Citrus Sinensis ID: 030960


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------17
MVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQMNLSDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK
cHHHHHHHHHHccccEEEEEcccccccccccccccccHHHHHHHHHHHHHcccccccccEEEEEEcccccccccccccccccccccccccccHHHHHHHHHHcccccccHHHHHcccccccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccccccccc
cHHHHHHHHHHcccEEEEEEEEccccccccccccccccHHHHHHHHHHHHcccccccccEEEEEEccccccccHHHccccccccEEEEcccccccHHHHHHHHccccccHHHHHcccccccHHHHHHHHHHHHHHHHHHcccEEcHHHHHHHHHHHHccHHHHHcccc
MVRDVFRLAkenapaiifiDEVDAIATARfdaqtgadREVQRILMELLNQMDGFDQTVNVKVIMAtnradtldpallrpgrldrkiefplpdrrQKRLVFQmnlsdevdledyvsrpdkiSAAEIAAICQEAGMHavrknryvilpkdfekgyrtnvkkpdtdfefyk
MVRDVFRLakenapaiifiDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMatnradtldpallrpgrldrkiefplpdrrqkrlvfqmnlsdevdledyvsRPDKISAAEIAAICQEAGMHAVRKNRYVilpkdfekgyrtnvkkpdtdfefyk
MVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQMNLSDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK
****VFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQMNLSDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYR**************
MVRDVFRLAKENAPAIIFIDEVDAIAT**************RILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQMNLSDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRT*************
MVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQMNLSDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK
*VRDVFRLAKENAPAIIFIDEVDAIATAR*****GADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQMNLSDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDT******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQMNLSDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query168 2.2.26 [Sep-21-2011]
Q9SEI4408 26S protease regulatory s yes no 1.0 0.411 0.965 2e-92
P85200414 26S protease regulatory s N/A no 1.0 0.405 0.959 9e-92
P54778413 26S protease regulatory s N/A no 1.0 0.406 0.959 1e-91
P34123403 26S protease regulatory s yes no 0.994 0.414 0.837 5e-82
P46507415 26S protease regulatory s N/A no 1.0 0.404 0.809 1e-80
Q63570418 26S protease regulatory s yes no 1.0 0.401 0.815 2e-78
P54775418 26S protease regulatory s yes no 1.0 0.401 0.815 2e-78
Q4R7L3418 26S protease regulatory s N/A no 1.0 0.401 0.815 2e-78
P43686418 26S protease regulatory s yes no 1.0 0.401 0.815 2e-78
Q3T030418 26S protease regulatory s yes no 1.0 0.401 0.815 2e-78
>sp|Q9SEI4|PRS6B_ARATH 26S protease regulatory subunit 6B homolog OS=Arabidopsis thaliana GN=RPT3 PE=1 SV=1 Back     alignment and function desciption
 Score =  337 bits (864), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 167/173 (96%), Positives = 167/173 (96%), Gaps = 5/173 (2%)

Query: 1   MVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQTVNV 60
           MVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQTVNV
Sbjct: 236 MVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQTVNV 295

Query: 61  KVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQ-----MNLSDEVDLEDYVS 115
           KVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQ     MNLSDEVDLEDYVS
Sbjct: 296 KVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTSKMNLSDEVDLEDYVS 355

Query: 116 RPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK 168
           RPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYR NVKKPDTDFEFYK
Sbjct: 356 RPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 408




The 26S protease is involved in the ATP-dependent degradation of ubiquitinated proteins. The regulatory (or ATPase) complex confers ATP dependency and substrate specificity to the 26S complex.
Arabidopsis thaliana (taxid: 3702)
>sp|P85200|PRS6B_HELAN 26S protease regulatory subunit 6B homolog OS=Helianthus annuus PE=1 SV=1 Back     alignment and function description
>sp|P54778|PRS6B_SOLTU 26S protease regulatory subunit 6B homolog OS=Solanum tuberosum PE=2 SV=1 Back     alignment and function description
>sp|P34123|PRS6B_DICDI 26S protease regulatory subunit 6B homolog OS=Dictyostelium discoideum GN=psmC4 PE=1 SV=1 Back     alignment and function description
>sp|P46507|PRS6B_MANSE 26S protease regulatory subunit 6B OS=Manduca sexta PE=2 SV=1 Back     alignment and function description
>sp|Q63570|PRS6B_RAT 26S protease regulatory subunit 6B OS=Rattus norvegicus GN=Psmc4 PE=1 SV=1 Back     alignment and function description
>sp|P54775|PRS6B_MOUSE 26S protease regulatory subunit 6B OS=Mus musculus GN=Psmc4 PE=1 SV=2 Back     alignment and function description
>sp|Q4R7L3|PRS6B_MACFA 26S protease regulatory subunit 6B OS=Macaca fascicularis GN=PSMC4 PE=2 SV=1 Back     alignment and function description
>sp|P43686|PRS6B_HUMAN 26S protease regulatory subunit 6B OS=Homo sapiens GN=PSMC4 PE=1 SV=2 Back     alignment and function description
>sp|Q3T030|PRS6B_BOVIN 26S protease regulatory subunit 6B OS=Bos taurus GN=PSMC4 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query168
255565346 415 26S protease regulatory subunit 6b, puta 1.0 0.404 0.971 3e-91
359478860 418 PREDICTED: 26S protease regulatory subun 1.0 0.401 0.971 4e-91
356570019 422 PREDICTED: 26S protease regulatory subun 1.0 0.398 0.971 5e-91
357460533 415 26S protease regulatory subunit 6B [Medi 1.0 0.404 0.965 5e-91
297745747 328 unnamed protein product [Vitis vinifera] 1.0 0.512 0.971 8e-91
356539715 423 PREDICTED: 26S protease regulatory subun 1.0 0.397 0.965 8e-91
449475799 418 PREDICTED: LOW QUALITY PROTEIN: 26S prot 1.0 0.401 0.965 1e-90
449444336 418 PREDICTED: 26S protease regulatory subun 1.0 0.401 0.965 1e-90
15237159 408 regulatory particle triple-A ATPase 3 [A 1.0 0.411 0.965 1e-90
224086733 412 predicted protein [Populus trichocarpa] 1.0 0.407 0.965 2e-90
>gi|255565346|ref|XP_002523664.1| 26S protease regulatory subunit 6b, putative [Ricinus communis] gi|223537064|gb|EEF38699.1| 26S protease regulatory subunit 6b, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  339 bits (869), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 168/173 (97%), Positives = 168/173 (97%), Gaps = 5/173 (2%)

Query: 1   MVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQTVNV 60
           MVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQTVNV
Sbjct: 243 MVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQTVNV 302

Query: 61  KVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQ-----MNLSDEVDLEDYVS 115
           KVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQ     MNLSDEVDLEDYVS
Sbjct: 303 KVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTSKMNLSDEVDLEDYVS 362

Query: 116 RPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK 168
           RPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK
Sbjct: 363 RPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK 415




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359478860|ref|XP_002276130.2| PREDICTED: 26S protease regulatory subunit 6B homolog [Vitis vinifera] Back     alignment and taxonomy information
>gi|356570019|ref|XP_003553190.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Glycine max] Back     alignment and taxonomy information
>gi|357460533|ref|XP_003600548.1| 26S protease regulatory subunit 6B [Medicago truncatula] gi|355489596|gb|AES70799.1| 26S protease regulatory subunit 6B [Medicago truncatula] Back     alignment and taxonomy information
>gi|297745747|emb|CBI15803.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356539715|ref|XP_003538340.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Glycine max] Back     alignment and taxonomy information
>gi|449475799|ref|XP_004154554.1| PREDICTED: LOW QUALITY PROTEIN: 26S protease regulatory subunit 6B homolog [Cucumis sativus] Back     alignment and taxonomy information
>gi|449444336|ref|XP_004139931.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Cucumis sativus] Back     alignment and taxonomy information
>gi|15237159|ref|NP_200637.1| regulatory particle triple-A ATPase 3 [Arabidopsis thaliana] gi|297793353|ref|XP_002864561.1| hypothetical protein ARALYDRAFT_495939 [Arabidopsis lyrata subsp. lyrata] gi|28558168|sp|Q9SEI4.1|PRS6B_ARATH RecName: Full=26S protease regulatory subunit 6B homolog; AltName: Full=26S protease subunit 6B homolog; AltName: Full=26S proteasome AAA-ATPase subunit RPT3; AltName: Full=Protein BMAA insensitive morphology 409; AltName: Full=Regulatory particle triple-A ATPase subunit 3 gi|6652882|gb|AAF22523.1|AF123392_1 26S proteasome AAA-ATPase subunit RPT3 [Arabidopsis thaliana] gi|8777330|dbj|BAA96920.1| 26S proteasome AAA-ATPase subunit RPT3 [Arabidopsis thaliana] gi|17979231|gb|AAL49932.1| AT4g10340/F24G24_140 [Arabidopsis thaliana] gi|56382019|gb|AAV85728.1| At5g58290 [Arabidopsis thaliana] gi|297310396|gb|EFH40820.1| hypothetical protein ARALYDRAFT_495939 [Arabidopsis lyrata subsp. lyrata] gi|332009646|gb|AED97029.1| regulatory particle triple-A ATPase 3 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|224086733|ref|XP_002307945.1| predicted protein [Populus trichocarpa] gi|222853921|gb|EEE91468.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query168
TAIR|locus:2161258408 RPT3 "regulatory particle trip 1.0 0.411 0.965 6.4e-83
DICTYBASE|DDB_G0289003403 psmC4 "HIV TAT binding-protein 0.994 0.414 0.837 4.6e-73
FB|FBgn0028686413 Rpt3 "Regulatory particle trip 1.0 0.406 0.826 7.5e-73
UNIPROTKB|F1MG70417 PSMC4 "26S protease regulatory 1.0 0.402 0.815 6.1e-71
UNIPROTKB|Q3T030418 PSMC4 "26S protease regulatory 1.0 0.401 0.815 6.1e-71
UNIPROTKB|E2RH48418 PSMC4 "Uncharacterized protein 1.0 0.401 0.815 6.1e-71
UNIPROTKB|P43686418 PSMC4 "26S protease regulatory 1.0 0.401 0.815 6.1e-71
UNIPROTKB|Q4R7L3418 PSMC4 "26S protease regulatory 1.0 0.401 0.815 6.1e-71
MGI|MGI:1346093418 Psmc4 "proteasome (prosome, ma 1.0 0.401 0.815 6.1e-71
RGD|621102418 Psmc4 "proteasome (prosome, ma 1.0 0.401 0.815 6.1e-71
TAIR|locus:2161258 RPT3 "regulatory particle triple-A ATPase 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 831 (297.6 bits), Expect = 6.4e-83, P = 6.4e-83
 Identities = 167/173 (96%), Positives = 167/173 (96%)

