cap fungus (Coprinus cinereus) [TaxI 82.41
d2q9oa1162 Laccase {Melanocarpus albomyces [TaxId: 204285]} 81.11
d1yela1102 At1g16640 {Thale cress (Arabidopsis thaliana) [Tax 80.9
>d1ws8a_ b.6.1.1 (A:) Mavicyanin {Zucchini (Cucurbita pepo) [TaxId: 3663]} Back     information, alignment and structure
class: All beta proteins
fold: Cupredoxin-like
superfamily: Cupredoxins
family: Plastocyanin/azurin-like
domain: Mavicyanin
species: Zucchini (Cucurbita pepo) [TaxId: 3663]

Probab=100.00  E-value=2.6e-39  Score=238.94  Aligned_cols=100  Identities=42%  Similarity=0.796  Sum_probs=96.0

Q ss_pred             ceEEEecCCCCCcCCC--CcccccCCCceEeCCEEEEEECCC-CeEEEeCcccCCCCCCCCCCCCCCCCCcEEEecCCcc
Q 030594           17 AVEYTVGDTSGWTQGF--DYTSWVSGKTFKVGDVLVFNYGGL-HKVDRVSESDYNNCASSNALESHDDGNTRINLKAPGT   93 (175)
Q Consensus        17 a~~~~VGg~~GWt~~~--~Y~~Wa~~~~F~vGDsLvF~y~~~-HsV~~V~~~~Y~~C~~~~~~~~~s~G~~~v~l~~~G~   93 (175)
                      |++|+|||+.||+.++  ||++|+++++|++||+|+|+|.++ |+|+||++++|++|+..+++..+++|++.|+|+++|+
T Consensus         2 at~~~VGg~~gW~~~~~~~Y~~Wa~~~~f~vGD~l~F~y~~~~h~V~~v~~~~y~~C~~~~~~~~~~~G~~~v~l~~~g~   81 (104)
T d1ws8a_           2 ATVHKVGDSTGWTTLVPYDYAKWASSNKFHVGDSLLFNYNNKFHNVLQVDQEQFKSCNSSSPAASYTSGADSIPLKRPGT   81 (104)
T ss_dssp             CCEEETTGGGCSCSSSCCCHHHHHHTSCBCTTCEEEEECCTTTCCEEEECHHHHHHTCCSSCSEEECSSEEEEECCSSEE
T ss_pred             CcEEEeCCcCccCcCCCcCHHHHhhCCcCCCCCEEEEEECCCCceEEEECHHHhcCCcCCCccccccCCCeEEEEecCcc
Confidence            7899999999999754  899999999999999999999999 9999999999999999999988999999999999999


