Citrus Sinensis ID: 030689

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170---
MAGIRWFGQTHQSVNRRSILGSIQGTVNDGNKKTNNKTATPQFLKFAVSGVTELLRLFSSFDKGVCRLDRVSYKQKDEILVSGIDDIVTILRSDYENAYFVTGIFTSEIYAEDCIFEDPTIRFRGTELYSRNLRLLVPFFEYPSIGLQNIKKVRYFLQIDIVFQLINISWICT
ccccccccccccEEEccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccHHHHHHHHHHHccccccccccEEEEEEEccEEEEEEEEEEEEEccccc
cccEEEEcccccEEcccccEEEEEccccccccccccccccHHHHHHHHHHHHHHHHHHccccccccHHcccccccccccccccHHHHHHHHHHHHHHcEEEEcccccHHcccccEEccccEEEccHHHHHHHHHHHHHHccccccEHccHHHHHcccEHcHHHHHHHHHHHcc
magirwfgqthqsVNRRSILGsiqgtvndgnkktnnktatpQFLKFAVSGVTELLRLFSSfdkgvcrldrvsykqkdeiLVSGIDDIVTILRSDYENAYFVTGIFtseiyaedcifedptirfrgtelysrnlrllvpffeypsiglqniKKVRYFLQIDIVFQLINISWICT
magirwfgqthqsvnrrsilgsiqgtvndgnkktnnktatpQFLKFAVSGVTELLRLFssfdkgvcrldrvsykqkdeilvsgiDDIVTILRSDYENAYFVTGIFTSEIYAEDCIFEDPTIRFRGTELYSRNLRLLVPFFEYPSIGLQNIKKVRYFLQIDIVFQLINISWICT
MAGIRWFGQTHQSVNRRSILGSIQGTVNDGNKKTNNKTATPQFLKFAVSGVTELLRLFSSFDKGVCRLDRVSYKQKDEILVSGIDDIVTILRSDYENAYFVTGIFTSEIYAEDCIFEDPTIRFRGTELYSRNLRLLVPFFEYPSIGLQNIKKVRYFLQIDIVFQLINISWICT
*****WFG*******************************TPQFLKFAVSGVTELLRLFSSFDKGVCRLDRVSYKQKDEILVSGIDDIVTILRSDYENAYFVTGIFTSEIYAEDCIFEDPTIRFRGTELYSRNLRLLVPFFEYPSIGLQNIKKVRYFLQIDIVFQLINISWIC*
*********************************************FAVSGVTELLR******************************IVTILRSDYENAYFVTGIFTSEIYAEDCIFEDPTIRFRGTELYSRNLRLLVPFFEYPSIGLQNIKKVRYFLQIDIVFQLINISWICT
MAGIRWFGQTHQSVNRRSILGSIQGTVNDGNKKTNNKTATPQFLKFAVSGVTELLRLFSSFDKGVCRLDRVSYKQKDEILVSGIDDIVTILRSDYENAYFVTGIFTSEIYAEDCIFEDPTIRFRGTELYSRNLRLLVPFFEYPSIGLQNIKKVRYFLQIDIVFQLINISWICT
*AGIRWFGQTHQSVNRRSILGSIQGTVND*********ATPQFLKFAVSGVTELLRLFSS*******************LVSGIDDIVTILRSDYENAYFVTGIFTSEIYAEDCIFEDPTIRFRGTELYSRNLRLLVPFFEYPSIGLQNIKKVRYFLQIDIVFQLINISWICT
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAGIRWFGQTHQSVNRRSILGSIQGTVNDGNKKTNNKTATPQFLKFAVSGVTELLRLFSSFDKGVCRLDRVSYKQKDEILVSGIDDIVTILRSDYENAYFVTGIFTSEIYAEDCIFEDPTIRFRGTELYSRNLRLLVPFFEYPSIGLQNIKKVRYFLQIDIVFQLINISWICT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query173
298204898216 unnamed protein product [Vitis vinifera] 0.838 0.671 0.592 1e-40
225451265242 PREDICTED: uncharacterized protein LOC10 0.664 0.475 0.711 2e-40
449442907217 PREDICTED: uncharacterized protein LOC10 0.693 0.552 0.606 6e-34
351720803255 uncharacterized protein LOC100306700 [Gl 0.728 0.494 0.528 7e-31
357441471238 hypothetical protein MTR_1g081280 [Medic 0.664 0.483 0.577 3e-29
357441473252 hypothetical protein MTR_1g081280 [Medic 0.664 0.456 0.577 4e-29
297828994216 predicted protein [Arabidopsis lyrata su 0.820 0.657 0.509 6e-29
21537187216 unknown [Arabidopsis thaliana] 0.647 0.518 0.575 1e-28
18397041216 uncharacterized protein [Arabidopsis tha 0.647 0.518 0.575 1e-28
186509771221 uncharacterized protein [Arabidopsis tha 0.647 0.506 0.575 2e-28
>gi|298204898|emb|CBI34205.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  170 bits (431), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 90/152 (59%), Positives = 109/152 (71%), Gaps = 7/152 (4%)

Query: 1   MAGIRWFGQTHQSVNRRSILGSIQGTVNDGNKKTNNKTATPQFLKFAVSGVTELLRLFSS 60
           MAGI        +++ R  +  I+      +   +NK  TPQ L+ AV GVTELLRL S 
Sbjct: 1   MAGIWCSSTVSSTLHLRKRVHGIRCC----STTPDNKEKTPQLLRIAVGGVTELLRLVSF 56

Query: 61  FDKGVCRLDRVSYKQKDEILVSGIDDIVTILRSDYENAYFVTGIFTSEIYAEDCIFEDPT 120
              G  RLD +SYKQ DE+LVS IDD++ IL+SDYENAYFVTGIFTS IY EDCIFEDPT
Sbjct: 57  ---GQNRLDSMSYKQGDELLVSCIDDVLLILKSDYENAYFVTGIFTSAIYDEDCIFEDPT 113

Query: 121 IRFRGTELYSRNLRLLVPFFEYPSIGLQNIKK 152
           I+FRG +LYSRNL+LLVPFF++PSI LQ I+K
Sbjct: 114 IKFRGKDLYSRNLKLLVPFFDHPSIALQKIEK 145

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225451265|ref|XP_002272524.1| PREDICTED: uncharacterized protein LOC100264176 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449442907|ref|XP_004139222.1| PREDICTED: uncharacterized protein LOC101220191 [Cucumis sativus] gi|449482948|ref|XP_004156451.1| PREDICTED: uncharacterized LOC101220191 [Cucumis sativus] Back     alignment and taxonomy information
>gi|351720803|ref|NP_001235141.1| uncharacterized protein LOC100306700 [Glycine max] gi|255629317|gb|ACU15003.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|357441471|ref|XP_003591013.1| hypothetical protein MTR_1g081280 [Medicago truncatula] gi|355480061|gb|AES61264.1| hypothetical protein MTR_1g081280 [Medicago truncatula] Back     alignment and taxonomy information
>gi|357441473|ref|XP_003591014.1| hypothetical protein MTR_1g081280 [Medicago truncatula] gi|355480062|gb|AES61265.1| hypothetical protein MTR_1g081280 [Medicago truncatula] Back     alignment and taxonomy information
>gi|297828994|ref|XP_002882379.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297328219|gb|EFH58638.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|21537187|gb|AAM61528.1| unknown [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|18397041|ref|NP_566242.1| uncharacterized protein [Arabidopsis thaliana] gi|13878017|gb|AAK44086.1|AF370271_1 unknown protein [Arabidopsis thaliana] gi|17104639|gb|AAL34208.1| unknown protein [Arabidopsis thaliana] gi|332640630|gb|AEE74151.1| uncharacterized protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|186509771|ref|NP_001118575.1| uncharacterized protein [Arabidopsis thaliana] gi|227202522|dbj|BAH56734.1| AT3G04890 [Arabidopsis thaliana] gi|332640631|gb|AEE74152.1| uncharacterized protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query173
TAIR|locus:2114875221 AT3G04890 "AT3G04890" [Arabido 0.647 0.506 0.575 4.4e-29
TAIR|locus:2062989240 AT2G46100 "AT2G46100" [Arabido 0.265 0.191 0.413 0.00014
TAIR|locus:2114875 AT3G04890 "AT3G04890" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 323 (118.8 bits), Expect = 4.4e-29, P = 4.4e-29
 Identities = 65/113 (57%), Positives = 79/113 (69%)

Query:    40 TPQFLKFAVSGVTELLRLFSSFDKGVCRLDRVSYKQKDEILVSGIDDIVTILRSDYENAY 99
             TP  LK+AVSGVTE LRL S              + K+E+    +DD++ ILRSDY N Y
Sbjct:    34 TPAVLKWAVSGVTEFLRLISGAPSSTSIATNKD-RSKNEVTAGDVDDVMGILRSDYRNFY 92

Query:   100 FVTGIFTSEIYAEDCIFEDPTIRFRGTELYSRNLRLLVPFFEYPSIGLQNIKK 152
             FVTG+ TS IY++DCIFEDPTI F+GTELY RNL+LLVPF E  SI LQN++K
Sbjct:    93 FVTGVLTSAIYSDDCIFEDPTISFQGTELYERNLKLLVPFLEDASIELQNMEK 145
GO:0003674 "molecular_function" evidence=ND
GO:0005634 "nucleus" evidence=ISM
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2062989 AT2G46100 "AT2G46100" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
Al_scaffold_0003_445
annotation not avaliable (216 aa)
(Arabidopsis lyrata)
Predicted Functional Partners:
fgenesh2_kg.4__831__AT2G28605.1
annotation not avaliable (240 aa)
  ••    0.507
scaffold_400128.1
annotation not avaliable (333 aa)
  •     0.506
fgenesh2_kg.7__863__AT4G32770.1
annotation not avaliable (482 aa)
  •     0.506
fgenesh2_kg.2__1463__AT1G72030.1
annotation not avaliable (257 aa)
  •     0.506
scaffold_602917.1
annotation not avaliable (341 aa)
  •     0.505
fgenesh2_kg.8__1157__AT5G52780.1
annotation not avaliable (166 aa)
  •     0.504
fgenesh2_kg.6__2705__AT5G27560.1
annotation not avaliable (340 aa)
  ••    0.502
fgenesh2_kg.4__2829__AT2G46220.1
annotation not avaliable (237 aa)
  •     0.500
fgenesh1_pg.C_scaffold_9000152
annotation not avaliable (174 aa)
  •     0.497
fgenesh2_kg.6__2785__AT5G28500.1
annotation not avaliable (435 aa)
  •     0.494

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query173
pfam10184113 pfam10184, DUF2358, Uncharacterized conserved prot 1e-10
>gnl|CDD|220621 pfam10184, DUF2358, Uncharacterized conserved protein (DUF2358) Back     alignment and domain information 
 Score = 55.7 bits (135), Expect = 1e-10
 Identities = 24/72 (33%), Positives = 33/72 (45%), Gaps = 6/72 (8%)

Query: 85  DDIVTILRSDYENAYFVTGIFTSEIYAEDCIFEDPTIRFRGTELYSRN---LRLLVP-FF 140
            D +  LR D     F        IY++D  FEDP  +FRG + Y RN   +R L   FF
Sbjct: 1   ADAIEALREDLPR-LFPKDQ-DYSIYSDDVYFEDPLNKFRGIDRYKRNFWLIRFLGRLFF 58

Query: 141 EYPSIGLQNIKK 152
               + L +I +
Sbjct: 59  ADIRLELHDITQ 70

DUF2358 is a family of conserved proteins found from plants to humans. The function is unknown. Length = 113

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 173
PF10184113 DUF2358: Uncharacterized conserved protein (DUF235 99.87
PF12680102 SnoaL_2: SnoaL-like domain; PDB: 3F40_A 3RGA_A 3G8 98.17
TIGR02096129 conserved hypothetical protein, steroid delta-isom 97.77
PF07366126 SnoaL: SnoaL-like polyketide cyclase; InterPro: IP 97.52
cd00781122 ketosteroid_isomerase ketosteroid isomerase: Many 97.48
KOG4457202 consensus Uncharacterized conserved protein [Funct 96.75
COG4319137 Ketosteroid isomerase homolog [Function unknown] 94.06
PF13474121 SnoaL_3: SnoaL-like domain; PDB: 2GXF_A 3KSP_A 3KE 93.89
PF14534107 DUF4440: Domain of unknown function (DUF4440); PDB 93.06
TIGR02246128 conserved hypothetical protein. This family consis 92.85
PF07858125 LEH: Limonene-1,2-epoxide hydrolase catalytic doma 92.66
PRK08241339 RNA polymerase factor sigma-70; Validated 89.56
TIGR02960324 SigX5 RNA polymerase sigma-70 factor, TIGR02960 fa 85.71
cd00531124 NTF2_like Nuclear transport factor 2 (NTF2-like) s 84.1
>PF10184 DUF2358: Uncharacterized conserved protein (DUF2358); InterPro: IPR018790 This entry represents a family of conserved proteins Back     alignment and domain information 
Probab=99.87  E-value=8.2e-22  Score=149.04  Aligned_cols=80  Identities=33%  Similarity=0.580  Sum_probs=75.7

Q ss_pred             HHHHHHHHhhhhhccccccccccccccceeeeCCCCcccchHHHHHH---HHhhcc-ccCCCceEEEEEEeeCc-EEEEE
Q 030689           86 DIVTILRSDYENAYFVTGIFTSEIYAEDCIFEDPTIRFRGTELYSRN---LRLLVP-FFEYPSIGLQNIKKVRY-FLQID  160 (173)
Q Consensus        86 ~v~~~Lr~Dy~~~Yfvtg~~t~~IYa~D~~F~DPfn~F~G~dryk~~---l~~m~~-~f~~prf~L~di~~s~~-~~~lr  160 (173)
                      +++++||+||+++|  +|+++++||++||+|+||+++|+|+++|++|   +++++. +|.+++++|+++.+.++ .+.+|
T Consensus         2 ~~~~~Lr~D~~~~f--~~~~~~~iY~~dv~F~Dp~~~f~g~~~Y~~~~~~l~~l~~~~~~~~~~~v~~i~~~~~~~I~~r   79 (113)
T PF10184_consen    2 DVIRTLREDLPRFF--TGDLDYSIYDEDVVFIDPIVSFKGLDRYKRNLWALRFLGRLFFSDPSLEVLSIEQDGEDTIRAR   79 (113)
T ss_pred             hHHHHHHHHHHHHh--cCCCChhhcCCCeEEECCCCceecHHHHHHHHHHHHHHHhhccCCcEEEEEEEEECCCCEEEEE
Confidence            68999999999876  9999999999999999999999999999999   999998 89999999999999986 99999


Q ss_pred             EEEEeee
Q 030689          161 IVFQLIN  167 (173)
Q Consensus       161 W~F~~~~  167 (173)
                      |++.+..
T Consensus        80 W~~~g~~   86 (113)
T PF10184_consen   80 WRLRGVP   86 (113)
T ss_pred             EEEEEEe
Confidence            9998753

The function is unknown.
>PF12680 SnoaL_2: SnoaL-like domain; PDB: 3F40_A 3RGA_A 3G8Z_A 3DMC_A 3FH1_A 1TUH_A 3F14_A 3ER7_A 1Z1S_A 3F7X_A Back     alignment and domain information
>TIGR02096 conserved hypothetical protein, steroid delta-isomerase-related Back     alignment and domain information
>PF07366 SnoaL: SnoaL-like polyketide cyclase; InterPro: IPR009959 This domain is found in SnoaL [] a polyketide cyclase involved in nogalamycin biosynthesis Back     alignment and domain information
>cd00781 ketosteroid_isomerase ketosteroid isomerase: Many biological reactions proceed by enzymatic cleavage of a C-H bond adjacent to carbonyl or a carboxyl group, leading to an enol or a enolate intermediate that is subsequently re-protonated at the same or an adjacent carbon Back     alignment and domain information
>KOG4457 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG4319 Ketosteroid isomerase homolog [Function unknown] Back     alignment and domain information
>PF13474 SnoaL_3: SnoaL-like domain; PDB: 2GXF_A 3KSP_A 3KE7_A 3BB9_E 3CNX_A 3F7S_A 3GWR_B Back     alignment and domain information
>PF14534 DUF4440: Domain of unknown function (DUF4440); PDB: 3HX8_A 3SOY_A 3ROB_B 3GZR_A 3B7C_A 3CU3_A 3FSD_A 2R4I_C 1TP6_A Back     alignment and domain information
>TIGR02246 conserved hypothetical protein Back     alignment and domain information
>PF07858 LEH: Limonene-1,2-epoxide hydrolase catalytic domain; InterPro: IPR013100 Epoxide hydrolases catalyse the hydrolysis of epoxides to corresponding diols, which is important in detoxification, synthesis of signal molecules, or metabolism Back     alignment and domain information
>PRK08241 RNA polymerase factor sigma-70; Validated Back     alignment and domain information
>TIGR02960 SigX5 RNA polymerase sigma-70 factor, TIGR02960 family Back     alignment and domain information
>cd00531 NTF2_like Nuclear transport factor 2 (NTF2-like) superfamily Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query173
3dxo_A121 Uncharacterized snoal-like protein; putative isome 98.5
4h3u_A158 Hypothetical protein; structural genomics, PSI-bio 98.14
3hk4_A136 MLR7391 protein; NTF2-like protein, structural gen 98.1
2gex_A152 SNOL; alpha+beta barrel, oxidoreductase; 2.50A {St 98.07
2gey_A158 ACLR protein; alpha+beta barrel, oxidoreductase; H 98.03
2a15_A139 Hypothetical protein RV0760C; beta-alpha-barrel, s 98.02
3fh1_A129 Uncharacterized NTF2-like protein; structural geno 97.95
3k0z_A159 Putative polyketide cyclase; structural genomics, 97.89
3ebt_A132 Uncharacterized NTF2-like protein; structural geno 97.89
1sjw_A144 Nogalonic acid methyl ester cyclase; anthracycline 97.88
2f99_A153 Aklanonic acid methyl ester cyclase, AKNH; anthrac 97.88
3h3h_A122 Uncharacterized snoal-like protein; structural gen 97.85
3mso_A143 Steroid delta-isomerase; structural genomics, join 97.83
1oh0_A131 Steroid delta-isomerase; ketosteroid isomerase, KS 97.82
1ohp_A125 Steroid delta-isomerase; inhibitor; HET: ESR; 1.53 97.78
3f9s_A146 Putative polyketide cyclase; structural genomics, 97.77
3ehc_A128 Snoal-like polyketide cyclase; structural genomics 97.77
3kkg_A146 Putative snoal-like polyketide cyclase; structural 97.74
3hx8_A129 MLR2180 protein, putative ketosteroid isomerase; s 97.54
3rga_A283 Epoxide hydrolase; NTF2-like, epoxide-opening cycl 97.51
3f8x_A148 Putative delta-5-3-ketosteroid isomerase; structur 97.49
3ec9_A140 Uncharacterized NTF2-like protein; structural geno 97.46
3fgy_A135 Uncharacterized NTF2-like protein; structural geno 97.43
3g0k_A148 Putative membrane protein; snoal-like polyketide c 97.42
1nww_A149 Limonene-1,2-epoxide hydrolase; HET: MES; 1.20A {R 97.37
3ff2_A117 Uncharacterized cystatin fold protein (YP_497570. 97.36
3rga_A 283 Epoxide hydrolase; NTF2-like, epoxide-opening cycl 97.35
1s5a_A150 Hypothetical protein YESE; structural genomics, PS 97.34
3dm8_A143 Uncharacterized protein RPA4348; siras, putative i 97.31
3ke7_A134 Putative ketosteroid isomerase; structural genomic 97.25
3g8z_A148 Protein of unknown function with cystatin-like FO; 97.23
2k54_A123 Protein ATU0742; protein of unknown function, stru 97.13
3g16_A156 Uncharacterized protein with cystatin-like fold; Y 97.09
1z1s_A163 Hypothetical protein PA3332; beta barrel, conserve 97.06
3d9r_A135 Ketosteroid isomerase-like protein; YP_049581.1, s 96.97
1tuh_A156 BAL32A, hypothetical protein EGC068; unknown funct 96.87
3er7_A131 Uncharacterized NTF2-like protein; YP_001812677.1, 96.85
3h51_A156 Putative calcium/calmodulin dependent protein KIN 96.7
3i0y_A140 Putative polyketide cyclase; cystatin-like fold, s 96.67
3rob_A139 Uncharacterized conserved protein; structural geno 96.66
1tp6_A128 Hypothetical protein PA1314; structural genomics, 96.58
3dmc_A134 NTF2-like protein; structural genomics, joint cent 96.56
3grd_A134 Uncharacterized NTF2-superfamily protein; NP_97724 96.55
2bng_A149 MB2760; epoxide hydrolase, limonene, hydrolase, st 96.51
3f14_A112 Uncharacterized NTF2-like protein; YP_680363.1, NT 96.38
3f7x_A151 Putative polyketide cyclase; structural genomics, 96.31
3bb9_A148 Putative orphan protein; structural genomics, join 96.28
3flj_A155 Uncharacterized protein conserved in bacteria WIT 96.22
3f7s_A142 Uncharacterized NTF2-like protein; structural geno 95.58
3f8h_A150 Putative polyketide cyclase; structural genomics, 95.41
3f40_A114 Uncharacterized NTF2-like protein; YP_677363.1, NT 95.4
3en8_A128 Uncharacterized NTF-2 like protein; YP_553245.1, N 95.36
2gxf_A142 Hypothetical protein YYBH; alpha-beta protein., st 95.32
3jum_A185 Phenazine biosynthesis protein A/B; chirality, dru 94.84
2ux0_A143 Calcium-calmodulin dependent protein kinase (CAM I 93.76
3gwr_A144 Putative calcium/calmodulin-dependent protein KIN 93.69
2rfr_A155 Uncharacterized protein; structural genomics, join 92.13
3gzr_A146 Uncharacterized protein with A NTF2-like fold; str 92.12
3b7c_A122 Uncharacterized protein; NTF-2 like protein, struc 92.0
3cu3_A172 Domain of unknown function with A cystatin-like F; 91.15
3ff0_A163 Phenazine biosynthesis protein PHZB 2; cystatin-li 90.35
2chc_A170 Protein RV3472; hypothetical protein; 1.69A {Mycob 89.94
3b8l_A163 Uncharacterized protein; putative aromatic ring hy 87.64
3fsd_A134 NTF2-like protein of unknown function in nutrient; 87.42
3ef8_A150 Putative scyalone dehydratase; YP_496742.1, struct 86.74
3a76_A176 Gamma-hexachlorocyclohexane dehydrochlorinase; bar 86.58
3ecf_A130 NTF2-like protein; structural genomics, joint cent 86.38
2rgq_A144 Domain of unknown function with A cystatin-like F; 86.1
2r4i_A123 Uncharacterized protein; NTF2-like protein, struct 84.99
3lyg_A120 NTF2-like protein of unknown function; structural 82.93
4i4k_A143 Uncharacterized protein SGCJ; structural genomics, 82.42
3cnx_A170 Uncharacterized protein; putative dehydratase, NTF 82.21
>3dxo_A Uncharacterized snoal-like protein; putative isomerase of the snoal-like family; HET: MSE PGE; 2.70A {Agrobacterium tumefaciens str} SCOP: d.17.4.19 Back     alignment and structure
Probab=98.50  E-value=1.4e-07  Score=68.95  Aligned_cols=60  Identities=13%  Similarity=0.122  Sum_probs=56.6

Q ss_pred             ccccccccceeeeCCCCcccchHHHHHHHHhhccccCCCceEEE-EEEeeCcEEEEEEEEE
Q 030689          105 FTSEIYAEDCIFEDPTIRFRGTELYSRNLRLLVPFFEYPSIGLQ-NIKKVRYFLQIDIVFQ  164 (173)
Q Consensus       105 ~t~~IYa~D~~F~DPfn~F~G~dryk~~l~~m~~~f~~prf~L~-di~~s~~~~~lrW~F~  164 (173)
                      .+.++|++|+.|.||...++|++.+++.+..+...+.+.+|+++ .+...++.+.++|++.
T Consensus        27 ~l~~l~a~D~~~~dP~~~~~G~~ai~~~~~~~~~~~~~~~f~~~~~~~~~~~~~~~~w~~~   87 (121)
T 3dxo_A           27 LVGQAWAENTRYVDPLMQGEGQQGIAAMIEAARQKFPGYRFVLAGTPDGHGNFTRFSWRLI   87 (121)
T ss_dssp             HHHHHEEEEEEEECSSCEEEHHHHHHHHHHHHHHHSTTCEEEEEEEEEEETTEEEEEEEEE
T ss_pred             HHHHhcCCCeEEECCCCCcCCHHHHHHHHHHHHHHCCCcEEEEccCcceeCCEEEEEEEEe
Confidence            57899999999999999999999999999999999999999999 7888899999999986
>4h3u_A Hypothetical protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 1.15A {Catenulispora acidiphila} Back     alignment and structure
>3hk4_A MLR7391 protein; NTF2-like protein, structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2, lyase; HET: MSE; 1.96A {Mesorhizobium loti} Back     alignment and structure
>2gex_A SNOL; alpha+beta barrel, oxidoreductase; 2.50A {Streptomyces nogalater} SCOP: d.17.4.9 Back     alignment and structure
>2gey_A ACLR protein; alpha+beta barrel, oxidoreductase; HET: PG4; 1.80A {Streptomyces galilaeus} SCOP: d.17.4.9 Back     alignment and structure
>2a15_A Hypothetical protein RV0760C; beta-alpha-barrel, structural genomics, PSI, protein structure initiative; 1.68A {Mycobacterium tuberculosis} SCOP: d.17.4.3 PDB: 2z76_A* 2z77_A* 2z7a_A Back     alignment and structure
>3fh1_A Uncharacterized NTF2-like protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 1.60A {Mesorhizobium loti} Back     alignment and structure
>3k0z_A Putative polyketide cyclase; structural genomics, joint CENT structural genomics, JCSG, protein structure initiative, PS lipoprotein; HET: NHE; 1.91A {Bacillus cereus} Back     alignment and structure
>3ebt_A Uncharacterized NTF2-like protein; structural genomics, joint center for structural genomics, J protein structure initiative; 1.30A {Burkholderia pseudomallei K96243} SCOP: d.17.4.9 Back     alignment and structure
>1sjw_A Nogalonic acid methyl ester cyclase; anthracyclines, nogalamycin, snoal, aldol condensation, LYAS structural genomics; HET: NGV; 1.35A {Streptomyces nogalater} SCOP: d.17.4.9 Back     alignment and structure
>2f99_A Aklanonic acid methyl ester cyclase, AKNH; anthracycline,polyketide cyclase,stereoselectivity, aklavino biosynthetic protein; HET: AKV; 1.90A {Streptomyces galilaeus} SCOP: d.17.4.9 PDB: 2f98_A* Back     alignment and structure
>3h3h_A Uncharacterized snoal-like protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE UNL MES; 1.60A {Burkholderia thailandensis E264} Back     alignment and structure
>3mso_A Steroid delta-isomerase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 2.57A {Pseudomonas aeruginosa} Back     alignment and structure
>1oh0_A Steroid delta-isomerase; ketosteroid isomerase, KSI, equilenin, PI, LBHB; HET: EQU; 1.1A {Pseudomonas putida} SCOP: d.17.4.3 PDB: 1e3v_A* 1opy_A 1dmq_A 1dmm_A 1ea2_A 3cpo_A 1e3r_A* 1ogx_A 2inx_A 2pzv_A 1c7h_A 1dmn_A 1k41_A 1oho_A* 3fzw_A* 1cqs_A* 1w00_A 1e97_A 1w6y_A* 3ipt_A* ... Back     alignment and structure
>1ohp_A Steroid delta-isomerase; inhibitor; HET: ESR; 1.53A {Pseudomonas testosteroni} SCOP: d.17.4.3 PDB: 1qjg_A* 8cho_A* 1ohs_A* 1ocv_A 1isk_A 3nuv_A* 1ogz_A* 3nhx_A* 3m8c_A* 3nxj_A* 3myt_A* 3mki_A 3mhe_A 1buq_A* 3nbr_A* 3t8u_A 3ov4_A* 3nm2_A Back     alignment and structure
>3f9s_A Putative polyketide cyclase; structural genomics, joint center for structural genomics, J protein structure initiative; 1.76A {Acidithiobacillus ferrooxidans atcc 23} Back     alignment and structure
>3ehc_A Snoal-like polyketide cyclase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.12A {Agrobacterium tumefaciens str} Back     alignment and structure
>3kkg_A Putative snoal-like polyketide cyclase; structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2, lyase; HET: MSE PGE; 1.40A {Jannaschia SP} Back     alignment and structure
>3hx8_A MLR2180 protein, putative ketosteroid isomerase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; HET: MSE UNL PG4; 1.45A {Mesorhizobium loti} Back     alignment and structure
>3rga_A Epoxide hydrolase; NTF2-like, epoxide-opening cyclic ether formation, isomerase; HET: LSB ILD; 1.59A {Streptomyces lasaliensis} Back     alignment and structure
>3f8x_A Putative delta-5-3-ketosteroid isomerase; structural genomics, joint center for structural genomics; HET: MSE; 1.55A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>3ec9_A Uncharacterized NTF2-like protein; structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.60A {Burkholderia thailandensis E264} SCOP: d.17.4.10 Back     alignment and structure
>3fgy_A Uncharacterized NTF2-like protein; structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.59A {Burkholderia xenovorans LB400} SCOP: d.17.4.0 Back     alignment and structure
>3g0k_A Putative membrane protein; snoal-like polyketide cyclase, structural genomics, joint CE structural genomics, JCSG; HET: MSE; 1.30A {Novosphingobium aromaticivorans} Back     alignment and structure
>1nww_A Limonene-1,2-epoxide hydrolase; HET: MES; 1.20A {Rhodococcus erythropolis} SCOP: d.17.4.8 PDB: 1nu3_A* Back     alignment and structure
>3ff2_A Uncharacterized cystatin fold protein (YP_497570. NTF2 superfamily; structural genomics; 1.90A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID} Back     alignment and structure
>3rga_A Epoxide hydrolase; NTF2-like, epoxide-opening cyclic ether formation, isomerase; HET: LSB ILD; 1.59A {Streptomyces lasaliensis} Back     alignment and structure
>1s5a_A Hypothetical protein YESE; structural genomics, PSI, protein STRU initiative, midwest center for structural genomics, MCSG, U function; 1.70A {Bacillus subtilis} SCOP: d.17.4.10 Back     alignment and structure
>3dm8_A Uncharacterized protein RPA4348; siras, putative isomerase, structural genomics, PSI-2, prote structure initiative; HET: CE9; 1.80A {Rhodopseudomonas palustris} SCOP: d.17.4.20 Back     alignment and structure
>3ke7_A Putative ketosteroid isomerase; structural genomics, joint C structural genomics, JCSG, protein structure initiative; HET: MSE BCN; 1.45A {Parabacteroides distasonis atcc 8503} Back     alignment and structure
>3g8z_A Protein of unknown function with cystatin-like FO; NP_639274.1, snoal-like polyketide cyclase; HET: MSE; 1.90A {Xanthomonas campestris PV} Back     alignment and structure
>2k54_A Protein ATU0742; protein of unknown function, structural genomics, PSI-2, Pro structure initiative; NMR {Agrobacterium tumefaciens str} SCOP: d.17.4.29 Back     alignment and structure
>3g16_A Uncharacterized protein with cystatin-like fold; YP_001022489.1, protein of unknown function with cystatin-LI structural genomics; HET: MSE; 1.45A {Methylibium petroleiphilum PM1} Back     alignment and structure
>1z1s_A Hypothetical protein PA3332; beta barrel, conserved hypothetical protein, structural genomics, PSI, protein structure initiative; HET: PGE; 1.49A {Pseudomonas aeruginosa PAO1} SCOP: d.17.4.10 Back     alignment and structure
>3d9r_A Ketosteroid isomerase-like protein; YP_049581.1, structural joint center for structural genomics, JCSG, protein structu initiative; HET: MSE; 2.40A {Pectobacterium atrosepticum} SCOP: d.17.4.27 Back     alignment and structure
>1tuh_A BAL32A, hypothetical protein EGC068; unknown function; 1.85A {Uncultured bacterium} SCOP: d.17.4.11 Back     alignment and structure
>3er7_A Uncharacterized NTF2-like protein; YP_001812677.1, NTF2-like protein of unknown function, struc genomics; HET: MSE; 1.50A {Exiguobacterium sibiricum 255-15} SCOP: d.17.4.24 Back     alignment and structure
>3h51_A Putative calcium/calmodulin dependent protein KIN association domain; NP_636218.1; HET: MSE PG4; 1.70A {Xanthomonas campestris PV} Back     alignment and structure
>3i0y_A Putative polyketide cyclase; cystatin-like fold, structural genomics, joint center for ST genomics, JCSG, protein structure initiative; HET: MSE UNL; 1.50A {Xanthomonas campestris PV} Back     alignment and structure
>3rob_A Uncharacterized conserved protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics; 1.48A {Planctomyces limnophilus} Back     alignment and structure
>1tp6_A Hypothetical protein PA1314; structural genomics, alpha-beta sandwich, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa PAO1} SCOP: d.17.4.12 Back     alignment and structure
>3dmc_A NTF2-like protein; structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2, unknow function; 1.65A {Anabaena variabilis atcc 29413} SCOP: d.17.4.10 Back     alignment and structure
>3grd_A Uncharacterized NTF2-superfamily protein; NP_977240.1, NTF2-superfamily protein with unknown function, structural genomics; HET: MSE; 1.25A {Bacillus cereus atcc 10987} SCOP: d.17.4.0 Back     alignment and structure
>2bng_A MB2760; epoxide hydrolase, limonene, hydrolase, structural proteomics in europe, spine, structural genomics; 2.5A {Mycobacterium tuberculosis} SCOP: d.17.4.8 Back     alignment and structure
>3f14_A Uncharacterized NTF2-like protein; YP_680363.1, NTF2-like protein of unknown function, structur genomics; HET: MSE TRS PGE; 1.45A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>3f7x_A Putative polyketide cyclase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL; 1.24A {Pseudomonas putida KT2440} Back     alignment and structure
>3bb9_A Putative orphan protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 1.80A {Shewanella frigidimarina} SCOP: d.17.4.16 Back     alignment and structure
>3flj_A Uncharacterized protein conserved in bacteria WIT cystatin-like fold; YP_168589.1; HET: MSE; 2.00A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>3f7s_A Uncharacterized NTF2-like protein; structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2; 2.11A {Pseudomonas putida KT2440} Back     alignment and structure
>3f8h_A Putative polyketide cyclase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, unknown function; HET: MSE; 2.00A {Silicibacter SP} Back     alignment and structure
>3f40_A Uncharacterized NTF2-like protein; YP_677363.1, NTF2-like protein of unknown function, structural genomics; HET: MSE; 1.27A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>3en8_A Uncharacterized NTF-2 like protein; YP_553245.1, NTF-2 like protein of unknown function, structu genomics; HET: MSE PG4; 1.85A {Burkholderia xenovorans LB400} SCOP: d.17.4.20 Back     alignment and structure
>2gxf_A Hypothetical protein YYBH; alpha-beta protein., structural genomics, PSI, protein structure initiative; HET: MES; 3.10A {Bacillus subtilis} SCOP: d.17.4.22 Back     alignment and structure
>3jum_A Phenazine biosynthesis protein A/B; chirality, drug design, medicinal CH inhibitor, biosynthetic protein; HET: AOD; 1.45A {Burkholderia SP} PDB: 3b4o_A* 3b4p_A* 3dzl_A* 3ex9_A 3cnm_A* 3jun_A* 3juo_A* 3jup_A* 3juq_A* Back     alignment and structure
>2ux0_A Calcium-calmodulin dependent protein kinase (CAM II gamma; transferase, oligomerisation DOM serine- threonine kinase, ATP-binding; 2.46A {Homo sapiens} SCOP: d.17.4.7 PDB: 2w2c_A 1hkx_A* Back     alignment and structure
>3gwr_A Putative calcium/calmodulin-dependent protein KIN II association domain; YP_315894.1; HET: MSE PG4; 2.01A {Thiobacillus denitrificans atcc 25259} Back     alignment and structure
>2rfr_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.16A {Novosphingobium aromaticivorans} SCOP: d.17.4.28 Back     alignment and structure
>3gzr_A Uncharacterized protein with A NTF2-like fold; structural genomics, joint center for struct genomics, JCSG, protein structure initiative; HET: MSE GOL; 1.40A {Caulobacter vibrioides} Back     alignment and structure
>3b7c_A Uncharacterized protein; NTF-2 like protein, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.70A {Shewanella oneidensis} SCOP: d.17.4.16 Back     alignment and structure
>3cu3_A Domain of unknown function with A cystatin-like F; structural genomics, joint center for structural genomics, J protein structure initiative; 2.00A {Nostoc punctiforme} SCOP: d.17.4.28 Back     alignment and structure
>3ff0_A Phenazine biosynthesis protein PHZB 2; cystatin-like fold, antibiotic biosynthesis, virulence, STRU genomics; 1.90A {Pseudomonas aeruginosa} Back     alignment and structure
>2chc_A Protein RV3472; hypothetical protein; 1.69A {Mycobacterium tuberculosis} SCOP: d.17.4.25 Back     alignment and structure
>3b8l_A Uncharacterized protein; putative aromatic ring hydroxylase, structural genomics, JOI for structural genomics, JCSG; HET: MSE; 1.75A {Novosphingobium aromaticivorans} SCOP: d.17.4.28 Back     alignment and structure
>3fsd_A NTF2-like protein of unknown function in nutrient; YP_427473.1, NTF2-like protein of unknown function in nutrie uptake; HET: UNL; 1.70A {Rhodospirillum rubrum atcc 11170} SCOP: d.17.4.0 Back     alignment and structure
>3ef8_A Putative scyalone dehydratase; YP_496742.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE PG4; 1.50A {Novosphingobium aromaticivorans DSM12444} SCOP: d.17.4.28 Back     alignment and structure
>3a76_A Gamma-hexachlorocyclohexane dehydrochlorinase; barrel fold, lyase, detoxification; HET: SPD; 2.25A {Sphingomonas paucimobilis} Back     alignment and structure
>3ecf_A NTF2-like protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.90A {Anabaena variabilis atcc 29413} SCOP: d.17.4.21 Back     alignment and structure
>2rgq_A Domain of unknown function with A cystatin-like F; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 1.80A {Nostoc punctiforme} SCOP: d.17.4.25 Back     alignment and structure
>2r4i_A Uncharacterized protein; NTF2-like protein, structural genomics, joint center for STR genomics, JCSG; HET: MSE CIT; 1.60A {Cytophaga hutchinsonii atcc 33406} SCOP: d.17.4.15 Back     alignment and structure
>3lyg_A NTF2-like protein of unknown function; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE GOL; 1.61A {Colwellia psychrerythraea} Back     alignment and structure
>4i4k_A Uncharacterized protein SGCJ; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: CIT PG4 1PE; 1.70A {Streptomyces globisporus} Back     alignment and structure
>3cnx_A Uncharacterized protein; putative dehydratase, NTF2-like protein, structural genomics center for structural genomics, JCSG; HET: MSE PGE PG6; 2.10A {Streptomyces avermitilis} SCOP: d.17.4.17 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query173
d3dxoa1117 Uncharacterized protein Atu0744 {Agrobacterium tum 98.61
d2gexa1138 Nogalamycin biosynthesis protein SnoL {Streptomyce 98.0
d2geya1144 Putative hydroxylase AclR {Streptomyces galilaeus 97.75
d3ebta1131 Uncharacterized protein BPSS0132 {Burkholderia pse 97.59
d2f99a1140 Aklanonic acid methyl ester cyclase, AknH {Strepto 97.45
d1ohpa1125 Delta-5-3-ketosteroid isomerase, steroid delta-iso 97.39
d1nwwa_145 Limonene-1,2-epoxide hydrolase {Rhodococcus erythr 97.36
d1oh0a_125 Delta-5-3-ketosteroid isomerase, steroid delta-iso 97.3
d3en8a1127 Uncharacterized protein BxeB2092 {Burkholderia xen 97.25
d2bnga1132 Uncharacterized protein Mb2760 {Mycobacterium tube 97.18
d3dm8a1135 Uncharacterized protein Rpa4348 {Rhodopseudomonas 97.0
d1z1sa1129 Uncharacterized protein PA3332 {Pseudomonas aerugi 96.94
d1s5aa_139 Hypothetical protein YesE {Bacillus subtilis [TaxI 96.67
d1sjwa_142 Nogalonic acid methyl ester cyclase SnoaL {Strepto 96.63
d2a15a1132 Hypothetical protein Rv0760c {Mycobacterium tuberc 96.58
d3dmca1133 Uncharacterized protein Ava2261 {Anabaena variabil 96.13
d3ec9a1130 Uncharacterized protein BTHI0051 {Burkholderia tha 95.86
d2k54a1123 Uncharacterized protein Atu0742 {Agrobacterium tum 95.33
d2rgqa1133 Uncharacterized protein NpunR3134 {Nostoc punctifo 93.63
d1tuha_131 Hypothetical protein egc068 from a soil-derived mo 93.47
d3d9ra1132 Uncharacterized protein ECA1476 {Pectobacterium at 92.91
d1m98a2142 Orange carotenoid protein, C-terminal domain {Cyan 92.88
d2gxfa1128 Hypothetical protein YybH {Bacillus subtilis [TaxI 92.57
d3bb9a1121 Uncharacterized protein Sfri1973 {Shewanella frigi 92.46
d2r4ia1122 Uncharacterized protein CHU142 {Cytophaga hutchins 90.8
d2rcda1127 Uncharacterized protein ECA3500 {Pectobacterium at 88.89
d3cu3a1162 Uncharacterized protein NpunR1993 {Nostoc punctifo 86.2
d3ef8a1149 Uncharacterized protein Saro1465 {Novosphingobium 85.91
d2chca1167 Uncharacterized protein Rv3472 {Mycobacterium tube 82.43
d3ejva1159 Uncharacterized protein Saro2766 {Novosphingobium 80.45
>d3dxoa1 d.17.4.19 (A:1-117) Uncharacterized protein Atu0744 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Cystatin-like
superfamily: NTF2-like
family: Atu0744-like
domain: Uncharacterized protein Atu0744
species: Agrobacterium tumefaciens [TaxId: 358]

Probab=98.61  E-value=2.4e-08  Score=70.65  Aligned_cols=62  Identities=13%  Similarity=0.092  Sum_probs=56.0

Q ss_pred             ccccccccceeeeCCCCcccchHHHHHHHHhhccccCCCceEEEE-EEeeCcEEEEEEEEEee
Q 030689          105 FTSEIYAEDCIFEDPTIRFRGTELYSRNLRLLVPFFEYPSIGLQN-IKKVRYFLQIDIVFQLI  166 (173)
Q Consensus       105 ~t~~IYa~D~~F~DPfn~F~G~dryk~~l~~m~~~f~~prf~L~d-i~~s~~~~~lrW~F~~~  166 (173)
                      ...++|++||+|.||++.++|++.++++++.+..-+.+.+|++++ +...++.+.++|+|...
T Consensus        26 ~l~~~~a~d~~~~dP~~~~~G~~ai~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~w~~~~~   88 (117)
T d3dxoa1          26 LVGQAWAENTRYVDPLMQGEGQQGIAAMIEAARQKFPGYRFVLAGTPDGHGNFTRFSWRLISP   88 (117)
T ss_dssp             HHHHHEEEEEEEECSSCEEEHHHHHHHHHHHHHHHSTTCEEEEEEEEEEETTEEEEEEEEECT
T ss_pred             HHHHHccCCEEEECCCCCcccHHHHHHHHHHHHHhCCCcEEEEEEEEecCCCEEEEEEEEecC
Confidence            367899999999999999999999999999999999999999874 65678999999999764
>d2gexa1 d.17.4.9 (A:2-139) Nogalamycin biosynthesis protein SnoL {Streptomyces nogalater [TaxId: 38314]} Back     information, alignment and structure
>d2geya1 d.17.4.9 (A:2-145) Putative hydroxylase AclR {Streptomyces galilaeus [TaxId: 33899]} Back     information, alignment and structure
>d3ebta1 d.17.4.9 (A:1-131) Uncharacterized protein BPSS0132 {Burkholderia pseudomallei [TaxId: 28450]} Back     information, alignment and structure
>d2f99a1 d.17.4.9 (A:2-141) Aklanonic acid methyl ester cyclase, AknH {Streptomyces galilaeus [TaxId: 33899]} Back     information, alignment and structure
>d1ohpa1 d.17.4.3 (A:1-125) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Comamonas testosteroni, also known as Pseudomonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1nwwa_ d.17.4.8 (A:) Limonene-1,2-epoxide hydrolase {Rhodococcus erythropolis [TaxId: 1833]} Back     information, alignment and structure
>d1oh0a_ d.17.4.3 (A:) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d3en8a1 d.17.4.20 (A:1-127) Uncharacterized protein BxeB2092 {Burkholderia xenovorans [TaxId: 36873]} Back     information, alignment and structure
>d2bnga1 d.17.4.8 (A:13-144) Uncharacterized protein Mb2760 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d3dm8a1 d.17.4.20 (A:1-135) Uncharacterized protein Rpa4348 {Rhodopseudomonas palustris [TaxId: 1076]} Back     information, alignment and structure
>d1z1sa1 d.17.4.10 (A:1-129) Uncharacterized protein PA3332 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1s5aa_ d.17.4.10 (A:) Hypothetical protein YesE {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1sjwa_ d.17.4.9 (A:) Nogalonic acid methyl ester cyclase SnoaL {Streptomyces nogalater [TaxId: 38314]} Back     information, alignment and structure
>d2a15a1 d.17.4.3 (A:5-136) Hypothetical protein Rv0760c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d3dmca1 d.17.4.10 (A:1-133) Uncharacterized protein Ava2261 {Anabaena variabilis [TaxId: 1172]} Back     information, alignment and structure
>d3ec9a1 d.17.4.10 (A:10-139) Uncharacterized protein BTHI0051 {Burkholderia thailandensis [TaxId: 57975]} Back     information, alignment and structure
>d2k54a1 d.17.4.29 (A:1-123) Uncharacterized protein Atu0742 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2rgqa1 d.17.4.25 (A:1-133) Uncharacterized protein NpunR3134 {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1tuha_ d.17.4.11 (A:) Hypothetical protein egc068 from a soil-derived mobile gene cassette {uncultured organism [TaxId: 155900]} Back     information, alignment and structure
>d3d9ra1 d.17.4.27 (A:3-134) Uncharacterized protein ECA1476 {Pectobacterium atrosepticum [TaxId: 29471]} Back     information, alignment and structure
>d1m98a2 d.17.4.6 (A:176-317) Orange carotenoid protein, C-terminal domain {Cyanobacteria (Arthrospira maxima) [TaxId: 129910]} Back     information, alignment and structure
>d2gxfa1 d.17.4.22 (A:1-128) Hypothetical protein YybH {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d3bb9a1 d.17.4.16 (A:27-147) Uncharacterized protein Sfri1973 {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d2r4ia1 d.17.4.15 (A:1-122) Uncharacterized protein CHU142 {Cytophaga hutchinsonii [TaxId: 985]} Back     information, alignment and structure
>d2rcda1 d.17.4.18 (A:1-127) Uncharacterized protein ECA3500 {Pectobacterium atrosepticum [TaxId: 29471]} Back     information, alignment and structure
>d3cu3a1 d.17.4.28 (A:9-170) Uncharacterized protein NpunR1993 {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d3ef8a1 d.17.4.28 (A:1-149) Uncharacterized protein Saro1465 {Novosphingobium aromaticivorans [TaxId: 48935]} Back     information, alignment and structure
>d2chca1 d.17.4.25 (A:1-167) Uncharacterized protein Rv3472 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d3ejva1 d.17.4.28 (A:2-160) Uncharacterized protein Saro2766 {Novosphingobium aromaticivorans [TaxId: 48935]} Back     information, alignment and structure