Query:     1 MVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQTVNV 60
             MVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQTVNV
Sbjct:   236 MVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQTVNV 295

Query:    61 KVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQ-----MNLSDEVDLEDYVS 115
             KVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQ     MNLSDEVDLEDYVS
Sbjct:   296 KVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTSKMNLSDEVDLEDYVS 355

Query:   116 RPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK 168
             RPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYR NVKKPDTDFEFYK
Sbjct:   356 RPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 408




GO:0000166 "nucleotide binding" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0016787 "hydrolase activity" evidence=IEA
GO:0016887 "ATPase activity" evidence=IGI;ISS
GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA
GO:0030163 "protein catabolic process" evidence=IEA
GO:0006511 "ubiquitin-dependent protein catabolic process" evidence=RCA;TAS
GO:0005634 "nucleus" evidence=TAS
GO:0005618 "cell wall" evidence=IDA
GO:0016020 "membrane" evidence=IDA
GO:0000502 "proteasome complex" evidence=IDA
GO:0005829 "cytosol" evidence=IDA
GO:0009506 "plasmodesma" evidence=IDA
GO:0006094 "gluconeogenesis" evidence=RCA
GO:0006635 "fatty acid beta-oxidation" evidence=RCA
GO:0006888 "ER to Golgi vesicle-mediated transport" evidence=RCA
GO:0007010 "cytoskeleton organization" evidence=RCA
GO:0009407 "toxin catabolic process" evidence=RCA
GO:0009735 "response to cytokinin stimulus" evidence=RCA
GO:0009853 "photorespiration" evidence=RCA
GO:0010498 "proteasomal protein catabolic process" evidence=RCA
GO:0043090 "amino acid import" evidence=RCA
GO:0043161 "proteasomal ubiquitin-dependent protein catabolic process" evidence=RCA
GO:0043248 "proteasome assembly" evidence=RCA
GO:0048767 "root hair elongation" evidence=RCA
GO:0051788 "response to misfolded protein" evidence=RCA
GO:0080129 "proteasome core complex assembly" evidence=RCA
GO:0008540 "proteasome regulatory particle, base subcomplex" evidence=IDA
DICTYBASE|DDB_G0289003 psmC4 "HIV TAT binding-protein-related" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
FB|FBgn0028686 Rpt3 "Regulatory particle triple-A ATPase 3" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F1MG70 PSMC4 "26S protease regulatory subunit 6B" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q3T030 PSMC4 "26S protease regulatory subunit 6B" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RH48 PSMC4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P43686 PSMC4 "26S protease regulatory subunit 6B" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q4R7L3 PSMC4 "26S protease regulatory subunit 6B" [Macaca fascicularis (taxid:9541)] Back     alignment and assigned GO terms
MGI|MGI:1346093 Psmc4 "proteasome (prosome, macropain) 26S subunit, ATPase, 4" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|621102 Psmc4 "proteasome (prosome, macropain) 26S subunit, ATPase, 4" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P34123PRS6B_DICDINo assigned EC number0.83720.99400.4143yesno
Q63570PRS6B_RATNo assigned EC number0.81501.00.4019yesno
P33298PRS6B_YEASTNo assigned EC number0.71021.00.3925yesno
P85200PRS6B_HELANNo assigned EC number0.95951.00.4057N/Ano
Q9SEI4PRS6B_ARATHNo assigned EC number0.96531.00.4117yesno
O74894PRS6B_SCHPONo assigned EC number0.72571.00.4318yesno
P54778PRS6B_SOLTUNo assigned EC number0.95951.00.4067N/Ano
P46502PRS6B_CAEELNo assigned EC number0.80921.00.4057yesno
P54775PRS6B_MOUSENo assigned EC number0.81501.00.4019yesno
Q3T030PRS6B_BOVINNo assigned EC number0.81501.00.4019yesno
P43686PRS6B_HUMANNo assigned EC number0.81501.00.4019yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00023924001
SubName- Full=Chromosome chr6 scaffold_3, whole genome shotgun sequence; (418 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00014791001
SubName- Full=Putative uncharacterized protein (Chromosome chr18 scaffold_1, whole genome shotg [...] (309 aa)
    0.854
GSVIVG00010470001
SubName- Full=Chromosome chr17 scaffold_263, whole genome shotgun sequence; (386 aa)
    0.830
GSVIVG00036762001
SubName- Full=Chromosome chr4 scaffold_83, whole genome shotgun sequence; (440 aa)
    0.816
GSVIVG00024499001
RecName- Full=Proteasome subunit beta type; EC=3.4.25.1;; The proteasome is a multicatalytic pr [...] (245 aa)
    0.695
GSVIVG00015634001
SubName- Full=Chromosome chr2 scaffold_11, whole genome shotgun sequence; (365 aa)
    0.684
GSVIVG00034204001
RecName- Full=Ubiquitin carboxyl-terminal hydrolase; EC=3.1.2.15; (479 aa)
     0.682
GSVIVG00006696001
SubName- Full=Chromosome chr2 scaffold_176, whole genome shotgun sequence; (267 aa)
    0.678
GSVIVG00018640001
SubName- Full=Chromosome chr12 scaffold_18, whole genome shotgun sequence; (629 aa)
    0.649
GSVIVG00019352001
SubName- Full=Chromosome chr7 scaffold_20, whole genome shotgun sequence; (320 aa)
    0.629
GSVIVG00023752001
SubName- Full=Putative uncharacterized protein (Chromosome chr7 scaffold_31, whole genome shotg [...] (205 aa)
    0.616

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query168
PTZ00454398 PTZ00454, PTZ00454, 26S protease regulatory subuni 1e-123
COG1222406 COG1222, RPT1, ATP-dependent 26S proteasome regula 6e-88
PTZ00361438 PTZ00361, PTZ00361, 26 proteosome regulatory subun 2e-67
PRK03992389 PRK03992, PRK03992, proteasome-activating nucleoti 1e-65
TIGR01242364 TIGR01242, 26Sp45, 26S proteasome subunit P45 fami 3e-55
TIGR01241 495 TIGR01241, FtsH_fam, ATP-dependent metalloprotease 6e-41
COG0464494 COG0464, SpoVK, ATPases of the AAA+ class [Posttra 9e-38
TIGR01243733 TIGR01243, CDC48, AAA family ATPase, CDC48 subfami 2e-35
CHL00176 638 CHL00176, ftsH, cell division protein; Validated 8e-35
COG0465 596 COG0465, HflB, ATP-dependent Zn proteases [Posttra 3e-33
pfam00004131 pfam00004, AAA, ATPase family associated with vari 3e-30
TIGR01243 733 TIGR01243, CDC48, AAA family ATPase, CDC48 subfami 1e-29
PRK10733 644 PRK10733, hflB, ATP-dependent metalloprotease; Rev 2e-29
TIGR03689512 TIGR03689, pup_AAA, proteasome ATPase 3e-20
COG0464 494 COG0464, SpoVK, ATPases of the AAA+ class [Posttra 3e-19
COG1223368 COG1223, COG1223, Predicted ATPase (AAA+ superfami 1e-17
cd00009151 cd00009, AAA, The AAA+ (ATPases Associated with a 2e-10
smart00382148 smart00382, AAA, ATPases associated with a variety 1e-09
CHL00195489 CHL00195, ycf46, Ycf46; Provisional 2e-07
>gnl|CDD|240423 PTZ00454, PTZ00454, 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
 Score =  351 bits (903), Expect = e-123
 Identities = 148/173 (85%), Positives = 161/173 (93%), Gaps = 5/173 (2%)

Query: 1   MVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQTVNV 60
           MVRDVFRLA+ENAP+IIFIDEVD+IAT RFDAQTGADREVQRIL+ELLNQMDGFDQT NV
Sbjct: 226 MVRDVFRLARENAPSIIFIDEVDSIATKRFDAQTGADREVQRILLELLNQMDGFDQTTNV 285

Query: 61  KVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQ-----MNLSDEVDLEDYVS 115
           KVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRL+FQ     MNLS+EVDLED+VS
Sbjct: 286 KVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLIFQTITSKMNLSEEVDLEDFVS 345

Query: 116 RPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK 168
           RP+KISAA+IAAICQEAGM AVRKNRYVILPKDFEKGY+T V+K D D++FY 
Sbjct: 346 RPEKISAADIAAICQEAGMQAVRKNRYVILPKDFEKGYKTVVRKTDRDYDFYS 398


Length = 398

>gnl|CDD|224143 COG1222, RPT1, ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|185575 PTZ00361, PTZ00361, 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>gnl|CDD|179699 PRK03992, PRK03992, proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>gnl|CDD|130309 TIGR01242, 26Sp45, 26S proteasome subunit P45 family Back     alignment and domain information
>gnl|CDD|233327 TIGR01241, FtsH_fam, ATP-dependent metalloprotease FtsH Back     alignment and domain information
>gnl|CDD|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>gnl|CDD|214386 CHL00176, ftsH, cell division protein; Validated Back     alignment and domain information
>gnl|CDD|223541 COG0465, HflB, ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|215649 pfam00004, AAA, ATPase family associated with various cellular activities (AAA) Back     alignment and domain information
>gnl|CDD|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>gnl|CDD|182683 PRK10733, hflB, ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>gnl|CDD|200312 TIGR03689, pup_AAA, proteasome ATPase Back     alignment and domain information
>gnl|CDD|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|224144 COG1223, COG1223, Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>gnl|CDD|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>gnl|CDD|214640 smart00382, AAA, ATPases associated with a variety of cellular activities Back     alignment and domain information
>gnl|CDD|177094 CHL00195, ycf46, Ycf46; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 168
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 100.0
KOG0730693 consensus AAA+-type ATPase [Posttranslational modi 100.0
KOG0733802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 100.0
KOG0734 752 consensus AAA+-type ATPase containing the peptidas 100.0
KOG0727408 consensus 26S proteasome regulatory complex, ATPas 100.0
KOG0738491 consensus AAA+-type ATPase [Posttranslational modi 100.0
KOG0728404 consensus 26S proteasome regulatory complex, ATPas 100.0
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 100.0
KOG0736953 consensus Peroxisome assembly factor 2 containing 100.0
KOG0652424 consensus 26S proteasome regulatory complex, ATPas 100.0
KOG0731 774 consensus AAA+-type ATPase containing the peptidas 100.0
KOG0726440 consensus 26S proteasome regulatory complex, ATPas 100.0
COG0465 596 HflB ATP-dependent Zn proteases [Posttranslational 100.0
KOG0733 802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 100.0
CHL00195489 ycf46 Ycf46; Provisional 100.0
PRK03992389 proteasome-activating nucleotidase; Provisional 100.0
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational 99.98
CHL00206 2281 ycf2 Ycf2; Provisional 99.98
KOG0739439 consensus AAA+-type ATPase [Posttranslational modi 99.97
TIGR01241 495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 99.97
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 99.97
PRK10733 644 hflB ATP-dependent metalloprotease; Reviewed 99.97
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 99.97
KOG0735952 consensus AAA+-type ATPase [Posttranslational modi 99.97
KOG0729435 consensus 26S proteasome regulatory complex, ATPas 99.97
CHL00176 638 ftsH cell division protein; Validated 99.97
COG1223368 Predicted ATPase (AAA+ superfamily) [General funct 99.97
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 99.96
KOG0737386 consensus AAA+-type ATPase [Posttranslational modi 99.96
KOG0730 693 consensus AAA+-type ATPase [Posttranslational modi 99.94
KOG0740428 consensus AAA+-type ATPase [Posttranslational modi 99.94
KOG0651388 consensus 26S proteasome regulatory complex, ATPas 99.94
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 99.93
KOG0741 744 consensus AAA+-type ATPase [Posttranslational modi 99.93
KOG0732 1080 consensus AAA+-type ATPase containing the bromodom 99.93
TIGR01243 733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 99.91
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 99.89
KOG0735 952 consensus AAA+-type ATPase [Posttranslational modi 99.8
KOG0742630 consensus AAA+-type ATPase [Posttranslational modi 99.75
KOG0736 953 consensus Peroxisome assembly factor 2 containing 99.65
COG0464 494 SpoVK ATPases of the AAA+ class [Posttranslational 99.63
KOG0743457 consensus AAA+-type ATPase [Posttranslational modi 99.55
KOG0744423 consensus AAA+-type ATPase [Posttranslational modi 99.55
PF00004132 AAA: ATPase family associated with various cellula 99.54
TIGR02639 731 ClpA ATP-dependent Clp protease ATP-binding subuni 99.08
PRK11034 758 clpA ATP-dependent Clp protease ATP-binding subuni 99.07
CHL00181287 cbbX CbbX; Provisional 99.03
TIGR00763 775 lon ATP-dependent protease La. This protein is ind 98.97
TIGR02928365 orc1/cdc6 family replication initiation protein. M 98.95
PRK00411394 cdc6 cell division control protein 6; Reviewed 98.86
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 98.86
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 98.85
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 98.84
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 98.83
TIGR02902 531 spore_lonB ATP-dependent protease LonB. Members of 98.77
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 98.75
TIGR00362405 DnaA chromosomal replication initiator protein Dna 98.75
PRK00149450 dnaA chromosomal replication initiation protein; R 98.7
PRK06893229 DNA replication initiation factor; Validated 98.52
PTZ00112 1164 origin recognition complex 1 protein; Provisional 98.51
PRK14088440 dnaA chromosomal replication initiation protein; P 98.47
PRK07940 394 DNA polymerase III subunit delta'; Validated 98.43
PRK10865 857 protein disaggregation chaperone; Provisional 98.42
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 98.41
PRK14961 363 DNA polymerase III subunits gamma and tau; Provisi 98.41
PRK06645 507 DNA polymerase III subunits gamma and tau; Validat 98.35
TIGR02397 355 dnaX_nterm DNA polymerase III, subunit gamma and t 98.34
PRK14087450 dnaA chromosomal replication initiation protein; P 98.33
CHL00095 821 clpC Clp protease ATP binding subunit 98.32
PRK14086617 dnaA chromosomal replication initiation protein; P 98.31
PRK10787 784 DNA-binding ATP-dependent protease La; Provisional 98.28
PRK14962 472 DNA polymerase III subunits gamma and tau; Provisi 98.28
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 98.25
PRK12422445 chromosomal replication initiation protein; Provis 98.24
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 98.22
PRK08727233 hypothetical protein; Validated 98.22
PRK14956 484 DNA polymerase III subunits gamma and tau; Provisi 98.19
PRK05563 559 DNA polymerase III subunits gamma and tau; Validat 98.17
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 98.17
PRK13342 413 recombination factor protein RarA; Reviewed 98.16
PRK08084235 DNA replication initiation factor; Provisional 98.14
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 98.1
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 98.09
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 98.06
PRK14951 618 DNA polymerase III subunits gamma and tau; Provisi 98.06
PRK12402337 replication factor C small subunit 2; Reviewed 98.02
PRK05642234 DNA replication initiation factor; Validated 98.02
PRK14958 509 DNA polymerase III subunits gamma and tau; Provisi 98.01
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 98.0
PRK14964 491 DNA polymerase III subunits gamma and tau; Provisi 98.0
PRK14953 486 DNA polymerase III subunits gamma and tau; Provisi 97.99
PRK14970 367 DNA polymerase III subunits gamma and tau; Provisi 97.98
PRK08451 535 DNA polymerase III subunits gamma and tau; Validat 97.96
PRK14963 504 DNA polymerase III subunits gamma and tau; Provisi 97.96
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 97.94
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 97.94
PRK04195 482 replication factor C large subunit; Provisional 97.91
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 97.89
PRK09111 598 DNA polymerase III subunits gamma and tau; Validat 97.87
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 97.86
PRK14969 527 DNA polymerase III subunits gamma and tau; Provisi 97.85
TIGR02030337 BchI-ChlI magnesium chelatase ATPase subunit I. Th 97.84
COG2256 436 MGS1 ATPase related to the helicase subunit of the 97.81
PRK13407334 bchI magnesium chelatase subunit I; Provisional 97.8
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 97.79
PRK04132846 replication factor C small subunit; Provisional 97.79
PRK00440319 rfc replication factor C small subunit; Reviewed 97.79
PRK09087226 hypothetical protein; Validated 97.79
PRK14965 576 DNA polymerase III subunits gamma and tau; Provisi 97.78
PRK06620214 hypothetical protein; Validated 97.77
KOG1514767 consensus Origin recognition complex, subunit 1, a 97.77
PRK06647 563 DNA polymerase III subunits gamma and tau; Validat 97.76
PRK05896 605 DNA polymerase III subunits gamma and tau; Validat 97.74
PRK08903227 DnaA regulatory inactivator Hda; Validated 97.74
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 97.74
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 97.7
CHL00081350 chlI Mg-protoporyphyrin IX chelatase 97.68
PRK14959 624 DNA polymerase III subunits gamma and tau; Provisi 97.67
COG0593408 DnaA ATPase involved in DNA replication initiation 97.67
smart00350509 MCM minichromosome maintenance proteins. 97.66
CHL00195 489 ycf46 Ycf46; Provisional 97.66
PRK14957 546 DNA polymerase III subunits gamma and tau; Provisi 97.64
PRK06964342 DNA polymerase III subunit delta'; Validated 97.63
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 97.62
PRK05707328 DNA polymerase III subunit delta'; Validated 97.62
PRK06305 451 DNA polymerase III subunits gamma and tau; Validat 97.61
PLN03025319 replication factor C subunit; Provisional 97.59
PRK05342412 clpX ATP-dependent protease ATP-binding subunit Cl 97.58
TIGR00382413 clpX endopeptidase Clp ATP-binding regulatory subu 97.57
PRK13341 725 recombination factor protein RarA/unknown domain f 97.56
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 97.56
PRK14950 585 DNA polymerase III subunits gamma and tau; Provisi 97.5
PHA02544316 44 clamp loader, small subunit; Provisional 97.44
TIGR02031 589 BchD-ChlD magnesium chelatase ATPase subunit D. Th 97.4
PRK14952 584 DNA polymerase III subunits gamma and tau; Provisi 97.4
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 97.39
PRK09112351 DNA polymerase III subunit delta'; Validated 97.36
TIGR02903 615 spore_lon_C ATP-dependent protease, Lon family. Me 97.34
KOG2004 906 consensus Mitochondrial ATP-dependent protease PIM 97.33
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 97.32
PRK14948 620 DNA polymerase III subunits gamma and tau; Provisi 97.32
PRK11331459 5-methylcytosine-specific restriction enzyme subun 97.28
PRK07471365 DNA polymerase III subunit delta'; Validated 97.24
PF05673249 DUF815: Protein of unknown function (DUF815); Inte 97.24
PRK14955 397 DNA polymerase III subunits gamma and tau; Provisi 97.22
COG0466 782 Lon ATP-dependent Lon protease, bacterial type [Po 97.21
COG2255332 RuvB Holliday junction resolvasome, helicase subun 97.2
COG1220444 HslU ATP-dependent protease HslVU (ClpYQ), ATPase 97.18
PRK08769319 DNA polymerase III subunit delta'; Validated 97.17
PRK05201443 hslU ATP-dependent protease ATP-binding subunit Hs 97.16
PRK14971 614 DNA polymerase III subunits gamma and tau; Provisi 97.16
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 97.16
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 97.15
COG0714329 MoxR-like ATPases [General function prediction onl 97.14
TIGR00764 608 lon_rel lon-related putative ATP-dependent proteas 97.11
PRK07993334 DNA polymerase III subunit delta'; Validated 97.11
TIGR02442 633 Cob-chelat-sub cobaltochelatase subunit. A number 97.1
COG2812 515 DnaX DNA polymerase III, gamma/tau subunits [DNA r 97.09
KOG2028 554 consensus ATPase related to the helicase subunit o 97.08
PRK14954 620 DNA polymerase III subunits gamma and tau; Provisi 97.07
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 97.07
CHL00095821 clpC Clp protease ATP binding subunit 97.03
PRK06871325 DNA polymerase III subunit delta'; Validated 97.02
COG1224450 TIP49 DNA helicase TIP49, TBP-interacting protein 96.94
KOG0741744 consensus AAA+-type ATPase [Posttranslational modi 96.92
PRK06090319 DNA polymerase III subunit delta'; Validated 96.88
TIGR00390441 hslU ATP-dependent protease HslVU, ATPase subunit. 96.85
TIGR01650327 PD_CobS cobaltochelatase, CobS subunit. This model 96.83
KOG2680454 consensus DNA helicase TIP49, TBP-interacting prot 96.82
smart00382148 AAA ATPases associated with a variety of cellular 96.76
PRK07276290 DNA polymerase III subunit delta'; Validated 96.75
PRK09862506 putative ATP-dependent protease; Provisional 96.7
PRK08058329 DNA polymerase III subunit delta'; Validated 96.62
COG0542 786 clpA ATP-binding subunits of Clp protease and DnaK 96.55
PRK05564313 DNA polymerase III subunit delta'; Validated 96.54
PRK07399314 DNA polymerase III subunit delta'; Validated 96.44
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 96.35
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK 96.28
TIGR00368499 Mg chelatase-related protein. The N-terminal end m 96.23
PRK13531 498 regulatory ATPase RavA; Provisional 96.23
COG3267269 ExeA Type II secretory pathway, component ExeA (pr 96.17
PRK10865857 protein disaggregation chaperone; Provisional 96.14
KOG0989346 consensus Replication factor C, subunit RFC4 [Repl 96.01
PRK06581263 DNA polymerase III subunit delta'; Validated 96.01
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 95.94
COG1067 647 LonB Predicted ATP-dependent protease [Posttransla 95.92
COG0470325 HolB ATPase involved in DNA replication [DNA repli 95.65
KOG2227 529 consensus Pre-initiation complex, subunit CDC6, AA 95.62
PF05729166 NACHT: NACHT domain 95.6
KOG1942456 consensus DNA helicase, TBP-interacting protein [R 95.56
PHA02244383 ATPase-like protein 95.53
PRK07132299 DNA polymerase III subunit delta'; Validated 95.52
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 95.48
PF07693325 KAP_NTPase: KAP family P-loop domain; InterPro: IP 95.36
PRK13406 584 bchD magnesium chelatase subunit D; Provisional 95.28
PTZ00111915 DNA replication licensing factor MCM4; Provisional 95.28
PRK05917290 DNA polymerase III subunit delta'; Validated 95.22
PF05707193 Zot: Zonular occludens toxin (Zot); InterPro: IPR0 95.0
PF07724171 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR 94.99
COG2607287 Predicted ATPase (AAA+ superfamily) [General funct 94.98
PRK05818261 DNA polymerase III subunit delta'; Validated 94.79
PRK08699325 DNA polymerase III subunit delta'; Validated 94.59
COG1239 423 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolis 94.48
PRK14700 300 recombination factor protein RarA; Provisional 94.46
PF05872 502 DUF853: Bacterial protein of unknown function (DUF 94.13
PRK08485206 DNA polymerase III subunit delta'; Validated 94.1
PF14516331 AAA_35: AAA-like domain 93.93
PRK13765 637 ATP-dependent protease Lon; Provisional 93.93
PF00493331 MCM: MCM2/3/5 family This family extends the MCM d 93.88
PF12846304 AAA_10: AAA-like domain 93.54
KOG1969 877 consensus DNA replication checkpoint protein CHL12 93.03
TIGR00602 637 rad24 checkpoint protein rad24. This family is bas 91.99
TIGR01128 302 holA DNA polymerase III, delta subunit. subunit ar 91.61
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [P 91.54
PRK05574 340 holA DNA polymerase III subunit delta; Reviewed 91.12
PRK10365441 transcriptional regulatory protein ZraR; Provision 90.79
PF06068398 TIP49: TIP49 C-terminus; InterPro: IPR010339 This 90.5
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 89.87
PRK11361457 acetoacetate metabolism regulatory protein AtoC; P 89.54
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 89.48
TIGR02974329 phageshock_pspF psp operon transcriptional activat 89.05
TIGR01817534 nifA Nif-specific regulatory protein. This model r 88.25
PRK11388638 DNA-binding transcriptional regulator DhaR; Provis 87.93
KOG2228 408 consensus Origin recognition complex, subunit 4 [R 87.85
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 87.71
PRK04841 903 transcriptional regulator MalT; Provisional 87.67
KOG1051898 consensus Chaperone HSP104 and related ATP-depende 86.74
TIGR02237209 recomb_radB DNA repair and recombination protein R 86.65
KOG0478804 consensus DNA replication licensing factor, MCM4 c 86.51
KOG1968 871 consensus Replication factor C, subunit RFC1 (larg 86.26
PHA00012 361 I assembly protein 85.92
PRK07452 326 DNA polymerase III subunit delta; Validated 85.78
KOG0745 564 consensus Putative ATP-dependent Clp-type protease 84.56
PF13304303 AAA_21: AAA domain; PDB: 3QKS_B 1US8_B 1F2U_B 1F2T 84.35
PRK15115444 response regulator GlrR; Provisional 83.99
PRK11608326 pspF phage shock protein operon transcriptional ac 83.37
PF12775272 AAA_7: P-loop containing dynein motor region D3; P 83.2
TIGR02915445 PEP_resp_reg putative PEP-CTERM system response re 82.87
TIGR01818463 ntrC nitrogen regulation protein NR(I). This model 82.47
PF07726131 AAA_3: ATPase family associated with various cellu 82.43
PF0296966 TAF: TATA box binding protein associated factor (T 82.31
PLN03210 1153 Resistant to P. syringae 6; Provisional 82.25
KOG2035351 consensus Replication factor C, subunit RFC3 [Cell 81.96
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 81.15
PF0080865 CBFD_NFYB_HMF: Histone-like transcription factor ( 80.53
COG1485367 Predicted ATPase [General function prediction only 80.29
PF13173128 AAA_14: AAA domain 80.07
PRK05022509 anaerobic nitric oxide reductase transcription reg 80.04
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
Probab=100.00  E-value=2.9e-43  Score=274.99  Aligned_cols=160  Identities=58%  Similarity=0.905  Sum_probs=153.4

Q ss_pred             CHHHHHHHHHHcCCeEEEEcccccccccccCCCCCcchHHHHHHHHHHHhccCCCCCCCeEEEEecCCCCCCCccccCCC
Q 030960            1 MVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPG   80 (168)
Q Consensus         1 ~l~~iF~~a~~~~p~ii~iDe~D~l~~~~~~~~~~~~~~~~~~~~~ll~~l~~~~~~~~v~vi~ttn~~~~ld~al~r~g   80 (168)
                      |+|++|+.|+.++||||||||+|+++.+|.+.+.+.+..+++.+-+||++||||....+|-||++||+++-|||||+|||
T Consensus       232 lVRelF~lArekaPsIIFiDEIDAIg~kR~d~~t~gDrEVQRTmleLL~qlDGFD~~~nvKVI~ATNR~D~LDPALLRPG  311 (406)
T COG1222         232 LVRELFELAREKAPSIIFIDEIDAIGAKRFDSGTSGDREVQRTMLELLNQLDGFDPRGNVKVIMATNRPDILDPALLRPG  311 (406)
T ss_pred             HHHHHHHHHhhcCCeEEEEechhhhhcccccCCCCchHHHHHHHHHHHHhccCCCCCCCeEEEEecCCccccChhhcCCC
Confidence            58999999999999999999999999999998888999999999999999999999999999999999999999999999


Q ss_pred             CcceEEecCCCCHHHHHHHHHh-----hcCCCCCHHHHHhCCCCCCHHHHHHHHHHHHHHHHHhCCCccCHHHHHHHHHh
Q 030960           81 RLDRKIEFPLPDRRQKRLVFQM-----NLSDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRT  155 (168)
Q Consensus        81 rf~~~i~~~~P~~~~R~~il~~-----~l~~~~~~~~la~~t~g~s~~di~~l~~~a~~~a~~~~~~~i~~~d~~~al~~  155 (168)
                      |||+.|+||+|+.+.|.+||+.     .+.+++||+.+|..|+|+||+||+++|.+|.+.|+|+.+..+|++||..|+++
T Consensus       312 R~DRkIEfplPd~~gR~~Il~IHtrkM~l~~dvd~e~la~~~~g~sGAdlkaictEAGm~AiR~~R~~Vt~~DF~~Av~K  391 (406)
T COG1222         312 RFDRKIEFPLPDEEGRAEILKIHTRKMNLADDVDLELLARLTEGFSGADLKAICTEAGMFAIRERRDEVTMEDFLKAVEK  391 (406)
T ss_pred             cccceeecCCCCHHHHHHHHHHHhhhccCccCcCHHHHHHhcCCCchHHHHHHHHHHhHHHHHhccCeecHHHHHHHHHH
Confidence            9999999999999999999984     45579999999999999999999999999999999999999999999999999


Q ss_pred             hcCCC
Q 030960          156 NVKKP  160 (168)
Q Consensus       156 ~~p~~  160 (168)
                      +....
T Consensus       392 V~~~~  396 (406)
T COG1222         392 VVKKK  396 (406)
T ss_pred             HHhcc
Confidence            87754



>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0652 consensus 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0726 consensus 26S proteasome regulatory complex, ATPase RPT2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00206 ycf2 Ycf2; Provisional Back     alignment and domain information
>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>KOG0737 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0740 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0732 consensus AAA+-type ATPase containing the bromodomain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>TIGR02902 spore_lonB ATP-dependent protease LonB Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13407 bchI magnesium chelatase subunit I; Provisional Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK04132 replication factor C small subunit; Provisional Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>KOG1514 consensus Origin recognition complex, subunit 1, and related proteins [Replication, recombination and repair] Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>CHL00081 chlI Mg-protoporyphyrin IX chelatase Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>smart00350 MCM minichromosome maintenance proteins Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1220 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>COG0714 MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>TIGR00764 lon_rel lon-related putative ATP-dependent protease Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR02442 Cob-chelat-sub cobaltochelatase subunit Back     alignment and domain information
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>KOG2680 consensus DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PRK07276 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK09862 putative ATP-dependent protease; Provisional Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00368 Mg chelatase-related protein Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] Back     alignment and domain information
>PRK06581 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>COG1067 LonB Predicted ATP-dependent protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG2227 consensus Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase [Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>KOG1942 consensus DNA helicase, TBP-interacting protein [Replication, recombination and repair] Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>PRK07132 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PF07693 KAP_NTPase: KAP family P-loop domain; InterPro: IPR011646 The KAP (after Kidins220/ARMS and PifA) family of predicted NTPases are sporadically distributed across a wide phylogenetic range in bacteria and in animals Back     alignment and domain information
>PRK13406 bchD magnesium chelatase subunit D; Provisional Back     alignment and domain information
>PTZ00111 DNA replication licensing factor MCM4; Provisional Back     alignment and domain information
>PRK05917 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF05707 Zot: Zonular occludens toxin (Zot); InterPro: IPR008900 This entry consists of bacterial and viral proteins which are very similar to the Zonular occludens toxin (Zot) Back     alignment and domain information
>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PRK05818 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG1239 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolism] Back     alignment and domain information
>PRK14700 recombination factor protein RarA; Provisional Back     alignment and domain information
>PF05872 DUF853: Bacterial protein of unknown function (DUF853); InterPro: IPR008571 Members of this family have a P-loop containing nucleotide triphosphate hydrolases fold Back     alignment and domain information
>PRK08485 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF14516 AAA_35: AAA-like domain Back     alignment and domain information
>PRK13765 ATP-dependent protease Lon; Provisional Back     alignment and domain information
>PF00493 MCM: MCM2/3/5 family This family extends the MCM domain of Prosite Back     alignment and domain information
>PF12846 AAA_10: AAA-like domain Back     alignment and domain information
>KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>TIGR01128 holA DNA polymerase III, delta subunit Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05574 holA DNA polymerase III subunit delta; Reviewed Back     alignment and domain information
>PRK10365 transcriptional regulatory protein ZraR; Provisional Back     alignment and domain information
>PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF Back     alignment and domain information
>TIGR01817 nifA Nif-specific regulatory protein Back     alignment and domain information
>PRK11388 DNA-binding transcriptional regulator DhaR; Provisional Back     alignment and domain information
>KOG2228 consensus Origin recognition complex, subunit 4 [Replication, recombination and repair] Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG1051 consensus Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>KOG0478 consensus DNA replication licensing factor, MCM4 component [Replication, recombination and repair] Back     alignment and domain information
>KOG1968 consensus Replication factor C, subunit RFC1 (large subunit) [Replication, recombination and repair] Back     alignment and domain information
>PHA00012 I assembly protein Back     alignment and domain information
>PRK07452 DNA polymerase III subunit delta; Validated Back     alignment and domain information
>KOG0745 consensus Putative ATP-dependent Clp-type protease (AAA+ ATPase superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13304 AAA_21: AAA domain; PDB: 3QKS_B 1US8_B 1F2U_B 1F2T_B 3QKT_A 1II8_B 3QKR_B 3QKU_A Back     alignment and domain information
>PRK15115 response regulator GlrR; Provisional Back     alignment and domain information
>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional Back     alignment and domain information
>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A Back     alignment and domain information
>TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator Back     alignment and domain information
>TIGR01818 ntrC nitrogen regulation protein NR(I) Back     alignment and domain information
>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model Back     alignment and domain information
>PF02969 TAF: TATA box binding protein associated factor (TAF); InterPro: IPR004823 The TATA box binding protein associated factor (TAF) is part of the transcription initiation factor TFIID multimeric protein complex Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG2035 consensus Replication factor C, subunit RFC3 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>PF00808 CBFD_NFYB_HMF: Histone-like transcription factor (CBF/NF-Y) and archaeal histone; InterPro: IPR003958 The CCAAT-binding factor (CBF) is a mammalian transcription factor that binds to a CCAAT motif in the promoters of a wide variety of genes, including type I collagen and albumin Back     alignment and domain information
>COG1485 Predicted ATPase [General function prediction only] Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query168
4b4t_K428 Near-Atomic Resolution Structural Model Of The Yeas 7e-65
4b4t_I437 Near-Atomic Resolution Structural Model Of The Yeas 7e-44
3h4m_A285 Aaa Atpase Domain Of The Proteasome- Activating Nuc 7e-42
4b4t_J405 Near-Atomic Resolution Structural Model Of The Yeas 4e-41
4b4t_M434 Near-Atomic Resolution Structural Model Of The Yeas 4e-40
4b4t_L437 Near-Atomic Resolution Structural Model Of The Yeas 2e-39
4b4t_H467 Near-Atomic Resolution Structural Model Of The Yeas 3e-36
2dvw_B83 Structure Of The Oncoprotein Gankyrin In Complex Wi 1e-26
1lv7_A257 Crystal Structure Of The Aaa Domain Of Ftsh Length 6e-26
3kds_E 465 Apo-ftsh Crystal Structure Length = 465 1e-25
2ce7_A 476 Edta Treated Length = 476 1e-25
3hu3_A489 Structure Of P97 N-D1 R155h Mutant In Complex With 1e-24
3hu2_A489 Structure Of P97 N-D1 R86a Mutant In Complex With A 1e-24
3hu1_A489 Structure Of P97 N-D1 R95g Mutant In Complex With A 2e-24
1e32_A458 Structure Of The N-Terminal Domain And The D1 Aaa D 2e-24
3cf1_A 806 Structure Of P97VCP IN COMPLEX WITH ADPADP.ALFX Len 2e-24
1r7r_A 816 The Crystal Structure Of Murine P97VCP AT 3.6A Leng 2e-24
2qz4_A262 Human Paraplegin, Aaa Domain In Complex With Adp Le 2e-24
3cf0_A301 Structure Of D2 Subdomain Of P97VCP IN COMPLEX WITH 2e-23
1iy2_A278 Crystal Structure Of The Ftsh Atpase Domain From Th 8e-23
4eiw_A 508 Whole Cytosolic Region Of Atp-Dependent Metalloprot 8e-23
2dhr_A 499 Whole Cytosolic Region Of Atp-Dependent Metalloprot 8e-23
1ixz_A254 Crystal Structure Of The Ftsh Atpase Domain From Th 9e-23
2r62_A268 Crystal Structure Of Helicobacter Pylori Atp Depend 6e-21
2x8a_A274 Human Nuclear Valosin Containing Protein Like (Nvl) 6e-20
2rko_A331 Crystal Structure Of The Vps4p-Dimer Length = 331 2e-17
2qp9_X355 Crystal Structure Of S.Cerevisiae Vps4 Length = 355 3e-17
3eih_A340 Crystal Structure Of S.Cerevisiae Vps4 In The Prese 5e-17
3eie_A322 Crystal Structure Of S.Cerevisiae Vps4 In The So4-B 6e-17
2zam_A444 Crystal Structure Of Mouse Skd1VPS4B APO-Form Lengt 3e-16
1xwi_A322 Crystal Structure Of Vps4b Length = 322 8e-16
2dzn_B82 Crystal Structure Analysis Of Yeast Nas6p Complexed 4e-15
3d8b_A357 Crystal Structure Of Human Fidgetin-Like Protein 1 7e-15
3vfd_A389 Human Spastin Aaa Domain Length = 389 2e-08
3b9p_A297 Spastin Length = 297 5e-08
2krk_A86 Solution Nmr Structure Of 26s Protease Regulatory S 3e-04
>pdb|4B4T|K Chain K, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 428 Back     alignment and structure

Iteration: 1

Score = 242 bits (618), Expect = 7e-65, Method: Compositional matrix adjust. Identities = 125/176 (71%), Positives = 144/176 (81%), Gaps = 8/176 (4%) Query: 1 MVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQTVNV 60 MVRDVFRLA+ENAP+IIFIDEVD+IAT RFDAQTG+DREVQRIL+ELL QMDGFDQ+ NV Sbjct: 253 MVRDVFRLARENAPSIIFIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNV 312 Query: 61 KVIMATNRADTLDPALLRPGRLDRKIEFP-LPDRRQKRLVF-----QMNLSDEVDLEDYV 114 KVIMATNRADTLDPALLRPGRLDRKIEFP L DRR++RL+F +M+L+ E DL+ + Sbjct: 313 KVIMATNRADTLDPALLRPGRLDRKIEFPSLRDRRERRLIFGTIASKMSLAPEADLDSLI 372 Query: 115 SRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDT--DFEFYK 168 R D +S A IAAI QEAG+ AVRKNRYVIL D E+ Y T VK +T F+FYK Sbjct: 373 IRNDSLSGAVIAAIMQEAGLRAVRKNRYVILQSDLEEAYATQVKTDNTVDKFDFYK 428
>pdb|4B4T|I Chain I, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 437 Back     alignment and structure
>pdb|3H4M|A Chain A, Aaa Atpase Domain Of The Proteasome- Activating Nucleotidase Length = 285 Back     alignment and structure
>pdb|4B4T|J Chain J, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 405 Back     alignment and structure
>pdb|4B4T|M Chain M, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 434 Back     alignment and structure
>pdb|4B4T|L Chain L, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 437 Back     alignment and structure
>pdb|4B4T|H Chain H, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 467 Back     alignment and structure
>pdb|2DVW|B Chain B, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 83 Back     alignment and structure
>pdb|1LV7|A Chain A, Crystal Structure Of The Aaa Domain Of Ftsh Length = 257 Back     alignment and structure
>pdb|3KDS|E Chain E, Apo-ftsh Crystal Structure Length = 465 Back     alignment and structure
>pdb|2CE7|A Chain A, Edta Treated Length = 476 Back     alignment and structure
>pdb|3HU3|A Chain A, Structure Of P97 N-D1 R155h Mutant In Complex With Atpgs Length = 489 Back     alignment and structure
>pdb|3HU2|A Chain A, Structure Of P97 N-D1 R86a Mutant In Complex With Atpgs Length = 489 Back     alignment and structure
>pdb|3HU1|A Chain A, Structure Of P97 N-D1 R95g Mutant In Complex With Atpgs Length = 489 Back     alignment and structure
>pdb|1E32|A Chain A, Structure Of The N-Terminal Domain And The D1 Aaa Domain Of Membrane Fusion Atpase P97 Length = 458 Back     alignment and structure
>pdb|3CF1|A Chain A, Structure Of P97VCP IN COMPLEX WITH ADPADP.ALFX Length = 806 Back     alignment and structure
>pdb|1R7R|A Chain A, The Crystal Structure Of Murine P97VCP AT 3.6A Length = 816 Back     alignment and structure
>pdb|2QZ4|A Chain A, Human Paraplegin, Aaa Domain In Complex With Adp Length = 262 Back     alignment and structure
>pdb|3CF0|A Chain A, Structure Of D2 Subdomain Of P97VCP IN COMPLEX WITH ADP Length = 301 Back     alignment and structure
>pdb|1IY2|A Chain A, Crystal Structure Of The Ftsh Atpase Domain From Thermus Thermophilus Length = 278 Back     alignment and structure
>pdb|4EIW|A Chain A, Whole Cytosolic Region Of Atp-Dependent Metalloprotease Ftsh (G399l) Length = 508 Back     alignment and structure
>pdb|2DHR|A Chain A, Whole Cytosolic Region Of Atp-Dependent Metalloprotease Ftsh (G399l) Length = 499 Back     alignment and structure
>pdb|1IXZ|A Chain A, Crystal Structure Of The Ftsh Atpase Domain From Thermus Thermophilus Length = 254 Back     alignment and structure
>pdb|2R62|A Chain A, Crystal Structure Of Helicobacter Pylori Atp Dependent Protease, Ftsh Length = 268 Back     alignment and structure
>pdb|2X8A|A Chain A, Human Nuclear Valosin Containing Protein Like (Nvl), C- Terminal Aaa-Atpase Domain Length = 274 Back     alignment and structure
>pdb|2RKO|A Chain A, Crystal Structure Of The Vps4p-Dimer Length = 331 Back     alignment and structure
>pdb|2QP9|X Chain X, Crystal Structure Of S.Cerevisiae Vps4 Length = 355 Back     alignment and structure
>pdb|3EIH|A Chain A, Crystal Structure Of S.Cerevisiae Vps4 In The Presence Of Atpgammas Length = 340 Back     alignment and structure
>pdb|3EIE|A Chain A, Crystal Structure Of S.Cerevisiae Vps4 In The So4-Bound State Length = 322 Back     alignment and structure
>pdb|2ZAM|A Chain A, Crystal Structure Of Mouse Skd1VPS4B APO-Form Length = 444 Back     alignment and structure
>pdb|1XWI|A Chain A, Crystal Structure Of Vps4b Length = 322 Back     alignment and structure
>pdb|2DZN|B Chain B, Crystal Structure Analysis Of Yeast Nas6p Complexed With The Proteasome Subunit, Rpt3 Length = 82 Back     alignment and structure
>pdb|3D8B|A Chain A, Crystal Structure Of Human Fidgetin-Like Protein 1 In Complex With Adp Length = 357 Back     alignment and structure
>pdb|3VFD|A Chain A, Human Spastin Aaa Domain Length = 389 Back     alignment and structure
>pdb|3B9P|A Chain A, Spastin Length = 297 Back     alignment and structure
>pdb|2KRK|A Chain A, Solution Nmr Structure Of 26s Protease Regulatory Subunit 8 From H.Sapiens, Northeast Structural Genomics Consortium Target Target Hr3102a Length = 86 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query168
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 1e-90
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 2e-50
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 4e-48
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 7e-48
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 9e-34
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 2e-47
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 3e-46
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 5e-41
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 6e-40
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 7e-40
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 8e-40
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 1e-39
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 2e-39
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 2e-38
2r62_A268 Cell division protease FTSH homolog; ATPase domain 7e-38
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 2e-37
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 3e-37
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 1e-36
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 2e-36
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 3e-36
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 5e-36
3aji_B83 S6C, proteasome (prosome, macropain) 26S subunit, 3e-31
2dzn_B82 26S protease regulatory subunit 6B homolog; ankyri 2e-28
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 1e-20
2krk_A86 26S protease regulatory subunit 8; structural geno 2e-16
3kw6_A78 26S protease regulatory subunit 8; structural geno 9e-14
3vlf_B88 26S protease regulatory subunit 7 homolog; heat re 6e-08
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Length = 285 Back     alignment and structure
 Score =  264 bits (677), Expect = 1e-90
 Identities = 85/164 (51%), Positives = 113/164 (68%), Gaps = 5/164 (3%)

Query: 1   MVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQTVNV 60
           +V+D+F+LAKE AP+IIFIDE+DAIA  R DA TG DREVQR LM+LL +MDGFD   +V
Sbjct: 98  LVKDIFKLAKEKAPSIIFIDEIDAIAAKRTDALTGGDREVQRTLMQLLAEMDGFDARGDV 157

Query: 61  KVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQ-----MNLSDEVDLEDYVS 115
           K+I ATNR D LDPA+LRPGR DR IE P PD + +  + +     MNL+++V+LE+   
Sbjct: 158 KIIGATNRPDILDPAILRPGRFDRIIEVPAPDEKGRLEILKIHTRKMNLAEDVNLEEIAK 217

Query: 116 RPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKK 159
             +    AE+ AIC EAGM+A+R+ R  +   DF K     ++K
Sbjct: 218 MTEGCVGAELKAICTEAGMNAIRELRDYVTMDDFRKAVEKIMEK 261


>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Length = 301 Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* 2pjh_B Length = 489 Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Length = 274 Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Length = 293 Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Length = 262 Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Length = 278 Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Length = 322 Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Length = 322 Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Length = 254 Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Length = 257 Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Length = 355 Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Length = 268 Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Length = 444 Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Length = 357 Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Length = 297 Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Length = 499 Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Length = 476 Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Length = 389 Back     alignment and structure
>3aji_B S6C, proteasome (prosome, macropain) 26S subunit, ATPA; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dwz_B* 2dvw_B* Length = 83 Back     alignment and structure
>2dzn_B 26S protease regulatory subunit 6B homolog; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} PDB: 2dzo_B Length = 82 Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Length = 272 Back     alignment and structure
>2krk_A 26S protease regulatory subunit 8; structural genomics, northeast structural genomics consortium (NESG), target HR3102A, PSI-2; NMR {Homo sapiens} Length = 86 Back     alignment and structure
>3kw6_A 26S protease regulatory subunit 8; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Homo sapiens} Length = 78 Back     alignment and structure
>3vlf_B 26S protease regulatory subunit 7 homolog; heat repeat, chaperone, chaperone-protein binding complex; HET: DNA; 3.80A {Saccharomyces cerevisiae} PDB: 4a3v_B* Length = 88 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query168
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 100.0
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 100.0
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 100.0
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 100.0
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 100.0
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 100.0
3cf2_A806 TER ATPase, transitional endoplasmic reticulum ATP 100.0
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 100.0
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 99.97
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 99.96
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 99.96
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 99.95
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 99.95
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 99.94
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 99.94
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 99.94
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 99.94
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 99.94
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 99.93
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 99.93
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 99.93
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 99.92
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 99.92
2r62_A268 Cell division protease FTSH homolog; ATPase domain 99.91
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 99.89
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 99.88
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 99.87
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 99.81
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 99.78
2krk_A86 26S protease regulatory subunit 8; structural geno 99.71
3kw6_A78 26S protease regulatory subunit 8; structural geno 99.7
3aji_B83 S6C, proteasome (prosome, macropain) 26S subunit, 99.68
3vlf_B88 26S protease regulatory subunit 7 homolog; heat re 99.61
2dzn_B82 26S protease regulatory subunit 6B homolog; ankyri 99.57
2c9o_A 456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 99.5
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 99.34
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 99.31
3m6a_A 543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 99.29
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 99.23
2v1u_A387 Cell division control protein 6 homolog; DNA repli 99.21
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 99.17
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 99.14
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 99.08
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 99.08
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 99.07
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 99.04
3bos_A242 Putative DNA replication factor; P-loop containing 99.01
2chg_A226 Replication factor C small subunit; DNA-binding pr 98.98
2qby_A 386 CDC6 homolog 1, cell division control protein 6 ho 98.97
2r44_A331 Uncharacterized protein; putative ATPase, structur 98.96
1g8p_A350 Magnesium-chelatase 38 kDa subunit; parallel beta 98.94
1g41_A 444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 98.92
2qby_B 384 CDC6 homolog 3, cell division control protein 6 ho 98.9
1fnn_A 389 CDC6P, cell division control protein 6; ORC1, AAA 98.88
3hws_A363 ATP-dependent CLP protease ATP-binding subunit CL; 98.88
3pvs_A 447 Replication-associated recombination protein A; ma 98.74
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 98.71
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 98.7
2c9o_A456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 98.69
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 98.68
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 98.68
1jr3_A 373 DNA polymerase III subunit gamma; processivity, pr 98.66
3f9v_A595 Minichromosome maintenance protein MCM; replicativ 98.66
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 98.65
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 98.63
3pxi_A 758 Negative regulator of genetic competence CLPC/MEC; 98.61
3nbx_X 500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 98.6
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 98.58
3pxg_A468 Negative regulator of genetic competence CLPC/MEC; 98.57
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 98.54
2chq_A319 Replication factor C small subunit; DNA-binding pr 98.51
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 98.48
1w5s_A 412 Origin recognition complex subunit 2 ORC2; replica 98.47
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 98.47
1um8_A376 ATP-dependent CLP protease ATP-binding subunit CL; 98.46
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 98.39
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 98.32
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 98.28
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 98.21
1sxj_A 516 Activator 1 95 kDa subunit; clamp loader, processi 98.21
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 98.2
1qvr_A854 CLPB protein; coiled coil, AAA ATPase, chaperone; 98.05
1g41_A444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 98.05
3k1j_A 604 LON protease, ATP-dependent protease LON; ATP-bind 97.93
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 97.85
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 97.74
2gno_A305 DNA polymerase III, gamma subunit-related protein; 97.66
1ojl_A304 Transcriptional regulatory protein ZRAR; response 97.42
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 97.35
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 97.19
3f8t_A506 Predicted ATPase involved in replication control, 97.18
2r2a_A199 Uncharacterized protein; zonular occludens toxin, 97.13
1jr3_D 343 DNA polymerase III, delta subunit; processivity, p 96.68
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 96.18
2fna_A357 Conserved hypothetical protein; structural genomic 96.17
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 94.89
1ny5_A387 Transcriptional regulator (NTRC family); AAA+ ATPa 94.62
4ag6_A392 VIRB4 ATPase, type IV secretory pathway VIRB4 comp 93.73
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 93.69
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 93.42
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 93.27
3co5_A143 Putative two-component system transcriptional RES 93.08
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 92.4
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 90.77
2iut_A574 DNA translocase FTSK; nucleotide-binding, chromoso 88.84
2kjq_A149 DNAA-related protein; solution structure, NESG, st 88.76
3dzd_A368 Transcriptional regulator (NTRC family); sigma43 a 87.97
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 85.43
1taf_B70 TFIID TBP associated factor 62; transcription init 81.78
1b67_A68 Protein (histone HMFA); DNA binding protein; 1.48A 81.02
2ius_A512 DNA translocase FTSK; nucleotide-binding, chromoso 80.23
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
Probab=100.00  E-value=3.2e-41  Score=272.21  Aligned_cols=158  Identities=45%  Similarity=0.797  Sum_probs=148.7