Q ss_pred             EEEEcCCCCCCCCCCeEEEEeec
Q 030594           94 QYFICPTAGHCPGGMKLAVTVVA  116 (175)
Q Consensus        94 ~YFiC~v~~HC~~GmKl~I~V~~  116 (175)
                      +||||++++||++||||.|+|++
T Consensus        82 ~yF~C~~~~HC~~Gmkl~I~V~P  104 (104)
T d1ws8a_          82 FYFLCGIPGHCQLGQKVEIKVDP  104 (104)
T ss_dssp             EEEECCSTTTTTTTCEEEEEECC
T ss_pred             EEEECCCcchhhCCCEEEEEECC
Confidence            99999999999999999999974
>d2cbpa_ b.6.1.1 (A:) Plantacyanin {Cucumber (Cucumis sativus) [TaxId: 3659]} Back     information, alignment and structure
>d1jera_ b.6.1.1 (A:) Stellacyanin {Cucumber (Cucumis sativus) [TaxId: 3659]} Back     information, alignment and structure
>d1f56a_ b.6.1.1 (A:) Plantacyanin {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1bypa_ b.6.1.1 (A:) Plastocyanin {White campion (Silene pratensis) [TaxId: 52853]} Back     information, alignment and structure
>d1iuza_ b.6.1.1 (A:) Plastocyanin {Ulva pertusa, a sea lettuce [TaxId: 3120]} Back     information, alignment and structure
>d1kdja_ b.6.1.1 (A:) Plastocyanin {Fern (Adiantum capillus-veneris) [TaxId: 13818]} Back     information, alignment and structure
>d2plta_ b.6.1.1 (A:) Plastocyanin {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2jxma1 b.6.1.1 (A:1-97) Plastocyanin {Photosynthetic prokaryote (Prochlorothrix hollandica) [TaxId: 1223]} Back     information, alignment and structure
>d2cj3a1 b.6.1.1 (A:1-105) Plastocyanin {Anabaena variabilis [TaxId: 1172]} Back     information, alignment and structure
>d2q5ba1 b.6.1.1 (A:1-105) Plastocyanin {Cyanobacterium (Phormidium laminosum) [TaxId: 32059]} Back     information, alignment and structure
>d1adwa_ b.6.1.1 (A:) Pseudoazurin {Thiosphaera pantotropha [TaxId: 82367]} Back     information, alignment and structure
>d1plca_ b.6.1.1 (A:) Plastocyanin {Poplar (Populus nigra), variant italica [TaxId: 3691]} Back     information, alignment and structure
>d1paza_ b.6.1.1 (A:) Pseudoazurin {Alcaligenes faecalis, strain s-6 [TaxId: 511]} Back     information, alignment and structure
>d1pmya_ b.6.1.1 (A:) Pseudoazurin {Methylobacterium extorquens, strain am1 [TaxId: 408]} Back     information, alignment and structure
>d1bqka_ b.6.1.1 (A:) Pseudoazurin {Achromobacter cycloclastes [TaxId: 223]} Back     information, alignment and structure
>d1pcsa_ b.6.1.1 (A:) Plastocyanin {Cyanobacterium (Synechocystis sp.), pcc 6803 [TaxId: 1143]} Back     information, alignment and structure
>d1bxua_ b.6.1.1 (A:) Plastocyanin {Cyanobacterium (Synechocystis sp.), pcc 7942 [TaxId: 1143]} Back     information, alignment and structure
>d1qhqa_ b.6.1.1 (A:) Auracyanin {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d2ov0a1 b.6.1.1 (A:1-105) Amicyanin {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1id2a_ b.6.1.1 (A:) Amicyanin {Paracoccus versutus (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1cuoa_ b.6.1.1 (A:) Azurin {Methylomonas sp. j [TaxId: 32038]} Back     information, alignment and structure
>d1ibya_ b.6.1.4 (A:) Red copper protein nitrosocyanin {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d2ccwa1 b.6.1.1 (A:1-129) Azurin {Alcaligenes xylosoxidans, NCIMB (11015), different isoforms [TaxId: 85698]} Back     information, alignment and structure
>d1e30a_ b.6.1.1 (A:) Rusticyanin {Thiobacillus ferrooxidans [TaxId: 920]} Back     information, alignment and structure
>d1shxa1 b.6.1.5 (A:32-170) Ephrin-a5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ikop_ b.6.1.5 (P:) Ephrin-b2 ectodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cuaa_ b.6.1.2 (A:) Cytochrome c oxidase {Thermus thermophilus, ba3 type [TaxId: 274]} Back     information, alignment and structure
>d1jzga_ b.6.1.1 (A:) Azurin {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qnia1 b.6.1.4 (A:451-581) Nitrous oxide reductase, C-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1nwpa_ b.6.1.1 (A:) Azurin {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1fwxa1 b.6.1.4 (A:452-581) Nitrous oxide reductase, C-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1kbva1 b.6.1.3 (A:13-163) Nitrite reductase, NIR {Neisseria gonorrhoeae, AniA [TaxId: 485]} Back     information, alignment and structure
>d1aoza1 b.6.1.3 (A:1-129) Ascorbate oxidase {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]} Back     information, alignment and structure
>d1oe2a1 b.6.1.3 (A:1-159) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d1mzya1 b.6.1.3 (A:41-193) Nitrite reductase, NIR {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d2bw4a1 b.6.1.3 (A:8-164) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d1gyca1 b.6.1.3 (A:1-130) Laccase {Trametes versicolor, laccase 2 [TaxId: 5325]} Back     information, alignment and structure
>d1hfua1 b.6.1.3 (A:1-131) Laccase {Inky cap fungus (Coprinus cinereus) [TaxId: 5346]} Back     information, alignment and structure
>d2q9oa1 b.6.1.3 (A:1-162) Laccase {Melanocarpus albomyces [TaxId: 204285]} Back     information, alignment and structure
>d1yela1 b.142.1.2 (A:1-102) At1g16640 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure