Citrus Sinensis ID: 030608

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170----
MGSLQLNSYRLASYSLPYNFNCTTNSHKSLKFYKRVSFSRSRIRATATISENDSQANAAEEPPVVNFAFVHSVLLPDGTPDIHFRTACGGQKLRDIMLNSNIDLYGPYARPLSNCAGGGTCGTCMVEKPKNWRLACQTTVGTPDSTGLVVIQQLPEWKGHEWKYKKIPTSELPQ
cccccccccccccccccccccccccccccccccccccccccEEEEEEEcccccccccccccccEEEEEEEEEEEccccccccEEEEEcccHHHHHHHHHccccccccccccccccccccEEEcEEEcccccEEEEEEEEEccccccccEEEEEccccccccccccccccccccc
cccEEEccccccccccccccccccccccccccccccccccccEEEEEEccccccccccccccccEEEEEEcccccccccccccHHHHccHHHHHHHHHHccccEEcccccEEccccccccccEEEEEcccccEEEEEEEccccccccEEEEEEcccccEEEEcccccccccccc
mgslqlnsyrlasyslpynfncttnshkslkfykrvsfsrsRIRATATIsendsqanaaeeppvvNFAFVHsvllpdgtpdihfrtacggqkLRDIMLNsnidlygpyarplsncagggtcgtcmvekpknwrlacqttvgtpdstgLVVIQqlpewkghewkykkiptselpq
mgslqlnsYRLASYSLPYNFNCTTNSHKSLKFYKRVSFSRSRIRATAtisendsqanaaeepPVVNFAFVHSVLLPDGTPDIHFRTACGGQKLRDIMLNSNIDLYGPYARPLSNCAGGGTCGTCMVEKPKNWRLACQTtvgtpdstglVVIQQlpewkghewkykkiptselpq
MGSLQLNSYRLASYSLPYNFNCTTNSHKSLKFYKRVSFSRSRIRATATISENDSQANAAEEPPVVNFAFVHSVLLPDGTPDIHFRTACGGQKLRDIMLNSNIDLYGPYARPLSNCAGGGTCGTCMVEKPKNWRLACQTTVGTPDSTGLVVIQQLPEWKGHEWKYKKIPTSELPQ
*******SYRLASYSLPYNFNCTTNSHKSLKFYKRVSFSR***********************VVNFAFVHSVLLPDGTPDIHFRTACGGQKLRDIMLNSNIDLYGPYARPLSNCAGGGTCGTCMVEKPKNWRLACQTTVGTPDSTGLVVIQQLPEWKGHEWKYKK********
******************************************************************FAFVHSVL***GTPDIHFRTACGGQKLRDIMLNSNIDLYGPYARPLSNCAGGGTCGTCMVEKPKNWRLACQTTVGTPDSTGLVVIQQLPEWKG**W************
MGSLQLNSYRLASYSLPYNFNCTTNSHKSLKFYKRVSFSRSRIRATATIS********AEEPPVVNFAFVHSVLLPDGTPDIHFRTACGGQKLRDIMLNSNIDLYGPYARPLSNCAGGGTCGTCMVEKPKNWRLACQTTVGTPDSTGLVVIQQLPEWKGHEWKYKKIPTSELPQ
**********LASY***********************FSRSRIRATATIS*********EEPPVVNFAFVHSVLLPDGTPDIHFRTACGGQKLRDIMLNSNIDLYGPYARPLSNCAGGGTCGTCMVEKPKNWRLACQTTVGTPDSTGLVVIQQLPEWKGHEWKYKKIPT*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGSLQLNSYRLASYSLPYNFNCTTNSHKSLKFYKRVSFSRSRIRATATISENDSQANAAEEPPVVNFAFVHSVLLPDGTPDIHFRTACGGQKLRDIMLNSNIDLYGPYARPLSNCAGGGTCGTCMVEKPKNWRLACQTTVGTPDSTGLVVIQQLPEWKGHEWKYKKIPTSELPQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query174
255549894204 electron carrier, putative [Ricinus comm 0.988 0.843 0.611 6e-61
449448008197 PREDICTED: uncharacterized protein LOC10 0.982 0.868 0.567 3e-56
224059120195 predicted protein [Populus trichocarpa] 0.942 0.841 0.591 2e-55
225442545191 PREDICTED: uncharacterized protein LOC10 0.959 0.874 0.634 6e-55
388508898195 unknown [Lotus japonicus] 0.919 0.820 0.592 8e-55
297834498204 hypothetical protein ARALYDRAFT_897928 [ 0.959 0.818 0.554 1e-50
357454845191 Electron carrier/ electron transporter/ 0.816 0.743 0.601 1e-49
15228165204 NDH-dependent cyclic electron flow 1 [Ar 0.977 0.833 0.542 1e-49
356556426194 PREDICTED: uncharacterized protein LOC10 0.896 0.804 0.593 4e-44
147838870159 hypothetical protein VITISV_011434 [Viti 0.885 0.968 0.554 4e-43
>gi|255549894|ref|XP_002515998.1| electron carrier, putative [Ricinus communis] gi|223544903|gb|EEF46418.1| electron carrier, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  238 bits (607), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 123/201 (61%), Positives = 144/201 (71%), Gaps = 29/201 (14%)

Query: 3   SLQLNSYRLA-----SYSLPYNFNCTTNS-HKSLKFYKRVSFSRSRIRATATI--SENDS 54
           +LQLNSY LA     S++L ++   +TN+ HKSLK  + VSFSR +IRA  T+  S++D+
Sbjct: 4   ALQLNSYGLANSLKASHNLKHSAATSTNNIHKSLKHSRSVSFSRVKIRAVGTVPDSKSDA 63

Query: 55  QANAAEEPPVVNFAFVHSVLLPDGTPDIHFRTACGGQKLRDIMLNSNIDLYGPYARPLSN 114
           +    EEPP V F FVHSVLLPDGTPD+HFRT CGGQKLRD ML+SNIDLYGPY RPL N
Sbjct: 64  KQEPPEEPPSVKFVFVHSVLLPDGTPDVHFRTTCGGQKLRDTMLDSNIDLYGPYGRPLLN 123

Query: 115 CAGGGTCGTCMVE--------KPK-------------NWRLACQTTVGTPDSTGLVVIQQ 153
           CAGGGTCG+CMVE         P+             NWRLACQTTVG+PDSTGLVVIQQ
Sbjct: 124 CAGGGTCGSCMVEVVMGKELLSPRTEKEKKILKKKPKNWRLACQTTVGSPDSTGLVVIQQ 183

Query: 154 LPEWKGHEWKYKKIPTSELPQ 174
           LPEWK HEWKY+KI   E+ Q
Sbjct: 184 LPEWKAHEWKYEKILPPEISQ 204

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|449448008|ref|XP_004141758.1| PREDICTED: uncharacterized protein LOC101218377 [Cucumis sativus] gi|449491773|ref|XP_004158999.1| PREDICTED: uncharacterized protein LOC101228255 [Cucumis sativus] Back     alignment and taxonomy information
>gi|224059120|ref|XP_002299725.1| predicted protein [Populus trichocarpa] gi|118486517|gb|ABK95098.1| unknown [Populus trichocarpa] gi|222846983|gb|EEE84530.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225442545|ref|XP_002284206.1| PREDICTED: uncharacterized protein LOC100241139 [Vitis vinifera] gi|297743235|emb|CBI36102.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|388508898|gb|AFK42515.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|297834498|ref|XP_002885131.1| hypothetical protein ARALYDRAFT_897928 [Arabidopsis lyrata subsp. lyrata] gi|297330971|gb|EFH61390.1| hypothetical protein ARALYDRAFT_897928 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|357454845|ref|XP_003597703.1| Electron carrier/ electron transporter/ iron ion binding protein [Medicago truncatula] gi|355486751|gb|AES67954.1| Electron carrier/ electron transporter/ iron ion binding protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|15228165|ref|NP_188246.1| NDH-dependent cyclic electron flow 1 [Arabidopsis thaliana] gi|9279708|dbj|BAB01265.1| unnamed protein product [Arabidopsis thaliana] gi|14596159|gb|AAK68807.1| Unknown protein [Arabidopsis thaliana] gi|30023670|gb|AAP13368.1| At3g16240 [Arabidopsis thaliana] gi|332642269|gb|AEE75790.1| NDH-dependent cyclic electron flow 1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356556426|ref|XP_003546527.1| PREDICTED: uncharacterized protein LOC100820264 [Glycine max] Back     alignment and taxonomy information
>gi|147838870|emb|CAN70335.1| hypothetical protein VITISV_011434 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query174
TAIR|locus:2094882204 PnsB3 "Photosynthetic NDH subc 0.724 0.617 0.571 1.1e-50
TAIR|locus:2125637180 AT4G32590 [Arabidopsis thalian 0.637 0.616 0.333 3.2e-16
TAIR|locus:2094882 PnsB3 "Photosynthetic NDH subcomplex B 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 350 (128.3 bits), Expect = 1.1e-50, Sum P(2) = 1.1e-50
 Identities = 76/133 (57%), Positives = 94/133 (70%)

Query:     1 MGSLQLNSYRLASYSLPYN--FNCTTNSHKSLKFYKRVSFSRSRIRATATISEND-SQAN 57
             MGS+QL+   L + SLP N  F+  T  +K   ++ R   + +R +    IS    SQ  
Sbjct:     1 MGSVQLSGSGLVA-SLPPNHSFSHKTKLNKPNSYFFRSKHNAARTKTVRAISTAPASQPP 59

Query:    58 AAEEP---PVVNFAFVHSVLLPDGTPDIHFRTACGGQKLRDIMLNSNIDLYGPYARPLSN 114
             AA+EP   P V+FAFVHSVLLPDGTPD+H+R A GGQKLRDIML+SNI+LYGPY++PLSN
Sbjct:    60 AADEPDEPPAVDFAFVHSVLLPDGTPDVHWRRANGGQKLRDIMLDSNIELYGPYSKPLSN 119

Query:   115 CAGGGTCGTCMVE 127
             CAG GTC TCMVE
Sbjct:   120 CAGVGTCATCMVE 132
GO:0009055 "electron carrier activity" evidence=IEA;ISS
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0051536 "iron-sulfur cluster binding" evidence=IEA
GO:0009535 "chloroplast thylakoid membrane" evidence=IDA
GO:0009773 "photosynthetic electron transport in photosystem I" evidence=IMP
GO:0010598 "NAD(P)H dehydrogenase complex (plastoquinone)" evidence=IMP;IDA
GO:0006098 "pentose-phosphate shunt" evidence=RCA
GO:0019252 "starch biosynthetic process" evidence=RCA
GO:0019288 "isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway" evidence=RCA
GO:0019760 "glucosinolate metabolic process" evidence=RCA
GO:0019761 "glucosinolate biosynthetic process" evidence=RCA
GO:0030003 "cellular cation homeostasis" evidence=RCA
GO:0070838 "divalent metal ion transport" evidence=RCA
TAIR|locus:2125637 AT4G32590 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query174
TIGR01941 405 TIGR01941, nqrF, NADH:ubiquinone oxidoreductase, N 9e-05
cd0020784 cd00207, fer2, 2Fe-2S iron-sulfur cluster binding 2e-04
COG0633102 COG0633, Fdx, Ferredoxin [Energy production and co 2e-04
PRK05464 409 PRK05464, PRK05464, Na(+)-translocating NADH-quino 4e-04
COG2871 410 COG2871, NqrF, Na+-transporting NADH:ubiquinone ox 0.001
>gnl|CDD|130996 TIGR01941, nqrF, NADH:ubiquinone oxidoreductase, Na(+)-translocating, F subunit Back     alignment and domain information 
 Score = 41.3 bits (97), Expect = 9e-05
 Identities = 21/75 (28%), Positives = 28/75 (37%), Gaps = 27/75 (36%)

Query: 86  TACGGQKLRDIMLNSNIDLYGPYARPLSNCAGGGTCGTCMV------------------- 126
           T   G KL + + ++ I +          C GGGTCG C V                   
Sbjct: 45  TVPAGGKLLNTLASNGIFISSA-------CGGGGTCGQCRVRVVEGGGEILPTELSHFSK 97

Query: 127 -EKPKNWRLACQTTV 140
            E  + WRL+CQ  V
Sbjct: 98  REAKEGWRLSCQVKV 112

This model represents the NqrF subunit of the six-protein, Na(+)-pumping NADH-quinone reductase of a number of marine and pathogenic Gram-negative bacteria. This oxidoreductase complex functions primarily as a sodium ion pump [Transport and binding proteins, Cations and iron carrying compounds]. Length = 405
>gnl|CDD|238126 cd00207, fer2, 2Fe-2S iron-sulfur cluster binding domain Back     alignment and domain information
>gnl|CDD|223706 COG0633, Fdx, Ferredoxin [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|235481 PRK05464, PRK05464, Na(+)-translocating NADH-quinone reductase subunit F; Provisional Back     alignment and domain information
>gnl|CDD|225426 COG2871, NqrF, Na+-transporting NADH:ubiquinone oxidoreductase, subunit NqrF [Energy production and conversion] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 174
PLN02593117 adrenodoxin-like ferredoxin protein 99.73
PTZ00490143 Ferredoxin superfamily; Provisional 99.7
TIGR02007110 fdx_isc ferredoxin, 2Fe-2S type, ISC system. This 99.68
TIGR0200897 fdx_plant ferredoxin [2Fe-2S]. This model represen 99.57
CHL0013499 petF ferredoxin; Validated 99.52
COG0633102 Fdx Ferredoxin [Energy production and conversion] 99.48
PTZ00038191 ferredoxin; Provisional 99.48
PLN03136148 Ferredoxin; Provisional 99.45
TIGR01941 405 nqrF NADH:ubiquinone oxidoreductase, Na(+)-translo 99.44
PRK1071384 2Fe-2S ferredoxin YfaE; Provisional 99.44
PRK05464 409 Na(+)-translocating NADH-quinone reductase subunit 99.4
KOG3309159 consensus Ferredoxin [Energy production and conver 99.4
COG2871 410 NqrF Na+-transporting NADH:ubiquinone oxidoreducta 99.4
cd0020784 fer2 2Fe-2S iron-sulfur cluster binding domain. Ir 99.33
COG3894 614 Uncharacterized metal-binding protein [General fun 99.3
PRK05713 312 hypothetical protein; Provisional 99.29
PF0011178 Fer2: 2Fe-2S iron-sulfur cluster binding domain; I 99.23
PRK11872 340 antC anthranilate dioxygenase reductase; Provision 99.23
PRK07609 339 CDP-6-deoxy-delta-3,4-glucoseen reductase; Validat 99.22
TIGR02160352 PA_CoA_Oxy5 phenylacetate-CoA oxygenase/reductase, 99.15
PRK10684332 HCP oxidoreductase, NADH-dependent; Provisional 99.14
PRK07569 234 bidirectional hydrogenase complex protein HoxU; Va 98.62
PF1351082 Fer2_4: 2Fe-2S iron-sulfur cluster binding domain; 98.55
PRK06259 486 succinate dehydrogenase/fumarate reductase iron-su 98.2
PF13085110 Fer2_3: 2Fe-2S iron-sulfur cluster binding domain; 98.11
PRK08166 847 NADH dehydrogenase subunit G; Validated 98.04
PRK12577 329 succinate dehydrogenase iron-sulfur subunit; Provi 97.89
PLN00129 276 succinate dehydrogenase [ubiquinone] iron-sulfur s 97.85
PRK12386 251 fumarate reductase iron-sulfur subunit; Provisiona 97.79
PRK12814 652 putative NADPH-dependent glutamate synthase small 97.78
PRK12576 279 succinate dehydrogenase iron-sulfur subunit; Provi 97.73
TIGR00384 220 dhsB succinate dehydrogenase and fumarate reductas 97.72
PRK13552 239 frdB fumarate reductase iron-sulfur subunit; Provi 97.66
PRK12385 244 fumarate reductase iron-sulfur subunit; Provisiona 97.65
PTZ00305 297 NADH:ubiquinone oxidoreductase; Provisional 97.64
COG0479 234 FrdB Succinate dehydrogenase/fumarate reductase, F 97.63
PRK08640 249 sdhB succinate dehydrogenase iron-sulfur subunit; 97.56
PRK07570 250 succinate dehydrogenase/fumarate reductase iron-su 97.54
PRK05950 232 sdhB succinate dehydrogenase iron-sulfur subunit; 97.53
PRK07860 797 NADH dehydrogenase subunit G; Validated 97.44
PRK08493 819 NADH dehydrogenase subunit G; Validated 97.43
PRK11433217 aldehyde oxidoreductase 2Fe-2S subunit; Provisiona 97.41
PRK12575 235 succinate dehydrogenase iron-sulfur subunit; Provi 97.36
PRK09129 776 NADH dehydrogenase subunit G; Validated 97.21
TIGR01973 603 NuoG NADH-quinone oxidoreductase, chain G. This mo 97.21
PRK09130 687 NADH dehydrogenase subunit G; Validated 96.94
PRK09908159 xanthine dehydrogenase subunit XdhC; Provisional 96.74
TIGR03193148 4hydroxCoAred 4-hydroxybenzoyl-CoA reductase, gamm 96.34
COG1034 693 NuoG NADH dehydrogenase/NADH:ubiquinone oxidoreduc 96.18
COG3383 978 Uncharacterized anaerobic dehydrogenase [General f 95.52
TIGR03198151 pucE xanthine dehydrogenase E subunit. This gene h 95.34
PRK09800 956 putative hypoxanthine oxidase; Provisional 94.68
PRK00054250 dihydroorotate dehydrogenase electron transfer sub 94.63
cd06219248 DHOD_e_trans_like1 FAD/NAD binding domain in the e 94.62
COG2080156 CoxS Aerobic-type carbon monoxide dehydrogenase, s 94.21
PRK06222281 ferredoxin-NADP(+) reductase subunit alpha; Review 94.15
PRK08345289 cytochrome-c3 hydrogenase subunit gamma; Provision 93.85
cd06218246 DHOD_e_trans FAD/NAD binding domain in the electro 93.16
cd06192243 DHOD_e_trans_like FAD/NAD binding domain (electron 92.65
TIGR03313 951 Se_sel_red_Mo probable selenate reductase, molybde 92.46
TIGR02963 467 xanthine_xdhA xanthine dehydrogenase, small subuni 91.82
TIGR03311 848 Se_dep_Molyb_1 selenium-dependent molybdenum hydro 90.99
cd06220233 DHOD_e_trans_like2 FAD/NAD binding domain in the e 90.56
PRK12778 752 putative bifunctional 2-polyprenylphenol hydroxyla 89.31
TIGR02969 1330 mam_aldehyde_ox aldehyde oxidase. Members of this 88.74
KOG3049 288 consensus Succinate dehydrogenase, Fe-S protein su 88.23
PRK05802320 hypothetical protein; Provisional 87.74
TIGR01372 985 soxA sarcosine oxidase, alpha subunit family, hete 86.84
PF1041840 DHODB_Fe-S_bind: Iron-sulfur cluster binding domai 86.09
cd06221253 sulfite_reductase_like Anaerobic sulfite reductase 85.04
PRK12775 1006 putative trifunctional 2-polyprenylphenol hydroxyl 84.83
TIGR02911261 sulfite_red_B sulfite reductase, subunit B. Member 83.75
PLN00192 1344 aldehyde oxidase 81.45
>PLN02593 adrenodoxin-like ferredoxin protein Back     alignment and domain information 
Probab=99.73  E-value=1.7e-17  Score=127.51  Aligned_cols=81  Identities=23%  Similarity=0.360  Sum_probs=65.9

Q ss_pred             eEEEEeeeeeCCCCCeeEEEEecCCCchHHHHHHHCCCCccCCCCCCCCCCCCCceecccEEE-----------------
Q 030608           65 VNFAFVHSVLLPDGTPDIHFRTACGGQKLRDIMLNSNIDLYGPYARPLSNCAGGGTCGTCMVE-----------------  127 (174)
Q Consensus        65 v~~~f~~~v~l~dGt~~v~~~ea~~GetLldaal~~GI~L~~p~~k~~~~CGG~G~CGTC~V~-----------------  127 (174)
                      |+|+|+.    ++|..  +.+++..|+|||++++++||++       ++.|||.|.||||+|+                 
T Consensus         1 ~~V~fi~----~~G~~--~~v~~~~G~tLl~a~~~~gi~i-------~~~CgG~g~C~tC~V~V~~~~~~~~l~~~~~~E   67 (117)
T PLN02593          1 ISVTFVD----KDGEE--RTVKAPVGMSLLEAAHENDIEL-------EGACEGSLACSTCHVIVMDEKVYNKLPEPTDEE   67 (117)
T ss_pred             CEEEEEc----CCCCE--EEEEECCCCcHHHHHHHcCCCC-------CccCCCcceeCCCEEEEecCccccCCCCCChHH
Confidence            5788887    78864  4457789999999999999998       5579999999999998                 


Q ss_pred             ---------cCCCeEEeecceecCCCCCCCeEEEcCCccccc
Q 030608          128 ---------KPKNWRLACQTTVGTPDSTGLVVIQQLPEWKGH  160 (174)
Q Consensus       128 ---------~~~g~RLACQ~~v~~~~~~gdv~I~~lpe~k~~  160 (174)
                               ..++||||||+.+.++  .++++|+++++.+..
T Consensus        68 ~~~L~~~~~~~~~sRLaCQ~~v~~~--~~~~~v~ip~~~~~~  107 (117)
T PLN02593         68 NDMLDLAFGLTETSRLGCQVIAKPE--LDGMRLALPAATRNF  107 (117)
T ss_pred             HHHHhcccCCCCCeEecceeEeecC--CCCEEEEcCchhccc
Confidence                     2358999999999832  257999987776543

>PTZ00490 Ferredoxin superfamily; Provisional Back     alignment and domain information
>TIGR02007 fdx_isc ferredoxin, 2Fe-2S type, ISC system Back     alignment and domain information
>TIGR02008 fdx_plant ferredoxin [2Fe-2S] Back     alignment and domain information
>CHL00134 petF ferredoxin; Validated Back     alignment and domain information
>COG0633 Fdx Ferredoxin [Energy production and conversion] Back     alignment and domain information
>PTZ00038 ferredoxin; Provisional Back     alignment and domain information
>PLN03136 Ferredoxin; Provisional Back     alignment and domain information
>TIGR01941 nqrF NADH:ubiquinone oxidoreductase, Na(+)-translocating, F subunit Back     alignment and domain information
>PRK10713 2Fe-2S ferredoxin YfaE; Provisional Back     alignment and domain information
>PRK05464 Na(+)-translocating NADH-quinone reductase subunit F; Provisional Back     alignment and domain information
>KOG3309 consensus Ferredoxin [Energy production and conversion] Back     alignment and domain information
>COG2871 NqrF Na+-transporting NADH:ubiquinone oxidoreductase, subunit NqrF [Energy production and conversion] Back     alignment and domain information
>cd00207 fer2 2Fe-2S iron-sulfur cluster binding domain Back     alignment and domain information
>COG3894 Uncharacterized metal-binding protein [General function prediction only] Back     alignment and domain information
>PRK05713 hypothetical protein; Provisional Back     alignment and domain information
>PF00111 Fer2: 2Fe-2S iron-sulfur cluster binding domain; InterPro: IPR001041 The ferredoxin protein family are electron carrier proteins with an iron-sulphur cofactor that act in a wide variety of metabolic reactions Back     alignment and domain information
>PRK11872 antC anthranilate dioxygenase reductase; Provisional Back     alignment and domain information
>PRK07609 CDP-6-deoxy-delta-3,4-glucoseen reductase; Validated Back     alignment and domain information
>TIGR02160 PA_CoA_Oxy5 phenylacetate-CoA oxygenase/reductase, PaaK subunit Back     alignment and domain information
>PRK10684 HCP oxidoreductase, NADH-dependent; Provisional Back     alignment and domain information
>PRK07569 bidirectional hydrogenase complex protein HoxU; Validated Back     alignment and domain information
>PF13510 Fer2_4: 2Fe-2S iron-sulfur cluster binding domain; PDB: 1Y56_A 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A Back     alignment and domain information
>PRK06259 succinate dehydrogenase/fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>PF13085 Fer2_3: 2Fe-2S iron-sulfur cluster binding domain; PDB: 3P4Q_N 1KFY_N 3CIR_N 3P4R_B 2B76_N 1KF6_B 3P4P_N 3P4S_B 1L0V_B 1ZOY_B Back     alignment and domain information
>PRK08166 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>PRK12577 succinate dehydrogenase iron-sulfur subunit; Provisional Back     alignment and domain information
>PLN00129 succinate dehydrogenase [ubiquinone] iron-sulfur subunit Back     alignment and domain information
>PRK12386 fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>PRK12576 succinate dehydrogenase iron-sulfur subunit; Provisional Back     alignment and domain information
>TIGR00384 dhsB succinate dehydrogenase and fumarate reductase iron-sulfur protein Back     alignment and domain information
>PRK13552 frdB fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK12385 fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>PTZ00305 NADH:ubiquinone oxidoreductase; Provisional Back     alignment and domain information
>COG0479 FrdB Succinate dehydrogenase/fumarate reductase, Fe-S protein subunit [Energy production and conversion] Back     alignment and domain information
>PRK08640 sdhB succinate dehydrogenase iron-sulfur subunit; Reviewed Back     alignment and domain information
>PRK07570 succinate dehydrogenase/fumarate reductase iron-sulfur subunit; Validated Back     alignment and domain information
>PRK05950 sdhB succinate dehydrogenase iron-sulfur subunit; Reviewed Back     alignment and domain information
>PRK07860 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>PRK08493 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>PRK11433 aldehyde oxidoreductase 2Fe-2S subunit; Provisional Back     alignment and domain information
>PRK12575 succinate dehydrogenase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK09129 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>TIGR01973 NuoG NADH-quinone oxidoreductase, chain G Back     alignment and domain information
>PRK09130 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>PRK09908 xanthine dehydrogenase subunit XdhC; Provisional Back     alignment and domain information
>TIGR03193 4hydroxCoAred 4-hydroxybenzoyl-CoA reductase, gamma subunit Back     alignment and domain information
>COG1034 NuoG NADH dehydrogenase/NADH:ubiquinone oxidoreductase 75 kD subunit (chain G) [Energy production and conversion] Back     alignment and domain information
>COG3383 Uncharacterized anaerobic dehydrogenase [General function prediction only] Back     alignment and domain information
>TIGR03198 pucE xanthine dehydrogenase E subunit Back     alignment and domain information
>PRK09800 putative hypoxanthine oxidase; Provisional Back     alignment and domain information
>PRK00054 dihydroorotate dehydrogenase electron transfer subunit; Reviewed Back     alignment and domain information
>cd06219 DHOD_e_trans_like1 FAD/NAD binding domain in the electron transfer subunit of dihydroorotate dehydrogenase-like proteins Back     alignment and domain information
>COG2080 CoxS Aerobic-type carbon monoxide dehydrogenase, small subunit CoxS/CutS homologs [Energy production and conversion] Back     alignment and domain information
>PRK06222 ferredoxin-NADP(+) reductase subunit alpha; Reviewed Back     alignment and domain information
>PRK08345 cytochrome-c3 hydrogenase subunit gamma; Provisional Back     alignment and domain information
>cd06218 DHOD_e_trans FAD/NAD binding domain in the electron transfer subunit of dihydroorotate dehydrogenase Back     alignment and domain information
>cd06192 DHOD_e_trans_like FAD/NAD binding domain (electron transfer subunit) of dihydroorotate dehydrogenase-like proteins Back     alignment and domain information
>TIGR03313 Se_sel_red_Mo probable selenate reductase, molybdenum-binding subunit Back     alignment and domain information
>TIGR02963 xanthine_xdhA xanthine dehydrogenase, small subunit Back     alignment and domain information
>TIGR03311 Se_dep_Molyb_1 selenium-dependent molybdenum hydroxylase 1 Back     alignment and domain information
>cd06220 DHOD_e_trans_like2 FAD/NAD binding domain in the electron transfer subunit of dihydroorotate dehydrogenase-like proteins Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>TIGR02969 mam_aldehyde_ox aldehyde oxidase Back     alignment and domain information
>KOG3049 consensus Succinate dehydrogenase, Fe-S protein subunit [Energy production and conversion] Back     alignment and domain information
>PRK05802 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>PF10418 DHODB_Fe-S_bind: Iron-sulfur cluster binding domain of dihydroorotate dehydrogenase B; InterPro: IPR019480 Lactococcus lactis is one of the few organisms with two dihydroorotate dehydrogenases (DHODs) A and B [] Back     alignment and domain information
>cd06221 sulfite_reductase_like Anaerobic sulfite reductase contains an FAD and NADPH binding module with structural similarity to ferredoxin reductase and sequence similarity to dihydroorotate dehydrogenases Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>TIGR02911 sulfite_red_B sulfite reductase, subunit B Back     alignment and domain information
>PLN00192 aldehyde oxidase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query174
2y5c_A109 Adrenodoxin-like protein, mitochondrial; electron 2e-05
3n9z_C123 Adrenodoxin; cytochrome P450, 22-hydroxycholestero 7e-05
3zyy_X 631 Iron-sulfur cluster binding protein; iron-sulfur-b 1e-04
2bt6_A108 Adrenodoxin 1; ruthenium(II) bipyridyl complex, in 1e-04
1l5p_A93 Ferredoxin; [2Fe-2S] cluster, electron transfer, i 2e-04
2wlb_A103 ETP1-FD, electron transfer protein 1, mitochondria 6e-04
>2y5c_A Adrenodoxin-like protein, mitochondrial; electron transport, iron-sulfur cluster biogenesis; 1.70A {Homo sapiens} Length = 109 Back     alignment and structure
 Score = 40.7 bits (96), Expect = 2e-05
 Identities = 20/116 (17%), Positives = 31/116 (26%), Gaps = 44/116 (37%)

Query: 75  LPDGTPDIHFRTACG---------GQKLRDIMLNSNIDLYGPYARPLSNCAGGGTCGTCM 125
           +     ++ F    G         G  +  +     +DL G        C     C TC 
Sbjct: 1   MASDVVNVVFVDRSGQRIPVSGRVGDNVLHLAQRHGVDLEG-------ACEASLACSTCH 53

Query: 126 VEKPKNW-------------------------RLACQTTVGTPDSTGLVVIQQLPE 156
           V   ++                          RL CQ  + TP+  G      LP+
Sbjct: 54  VYVSEDHLDLLPPPEEREDDMLDMAPLLQENSRLGCQIVL-TPELEGAEF--TLPK 106
>3n9z_C Adrenodoxin; cytochrome P450, 22-hydroxycholesterol, cholesterol SIDE CHA cleavage, structural genomics; HET: HEM HC9; 2.17A {Homo sapiens} PDB: 3na1_C* 3p1m_A* 1l6u_A 1l6v_A 1e6e_B* 1cje_A Length = 123 Back     alignment and structure
>3zyy_X Iron-sulfur cluster binding protein; iron-sulfur-binding protein, ashka family, ATPase; 2.20A {Carboxydothermus hydrogenoformans} Length = 631 Back     alignment and structure
>2bt6_A Adrenodoxin 1; ruthenium(II) bipyridyl complex, intramolecular electron TRA electron transport, metal-binding; HET: RUA; 1.50A {Bos taurus} SCOP: d.15.4.1 PDB: 1ayf_A 3n9y_C* 2jqr_B* 3na0_C* Length = 108 Back     alignment and structure
>1l5p_A Ferredoxin; [2Fe-2S] cluster, electron transfer, iron-sulfur protein, metalloprotein, oxidoreductase; 2.20A {Trichomonas vaginalis} SCOP: d.15.4.1 Length = 93 Back     alignment and structure
>2wlb_A ETP1-FD, electron transfer protein 1, mitochondrial; iron-sulfur, iron, transport, ferredoxin, adrenodoxin-like, electron transport; 2.60A {Schizosaccharomyces pombe} Length = 103 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query174
3hui_A126 Ferredoxin; cytochrome P450, electron transfer, ir 99.78
2y5c_A109 Adrenodoxin-like protein, mitochondrial; electron 99.78
2bt6_A108 Adrenodoxin 1; ruthenium(II) bipyridyl complex, in 99.78
3lxf_A104 Ferredoxin; iron, iron-sulfur, metal-binding, meta 99.76
3n9z_C123 Adrenodoxin; cytochrome P450, 22-hydroxycholestero 99.73
3ah7_A113 [2Fe-2S]ferredoxin; [2Fe-2S] cluster, iron-sulfur 99.72
1uwm_A106 Ferredoxin VI, FDVI; electron transport, metal-bin 99.72
1xlq_A106 Putidaredoxin, PDX; [2Fe-2S], ferredoxin, oxidored 99.72
2wlb_A103 ETP1-FD, electron transfer protein 1, mitochondria 99.7
1b9r_A105 Protein (terpredoxin); structure from molmol, ferr 99.69
1i7h_A111 Ferredoxin; 2Fe-2S,electron transport; 1.70A {Esch 99.67
1a70_A97 Ferredoxin; iron-sulfur protein, photosynthesis, e 99.62
1frr_A95 Ferredoxin I; electron transfer(iron-sulfur protei 99.6
1czp_A98 Ferredoxin I; [2Fe-2S] protein, crystal reduced wi 99.6
1awd_A94 Ferredoxin; electron transport, eukaryotic, green 99.6
1iue_A98 Ferredoxin; electron transport, iron-sulfur; 1.70A 99.59
1frd_A98 Heterocyst [2Fe-2S] ferredoxin; electron transport 99.58
1wri_A93 Ferredoxin II, ferredoxin; electron transport; 1.2 99.58
1jq4_A98 Methane monooxygenase component C; [2Fe-2S] ferred 99.57
1l5p_A93 Ferredoxin; [2Fe-2S] cluster, electron transfer, i 99.57
1krh_A 338 Benzoate 1,2-dioxygenase reductase; alpha-beta, FA 99.48
3zyy_X 631 Iron-sulfur cluster binding protein; iron-sulfur-b 99.45
1doi_A128 2Fe-2S ferredoxin; halophilic protein, redox prote 99.38
2pia_A321 Phthalate dioxygenase reductase; HET: FMN; 2.00A { 99.24
1kf6_B 243 Fumarate reductase iron-sulfur protein; respiratio 98.25
2wdq_B 238 Succinate dehydrogenase iron-sulfur subunit; succi 98.22
2bs2_B 241 Quinol-fumarate reductase iron-sulfur subunit B; 2 98.19
1t3q_A168 Quinoline 2-oxidoreductase small subunit; QOR, mol 98.17
3i9v_3 783 NADH-quinone oxidoreductase subunit 3; electron tr 98.16
3c8y_A 574 Iron hydrogenase 1; dithiomethylether, H-cluster, 98.15
2h88_B 252 Succinate dehydrogenase IP subunit; complex II, me 98.04
3vr8_B 282 Iron-sulfur subunit of succinate dehydrogenase; me 97.86
1rm6_C161 4-hydroxybenzoyl-COA reductase gamma subunit; xant 97.71
1ffv_A163 CUTS, iron-sulfur protein of carbon monoxide dehyd 97.7
1n62_A166 Carbon monoxide dehydrogenase small chain; CODH, m 97.7
3hrd_D160 Nicotinate dehydrogenase small FES subunit; seleni 97.58
1vlb_A 907 Aldehyde oxidoreductase; iron-sulphur cluster; HET 96.18
1dgj_A 907 Aldehyde oxidoreductase; beta half-barrel, four-he 96.13
2w3s_A 462 Xanthine dehydrogenase; XO, XDH, GOUT, iron, 2Fe-2 95.8
3nvw_A164 Xanthine dehydrogenase/oxidase; hydroxylase, homod 95.4
1y56_A 493 Hypothetical protein PH1363; dehydrogenase, protei 91.75
1ep3_B262 Dihydroorotate dehydrogenase B (PYRK subunit); het 90.25
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 86.69
3unc_A 1332 Xanthine dehydrogenase/oxidase; oxidoreductase; HE 82.52
>3hui_A Ferredoxin; cytochrome P450, electron transfer, iron, iron-sulfur, metal-binding, electron transport; 2.01A {Rhodopseudomonas palustris} Back     alignment and structure
Probab=99.78  E-value=4.3e-19  Score=136.54  Aligned_cols=81  Identities=21%  Similarity=0.393  Sum_probs=68.4

Q ss_pred             CCCCCeeEEEEeeeeeCCCCCeeEEEEecCCCchHHHHHHHCCCC-ccCCCCCCCCCCCCCceecccEEE----------
Q 030608           59 AEEPPVVNFAFVHSVLLPDGTPDIHFRTACGGQKLRDIMLNSNID-LYGPYARPLSNCAGGGTCGTCMVE----------  127 (174)
Q Consensus        59 ~~~~p~v~~~f~~~v~l~dGt~~v~~~ea~~GetLldaal~~GI~-L~~p~~k~~~~CGG~G~CGTC~V~----------  127 (174)
                      +..+.|++|+|+.    ++|..  +.+++.+|+|||++|+++||+ +       ++.|+|.|.||||+|+          
T Consensus        16 ~~~~~M~~Vt~~~----~~G~~--~~v~~~~G~tLL~aa~~~gi~gi-------~~~C~G~G~CgtC~v~v~~G~~~~l~   82 (126)
T 3hui_A           16 PRGSHMAKINFVD----HTGET--RTVEVEEGATVMEAAIRNAIPGV-------EAECGGACACATCHVYVDEAWREKVG   82 (126)
T ss_dssp             CTTCSEEEEEEEC----TTSCE--EEEEEETTSBHHHHHHTTTCTTC-------CCTTSSSSCCSTTEEEECGGGHHHHC
T ss_pred             CCCCCceEEEEEe----CCCCE--EEEEECCCCcHHHHHHHcCCCCC-------ccCCCCCCCCCCCEEEECCCcccccC
Confidence            5677889999987    68854  445789999999999999999 8       7789999999999998          


Q ss_pred             ---------------cCCCeEEeecceecCCCCCCC---eEEEcCCcc
Q 030608          128 ---------------KPKNWRLACQTTVGTPDSTGL---VVIQQLPEW  157 (174)
Q Consensus       128 ---------------~~~g~RLACQ~~v~~~~~~gd---v~I~~lpe~  157 (174)
                                     ..++||||||+++.     +|   ++|+++++.
T Consensus        83 ~~~~~E~~~L~~~~e~~~g~RLaCQ~~~~-----~dldgl~V~lp~~~  125 (126)
T 3hui_A           83 GPSPMEEDMLDFGYDVRPNSRLSCQIKVS-----NELDGLIVTTPERQ  125 (126)
T ss_dssp             CCCHHHHHHHTTSSSCCTTEEEGGGCBCC-----GGGTTEEEECCSCC
T ss_pred             CCCHHHhhhcCchhhccCCeEEeeeCEEC-----cCCCcEEEEecCcC
Confidence                           23689999999999     56   999976553
>2y5c_A Adrenodoxin-like protein, mitochondrial; electron transport, iron-sulfur cluster biogenesis; 1.70A {Homo sapiens} Back     alignment and structure
>2bt6_A Adrenodoxin 1; ruthenium(II) bipyridyl complex, intramolecular electron TRA electron transport, metal-binding; HET: RUA; 1.50A {Bos taurus} SCOP: d.15.4.1 PDB: 1ayf_A 3n9y_C* 2jqr_B* 3na0_C* Back     alignment and structure
>3lxf_A Ferredoxin; iron, iron-sulfur, metal-binding, metal protein; 2.30A {Novosphingobium aromaticivorans} SCOP: d.15.4.0 Back     alignment and structure
>3n9z_C Adrenodoxin; cytochrome P450, 22-hydroxycholesterol, cholesterol SIDE CHA cleavage, structural genomics; HET: HEM HC9; 2.17A {Homo sapiens} SCOP: d.15.4.1 PDB: 3na1_C* 3p1m_A* 1l6u_A 1l6v_A 1e6e_B* 1cje_A Back     alignment and structure
>3ah7_A [2Fe-2S]ferredoxin; [2Fe-2S] cluster, iron-sulfur cluster biosynthes pseudomonas, metal binding protein; 1.90A {Pseudomonas putida} Back     alignment and structure
>1uwm_A Ferredoxin VI, FDVI; electron transport, metal-binding, iron-sulfur, iron, 2Fe-2S; 2.0A {Rhodobacter capsulatus} SCOP: d.15.4.1 PDB: 1e9m_A Back     alignment and structure
>1xlq_A Putidaredoxin, PDX; [2Fe-2S], ferredoxin, oxidoreductase; 1.45A {Pseudomonas putida} SCOP: d.15.4.1 PDB: 1xlp_A 1oqr_A 1r7s_A 1pdx_A 1yji_A 1yjj_A 1oqq_A 1xln_A 1xlo_A 3lb8_C* 1put_A 1gpx_A Back     alignment and structure
>2wlb_A ETP1-FD, electron transfer protein 1, mitochondrial; iron-sulfur, iron, transport, ferredoxin, adrenodoxin-like, electron transport; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>1b9r_A Protein (terpredoxin); structure from molmol, ferredoxin; NMR {Pseudomonas SP} SCOP: d.15.4.1 Back     alignment and structure
>1i7h_A Ferredoxin; 2Fe-2S,electron transport; 1.70A {Escherichia coli} SCOP: d.15.4.1 Back     alignment and structure
>1a70_A Ferredoxin; iron-sulfur protein, photosynthesis, electron transport; 1.70A {Spinacia oleracea} SCOP: d.15.4.1 PDB: 1pfd_A Back     alignment and structure
>1frr_A Ferredoxin I; electron transfer(iron-sulfur protein); 1.80A {Equisetum arvense} SCOP: d.15.4.1 Back     alignment and structure
>1czp_A Ferredoxin I; [2Fe-2S] protein, crystal reduced with dithionite, electron; 1.17A {Nostoc SP} SCOP: d.15.4.1 PDB: 1ewy_C* 1fxa_A 1qt9_A 1qog_A 1j7c_A 1j7b_A 1qof_A 1qob_A 1j7a_A 1qoa_A 1rfk_A 3p63_A 4fxc_A 3ab5_A 1roe_A 2cjn_A 2cjo_A 1off_A 1dox_A 1doy_A ... Back     alignment and structure
>1awd_A Ferredoxin; electron transport, eukaryotic, green ALGA, electron transfer, metalloprotein; 1.40A {'chlorella' fusca} SCOP: d.15.4.1 Back     alignment and structure
>1iue_A Ferredoxin; electron transport, iron-sulfur; 1.70A {Plasmodium falciparum} SCOP: d.15.4.1 Back     alignment and structure
>1frd_A Heterocyst [2Fe-2S] ferredoxin; electron transport; 1.70A {Nostoc SP} SCOP: d.15.4.1 Back     alignment and structure
>1wri_A Ferredoxin II, ferredoxin; electron transport; 1.20A {Equisetum arvense} SCOP: d.15.4.1 Back     alignment and structure
>1jq4_A Methane monooxygenase component C; [2Fe-2S] ferredoxin, oxidoreductase; NMR {Methylococcus capsulatus str} SCOP: d.15.4.2 Back     alignment and structure
>1l5p_A Ferredoxin; [2Fe-2S] cluster, electron transfer, iron-sulfur protein, metalloprotein, oxidoreductase; 2.20A {Trichomonas vaginalis} SCOP: d.15.4.1 Back     alignment and structure
>1krh_A Benzoate 1,2-dioxygenase reductase; alpha-beta, FAD-binding, ferredoxin, NADH-binding, oxidoreductase; HET: FAD; 1.50A {Acinetobacter SP} SCOP: b.43.4.2 c.25.1.2 d.15.4.2 Back     alignment and structure
>3zyy_X Iron-sulfur cluster binding protein; iron-sulfur-binding protein, ashka family, ATPase; 2.20A {Carboxydothermus hydrogenoformans} Back     alignment and structure
>1doi_A 2Fe-2S ferredoxin; halophilic protein, redox protein, iron-sulfur, electron transport; 1.90A {Haloarcula marismortui} SCOP: d.15.4.1 PDB: 1e0z_A* 1e10_A Back     alignment and structure
>2pia_A Phthalate dioxygenase reductase; HET: FMN; 2.00A {Burkholderia cepacia} SCOP: b.43.4.2 c.25.1.2 d.15.4.2 Back     alignment and structure
>1kf6_B Fumarate reductase iron-sulfur protein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.1.2.1 d.15.4.2 PDB: 1kfy_B* 1l0v_B* 2b76_B* 3cir_B* 3p4p_B* 3p4q_B* 3p4r_B* 3p4s_B* Back     alignment and structure
>2wdq_B Succinate dehydrogenase iron-sulfur subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_B* 2acz_B* 1nek_B* 2wdr_B* 2wdv_B* 2ws3_B* 2wu2_B* 2wu5_B* 2wp9_B* Back     alignment and structure
>2bs2_B Quinol-fumarate reductase iron-sulfur subunit B; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.1.2.1 d.15.4.2 PDB: 2bs3_B* 1e7p_B* 1qlb_B* 2bs4_B* Back     alignment and structure
>1t3q_A Quinoline 2-oxidoreductase small subunit; QOR, molybdenum, MCD; HET: FAD MCN; 1.80A {Pseudomonas putida} SCOP: a.56.1.1 d.15.4.2 Back     alignment and structure
>3i9v_3 NADH-quinone oxidoreductase subunit 3; electron transport, respiratory chain, cell flavoprotein, FMN, iron, iron-sulfur, membrane; HET: FMN; 3.10A {Thermus thermophilus} PDB: 2ybb_3* 2fug_3* 3iam_3* 3ias_3* 3m9s_3* Back     alignment and structure
>3c8y_A Iron hydrogenase 1; dithiomethylether, H-cluster, iron-sulfur binding, oxidoreductase; HET: HCN; 1.39A {Clostridium pasteurianum} SCOP: c.96.1.1 d.15.4.2 d.58.1.5 PDB: 1c4c_A* 1c4a_A* 1feh_A* Back     alignment and structure
>2h88_B Succinate dehydrogenase IP subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_B* 1yq3_B* 2fbw_B* 2h89_B* 2wqy_B* 3aef_B* 3abv_B* 3ae1_B* 3ae3_B* 3ae2_B* 3ae5_B* 3ae6_B* 3ae7_B* 3ae8_B* 3ae9_B* 3aea_B* 3aeb_B* 3aec_B* 3aed_B* 3aee_B* ... Back     alignment and structure
>3vr8_B Iron-sulfur subunit of succinate dehydrogenase; membrane protein, reductase, mitochondria MEMB oxidoreductase; HET: FAD HEM RQX EPH; 2.81A {Ascaris suum} PDB: 3vrb_B* Back     alignment and structure
>1rm6_C 4-hydroxybenzoyl-COA reductase gamma subunit; xanthine oxidase family, dimer heterotrimers, oxidoreductase; HET: PCD FAD SF4 EPE; 1.60A {Thauera aromatica} SCOP: a.56.1.1 d.15.4.2 PDB: 1sb3_C* Back     alignment and structure
>1ffv_A CUTS, iron-sulfur protein of carbon monoxide dehydrogenase; hydrolase; HET: ARO PCD FAD; 2.25A {Hydrogenophaga pseudoflava} SCOP: a.56.1.1 d.15.4.2 PDB: 1ffu_A* Back     alignment and structure
>1n62_A Carbon monoxide dehydrogenase small chain; CODH, molybdenum, molybdopterin, oxidoreductase; HET: CUB MCN FAD; 1.09A {Oligotropha carboxidovorans} SCOP: a.56.1.1 d.15.4.2 PDB: 1n5w_A* 1n61_A* 1n60_A* 1n63_A* 1zxi_A* Back     alignment and structure
>3hrd_D Nicotinate dehydrogenase small FES subunit; selenium ligand, iron, iron-sulfur, metal-binding, oxidoreductase; HET: MCN FAD; 2.20A {Eubacterium barkeri} Back     alignment and structure
>1vlb_A Aldehyde oxidoreductase; iron-sulphur cluster; HET: PCD; 1.28A {Desulfovibrio gigas} SCOP: a.56.1.1 d.15.4.2 d.41.1.1 d.133.1.1 PDB: 1sij_A* 1zcs_A* 3fah_A* 3fc4_A* 3l4p_A* Back     alignment and structure
>1dgj_A Aldehyde oxidoreductase; beta half-barrel, four-helix bundle, beta barrel; HET: MCN; 2.80A {Desulfovibrio desulfuricans} SCOP: a.56.1.1 d.15.4.2 d.41.1.1 d.133.1.1 Back     alignment and structure
>2w3s_A Xanthine dehydrogenase; XO, XDH, GOUT, iron, 2Fe-2S, iron-sulfur, oxidoreductase, purine metabolism, molybdenum cofactor, hypoxanthine; HET: MPN FAD XAN; 2.60A {Rhodobacter capsulatus} PDB: 2w3r_A* 2w54_A* 2w55_A* 1jro_A* 1jrp_A* Back     alignment and structure
>3nvw_A Xanthine dehydrogenase/oxidase; hydroxylase, homodimer, xanthine oxidase, guanine, oxidoredu; HET: FAD MTE GUN; 1.60A {Bos taurus} PDB: 3etr_A* 3ns1_A* 3nvv_A* 3nrz_A* 3nvy_A* 3nvz_A* 3rca_A* 3sr6_A* 3eub_A* Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>1ep3_B Dihydroorotate dehydrogenase B (PYRK subunit); heterotetramer, alpha-beta barrel, beta sandwich, FAD domain alpha/beta NADP domain; HET: FMN FAD; 2.10A {Lactococcus lactis} SCOP: b.43.4.2 c.25.1.3 PDB: 1ep1_B* 1ep2_B* Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>3unc_A Xanthine dehydrogenase/oxidase; oxidoreductase; HET: MTE FAD SAL; 1.65A {Bos taurus} PDB: 3una_A* 3uni_A* 1v97_A* 1fo4_A* 1vdv_A* 3am9_A* 3amz_A* 3ax7_A* 3ax9_A* 3bdj_A* 1n5x_A* 2ckj_A* 2e1q_A* 3an1_A* 2e3t_A* 1wyg_A* 3b9j_B* 1fiq_B* 3b9j_A* 1fiq_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 174
d1b9ra_105 d.15.4.1 (A:) 2Fe-2S ferredoxin {Pseudomonas sp., 3e-08
d1l5pa_93 d.15.4.1 (A:) 2Fe-2S ferredoxin {Trichomonas vagin 4e-07
d2bt6a1104 d.15.4.1 (A:5-108) Adrenodoxin {Cow (Bos taurus) [ 3e-06
d1i7ha_109 d.15.4.1 (A:) Adrenodoxin-like ferredoxin {Escheri 4e-06
d1xlqa1106 d.15.4.1 (A:1-106) 2Fe-2S ferredoxin {Pseudomonas 5e-06
d1e9ma_106 d.15.4.1 (A:) 2Fe-2S ferredoxin {Rhodobacter capsu 5e-05
d2fug3395 d.15.4.2 (3:1-95) Nadh-quinone oxidoreductase chai 7e-04
d1a70a_97 d.15.4.1 (A:) 2Fe-2S ferredoxin {Spinach (Spinacia 0.001
d1krha3104 d.15.4.2 (A:2-105) Benzoate dioxygenase reductase, 0.004
>d1b9ra_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Pseudomonas sp., terpredoxin [TaxId: 306]} Length = 105 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-Grasp (ubiquitin-like)
superfamily: 2Fe-2S ferredoxin-like
family: 2Fe-2S ferredoxin-related
domain: 2Fe-2S ferredoxin
species: Pseudomonas sp., terpredoxin [TaxId: 306]

 Score = 47.3 bits (112), Expect = 3e-08
 Identities = 21/119 (17%), Positives = 35/119 (29%), Gaps = 43/119 (36%)

Query: 63  PVVNFAFVHSVLLPDGTPDIHFRTACGGQKLRDIMLNSNIDLYGPYARPLSNCAGGGTCG 122
           P V F      +        +   A  GQ L ++   + +         ++ C G   C 
Sbjct: 1   PRVVF------IDEQSG--EYAVDAQDGQSLMEVATQNGVPG------IVAECGGSCVCA 46

Query: 123 TCMV--------------------------EKPKNWRLACQTTVGTPDSTGLVVIQQLP 155
           TC +                                RL+CQ  +  P   GL+V  ++P
Sbjct: 47  TCRIEIEDAWVEIVGEANPDENDLLQSTGEPMTAGTRLSCQVFI-DPSMDGLIV--RVP 102
>d1l5pa_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Trichomonas vaginalis [TaxId: 5722]} Length = 93 Back     information, alignment and structure
>d2bt6a1 d.15.4.1 (A:5-108) Adrenodoxin {Cow (Bos taurus) [TaxId: 9913]} Length = 104 Back     information, alignment and structure
>d1i7ha_ d.15.4.1 (A:) Adrenodoxin-like ferredoxin {Escherichia coli [TaxId: 562]} Length = 109 Back     information, alignment and structure
>d1xlqa1 d.15.4.1 (A:1-106) 2Fe-2S ferredoxin {Pseudomonas putida, putidaredoxin [TaxId: 303]} Length = 106 Back     information, alignment and structure
>d1e9ma_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Rhodobacter capsulatus, ferredoxin VI [TaxId: 1061]} Length = 106 Back     information, alignment and structure
>d2fug33 d.15.4.2 (3:1-95) Nadh-quinone oxidoreductase chain 3, Nqo3, N-terminal domain {Thermus thermophilus [TaxId: 274]} Length = 95 Back     information, alignment and structure
>d1a70a_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Spinach (Spinacia oleracea) [TaxId: 3562]} Length = 97 Back     information, alignment and structure
>d1krha3 d.15.4.2 (A:2-105) Benzoate dioxygenase reductase, N-terminal domain {Acinetobacter sp. [TaxId: 472]} Length = 104 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query174
d1i7ha_109 Adrenodoxin-like ferredoxin {Escherichia coli [Tax 99.8
d1e9ma_106 2Fe-2S ferredoxin {Rhodobacter capsulatus, ferredo 99.79
d1xlqa1106 2Fe-2S ferredoxin {Pseudomonas putida, putidaredox 99.79
d2bt6a1104 Adrenodoxin {Cow (Bos taurus) [TaxId: 9913]} 99.79
d1b9ra_105 2Fe-2S ferredoxin {Pseudomonas sp., terpredoxin [T 99.77
d1krha3104 Benzoate dioxygenase reductase, N-terminal domain 99.7
d1frra_95 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258] 99.68
d1l5pa_93 2Fe-2S ferredoxin {Trichomonas vaginalis [TaxId: 5 99.68
d1frda_98 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), 99.68
d1a70a_97 2Fe-2S ferredoxin {Spinach (Spinacia oleracea) [Ta 99.67
d1awda_94 2Fe-2S ferredoxin {Chlorella fusca [TaxId: 3073]} 99.67
d1iuea_98 2Fe-2S ferredoxin {Malaria parasite (Plasmodium fa 99.66
d1czpa_98 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), 99.65
d1jq4a_98 Methane monooxygenase reductase N-terminal domain 99.64
d2fug3395 Nadh-quinone oxidoreductase chain 3, Nqo3, N-termi 99.54
d2piaa398 Phthalate dioxygenase reductase, C-terminal domain 99.46
d1wria_93 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258] 99.45
d1doia_128 2Fe-2S ferredoxin {Archaeon Haloarcula marismortui 99.44
d3c8ya2126 Fe-only hydrogenase, N-terminal domain {Clostridiu 98.26
d1kf6b2105 Fumarate reductase iron-sulfur protein, N-terminal 98.23
d2bs2b2106 Fumarate reductase iron-sulfur protein, N-terminal 98.15
d1t3qa281 Quinoline 2-oxidoreductase small subunit QorS, N-d 97.77
d1nekb2106 Succinate dehydogenase iron-sulfur protein, N-term 97.5
d1vlba280 Aldehyde oxidoreductase, N-terminal domain {Desulf 97.46
d1rm6c281 4-hydroxybenzoyl-CoA reductase gamma subunit HrcC, 97.16
d1dgja280 Aldehyde oxidoreductase, N-terminal domain {Desulf 97.12
d1ffva279 Carbone monoxide (CO) dehydrogenase iron-sulfur pr 96.96
d1n62a279 Carbone monoxide (CO) dehydrogenase iron-sulfur pr 96.94
d1jroa284 Xanthine dehydrogenase chain A, N-terminal domain 95.94
d1v97a290 Xanthine oxidase, N-terminal domain {Cow (Bos taur 95.48
d1ep3b2160 Dihydroorotate dehydrogenase B, PyrK subunit {Lact 91.38
>d1i7ha_ d.15.4.1 (A:) Adrenodoxin-like ferredoxin {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-Grasp (ubiquitin-like)
superfamily: 2Fe-2S ferredoxin-like
family: 2Fe-2S ferredoxin-related
domain: Adrenodoxin-like ferredoxin
species: Escherichia coli [TaxId: 562]

Probab=99.80  E-value=3.5e-20  Score=136.67  Aligned_cols=78  Identities=28%  Similarity=0.524  Sum_probs=63.2

Q ss_pred             CeeEEEEeeeeeCCCCCeeEEEEecCCCchHHHHHHHCCCCccCCCCCCCCCCCCCceecccEEE---------------
Q 030608           63 PVVNFAFVHSVLLPDGTPDIHFRTACGGQKLRDIMLNSNIDLYGPYARPLSNCAGGGTCGTCMVE---------------  127 (174)
Q Consensus        63 p~v~~~f~~~v~l~dGt~~v~~~ea~~GetLldaal~~GI~L~~p~~k~~~~CGG~G~CGTC~V~---------------  127 (174)
                      |.|+| +++..++|+|.    .+++..|+|||++++++||++       ++.|||.|+||||+|+               
T Consensus         1 pki~~-~p~~~~~p~g~----~v~~~~G~tLl~aa~~~gi~i-------~~~CgG~g~CgtC~v~v~~G~~~l~~~~~~E   68 (109)
T d1i7ha_           1 PKIVI-LPHQDLCPDGA----VLEANSGETILDAALRNGIEI-------EHACEKSCACTTCHCIVREGFDSLPESSEQE   68 (109)
T ss_dssp             CEEEE-CCBTTTBTTCE----EEECCTTCBHHHHHHHTTCCC-------CCTTSSSSCCSTTEEEEEECGGGSCCCCHHH
T ss_pred             CeEEE-ecCcccCCCCc----EEEeCCCCcHHHHHHHcCCCC-------CcCCCCcceeCCeEEEeecCccccCCCChHH
Confidence            44555 45656678884    246799999999999999999       6689999999999998               


Q ss_pred             ---------cCCCeEEeecceecCCCCCCCeEEEcCCcc
Q 030608          128 ---------KPKNWRLACQTTVGTPDSTGLVVIQQLPEW  157 (174)
Q Consensus       128 ---------~~~g~RLACQ~~v~~~~~~gdv~I~~lpe~  157 (174)
                               ..++||||||+++..    +|++|++ |++
T Consensus        69 ~~~l~~~~~~~~~~RLaCQ~~v~~----~dl~V~l-P~~  102 (109)
T d1i7ha_          69 DDMLDKAWGLEPESRLSCQARVTD----EDLVVEI-PRY  102 (109)
T ss_dssp             HHHHTTCTTCCTTEEETTTCBCCS----SCEEEEC-CSC
T ss_pred             hhhhhccccCCCCeEEEEeeEECC----CCEEEEe-Ccc
Confidence                     347899999999974    5999996 443
>d1e9ma_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Rhodobacter capsulatus, ferredoxin VI [TaxId: 1061]} Back     information, alignment and structure
>d1xlqa1 d.15.4.1 (A:1-106) 2Fe-2S ferredoxin {Pseudomonas putida, putidaredoxin [TaxId: 303]} Back     information, alignment and structure
>d2bt6a1 d.15.4.1 (A:5-108) Adrenodoxin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1b9ra_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Pseudomonas sp., terpredoxin [TaxId: 306]} Back     information, alignment and structure
>d1krha3 d.15.4.2 (A:2-105) Benzoate dioxygenase reductase, N-terminal domain {Acinetobacter sp. [TaxId: 472]} Back     information, alignment and structure
>d1frra_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258]} Back     information, alignment and structure
>d1l5pa_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Trichomonas vaginalis [TaxId: 5722]} Back     information, alignment and structure
>d1frda_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), pcc 7119 and 7120 [TaxId: 1167]} Back     information, alignment and structure
>d1a70a_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1awda_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Chlorella fusca [TaxId: 3073]} Back     information, alignment and structure
>d1iuea_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1czpa_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), pcc 7119 and 7120 [TaxId: 1167]} Back     information, alignment and structure
>d1jq4a_ d.15.4.2 (A:) Methane monooxygenase reductase N-terminal domain {Methylococcus capsulatus [TaxId: 414]} Back     information, alignment and structure
>d2fug33 d.15.4.2 (3:1-95) Nadh-quinone oxidoreductase chain 3, Nqo3, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2piaa3 d.15.4.2 (A:224-321) Phthalate dioxygenase reductase, C-terminal domain {Pseudomonas cepacia, db01 [TaxId: 292]} Back     information, alignment and structure
>d1wria_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258]} Back     information, alignment and structure
>d1doia_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d3c8ya2 d.15.4.2 (A:1-126) Fe-only hydrogenase, N-terminal domain {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1kf6b2 d.15.4.2 (B:1-105) Fumarate reductase iron-sulfur protein, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bs2b2 d.15.4.2 (B:1-106) Fumarate reductase iron-sulfur protein, N-terminal domain {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1t3qa2 d.15.4.2 (A:7-87) Quinoline 2-oxidoreductase small subunit QorS, N-domain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1nekb2 d.15.4.2 (B:1-106) Succinate dehydogenase iron-sulfur protein, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vlba2 d.15.4.2 (A:1-80) Aldehyde oxidoreductase, N-terminal domain {Desulfovibrio gigas [TaxId: 879]} Back     information, alignment and structure
>d1rm6c2 d.15.4.2 (C:1-81) 4-hydroxybenzoyl-CoA reductase gamma subunit HrcC, N-terminal domain {Thauera aromatica [TaxId: 59405]} Back     information, alignment and structure
>d1dgja2 d.15.4.2 (A:1-80) Aldehyde oxidoreductase, N-terminal domain {Desulfovibrio desulfuricans [TaxId: 876]} Back     information, alignment and structure
>d1ffva2 d.15.4.2 (A:3-81) Carbone monoxide (CO) dehydrogenase iron-sulfur protein, N-domain {Hydrogenophaga pseudoflava [TaxId: 47421]} Back     information, alignment and structure
>d1n62a2 d.15.4.2 (A:3-81) Carbone monoxide (CO) dehydrogenase iron-sulfur protein, N-domain {Oligotropha carboxidovorans, formerly Pseudomonas carboxydovorans [TaxId: 40137]} Back     information, alignment and structure
>d1jroa2 d.15.4.2 (A:1-84) Xanthine dehydrogenase chain A, N-terminal domain {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1v97a2 d.15.4.2 (A:3-92) Xanthine oxidase, N-terminal domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ep3b2 c.25.1.3 (B:103-262) Dihydroorotate dehydrogenase B, PyrK subunit {Lactococcus lactis, isozyme B [TaxId: 1358]} Back     information, alignment and structure