Q ss_pred             HHHHHHHHHHcCCeEEEEcccccccccccCCCCCcchHHHHHHHHHHHhccCCCCCCCeEEEEecCCCCCCCccccCCCC
Q 030960            2 VRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGR   81 (168)
Q Consensus         2 l~~iF~~a~~~~p~ii~iDe~D~l~~~~~~~~~~~~~~~~~~~~~ll~~l~~~~~~~~v~vi~ttn~~~~ld~al~r~gr   81 (168)
                      |+.+|+.|+.++||||||||+|++++.|....++.+....+++++||++||++....+|+||||||+|+.||||++||||
T Consensus       230 vr~lF~~Ar~~aP~IIFiDEiDai~~~R~~~~~~~~~~~~~~l~~lL~~lDg~~~~~~V~vIaATNrpd~LDpAllRpGR  309 (405)
T 4b4t_J          230 VRELFVMAREHAPSIIFMDEIDSIGSTRVEGSGGGDSEVQRTMLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGR  309 (405)
T ss_dssp             HHHHHHHHHHTCSEEEEEESSSCCTTSCSCSSSGGGGHHHHHHHHHHHHHHTTTCCCCEEEEEEESCSSSSCHHHHSTTS
T ss_pred             HHHHHHHHHHhCCceEeeecchhhccCCCCCCCCCcHHHHHHHHHHHHhhhccCCCCCeEEEeccCChhhCCHhHcCCCc
Confidence            78999999999999999999999999987777666777889999999999999999999999999999999999999999


Q ss_pred             cceEEecCCCCHHHHHHHHHhhcC-----CCCCHHHHHhCCCCCCHHHHHHHHHHHHHHHHHhCCCccCHHHHHHHHHhh
Q 030960           82 LDRKIEFPLPDRRQKRLVFQMNLS-----DEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTN  156 (168)
Q Consensus        82 f~~~i~~~~P~~~~R~~il~~~l~-----~~~~~~~la~~t~g~s~~di~~l~~~a~~~a~~~~~~~i~~~d~~~al~~~  156 (168)
                      ||+.|+|++|+.++|.+||+.++.     .+++++.+|+.|+||||+||+++|++|++.|++++...|+.+||+.|++++
T Consensus       310 fD~~I~i~lPd~~~R~~Il~~~~~~~~l~~dvdl~~lA~~t~G~SGADi~~l~~eA~~~Air~~~~~vt~~Df~~Al~~v  389 (405)
T 4b4t_J          310 IDRKIEFPPPSVAARAEILRIHSRKMNLTRGINLRKVAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQEDFELAVGKV  389 (405)
T ss_dssp             SCCEEECCCCCHHHHHHHHHHHHTTSBCCSSCCHHHHHHHCCSCCHHHHHHHHHHHHHHHHHTTCSBCCHHHHHHHHHHH
T ss_pred             CceEEEcCCcCHHHHHHHHHHHhcCCCCCccCCHHHHHHHCCCCCHHHHHHHHHHHHHHHHHcCCCCcCHHHHHHHHHHH
Confidence            999999999999999999997665     578999999999999999999999999999999999999999999999988


Q ss_pred             cCC
Q 030960          157 VKK  159 (168)
Q Consensus       157 ~p~  159 (168)
                      .++
T Consensus       390 ~~~  392 (405)
T 4b4t_J          390 MNK  392 (405)
T ss_dssp             HHH
T ss_pred             hCc
Confidence            764



>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>2krk_A 26S protease regulatory subunit 8; structural genomics, northeast structural genomics consortium (NESG), target HR3102A, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>3kw6_A 26S protease regulatory subunit 8; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Homo sapiens} Back     alignment and structure
>3aji_B S6C, proteasome (prosome, macropain) 26S subunit, ATPA; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dwz_B* 2dvw_B* Back     alignment and structure
>3vlf_B 26S protease regulatory subunit 7 homolog; heat repeat, chaperone, chaperone-protein binding complex; HET: DNA; 3.80A {Saccharomyces cerevisiae} PDB: 4a3v_B* Back     alignment and structure
>2dzn_B 26S protease regulatory subunit 6B homolog; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} PDB: 2dzo_B Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>3f8t_A Predicted ATPase involved in replication control, CDC46/MCM family; helicase, MCM homolog, DNA replication, ATP-binding, DNA-binding; 1.90A {Methanopyrus kandleri AV19} Back     alignment and structure
>2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} Back     alignment and structure
>1jr3_D DNA polymerase III, delta subunit; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1jqj_C* 1xxh_A* 1xxi_A* 3glf_A* 3glg_A* 3glh_A* 3gli_A* Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* Back     alignment and structure
>4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>2iut_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- cell division, DNA translocation, KOPS, membrane; HET: DNA SAP; 2.25A {Pseudomonas aeruginosa} PDB: 2iuu_A* Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>1taf_B TFIID TBP associated factor 62; transcription initiation, histone fold, complex (TWO transcr factors); 2.00A {Drosophila melanogaster} SCOP: a.22.1.3 Back     alignment and structure
>1b67_A Protein (histone HMFA); DNA binding protein; 1.48A {Methanothermus fervidus} SCOP: a.22.1.2 PDB: 1hta_A 1a7w_A 1b6w_A 1bfm_A Back     alignment and structure
>2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 168
d1lv7a_256 c.37.1.20 (A:) AAA domain of cell division protein 3e-57
d1ixza_247 c.37.1.20 (A:) AAA domain of cell division protein 3e-57
d1r7ra3265 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p 1e-35
d1w44a_321 c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [Ta 1e-23
d1e32a2258 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p 5e-22
d1svma_362 c.37.1.20 (A:) Papillomavirus large T antigen heli 6e-12
d1gvnb_273 c.37.1.21 (B:) Plasmid maintenance system epsilon/ 4e-10
d1d2na_246 c.37.1.20 (A:) Hexamerization domain of N-ethylmal 3e-09
d1ofha_309 c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId 4e-06
d1fnna2276 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrob 2e-05
d1w5sa2287 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-t 7e-04
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Length = 256 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: AAA domain of cell division protein FtsH
species: Escherichia coli [TaxId: 562]
 Score =  178 bits (452), Expect = 3e-57
 Identities = 62/156 (39%), Positives = 89/156 (57%), Gaps = 5/156 (3%)

Query: 1   MVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQTVNV 60
            VRD+F  AK+ AP IIFIDE+DA+   R     G   E ++ L ++L +MDGF+    +
Sbjct: 92  RVRDMFEQAKKAAPCIIFIDEIDAVGRQRGAGLGGGHDEREQTLNQMLVEMDGFEGNEGI 151

Query: 61  KVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQ-----MNLSDEVDLEDYVS 115
            VI ATNR D LDPALLRPGR DR++   LPD R +  + +     + L+ ++D      
Sbjct: 152 IVIAATNRPDVLDPALLRPGRFDRQVVVGLPDVRGREQILKVHMRRVPLAPDIDAAIIAR 211

Query: 116 RPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEK 151
                S A++A +  EA + A R N+ V+   +FEK
Sbjct: 212 GTPGFSGADLANLVNEAALFAARGNKRVVSMVEFEK 247


>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Length = 247 Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 265 Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Length = 321 Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 258 Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Length = 362 Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Length = 273 Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 246 Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Length = 309 Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 276 Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Length = 287 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query168
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 100.0
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 100.0
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 100.0
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 100.0
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 99.68
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 99.67
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 99.22
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 98.99
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 98.89
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 98.73
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 98.64
d1svma_362 Papillomavirus large T antigen helicase domain {Si 98.59
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 98.4
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 98.37
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 98.34
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 98.32
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 98.3
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 98.29
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 98.24
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 98.24
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 97.83
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 97.74
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 97.65
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 97.63
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 97.28
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 97.28
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 97.24
d1qvra2 387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 96.79
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 95.93
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 93.44
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 90.44
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 89.72
d1htaa_68 Archaeal histone {Archaeon Methanothermus fervidus 89.39
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 88.98
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 83.98
d1ku5a_66 Archaeal histone {Archaeon (Pyrococcus horikoshii) 83.23
d1e69a_308 Smc head domain {Thermotoga maritima [TaxId: 2336] 82.01
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 81.59
d2hyda1255 Putative multidrug export ATP-binding/permease pro 80.68
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: AAA domain of cell division protein FtsH
species: Escherichia coli [TaxId: 562]
Probab=100.00  E-value=1.1e-37  Score=237.67  Aligned_cols=156  Identities=39%  Similarity=0.625  Sum_probs=145.4

Q ss_pred             HHHHHHHHHHcCCeEEEEcccccccccccCCCCCcchHHHHHHHHHHHhccCCCCCCCeEEEEecCCCCCCCccccCCCC
Q 030960            2 VRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGR   81 (168)
Q Consensus         2 l~~iF~~a~~~~p~ii~iDe~D~l~~~~~~~~~~~~~~~~~~~~~ll~~l~~~~~~~~v~vi~ttn~~~~ld~al~r~gr   81 (168)
                      |+.+|+.|++++||||||||+|.++++|+......+....+++++|++.++++...++|+||||||+|+.||++++||||
T Consensus        93 l~~~f~~A~~~~P~il~iDeiD~l~~~r~~~~~~~~~~~~~~~~~ll~~~d~~~~~~~v~vIatTn~~~~ld~al~R~gR  172 (256)
T d1lv7a_          93 VRDMFEQAKKAAPCIIFIDEIDAVGRQRGAGLGGGHDEREQTLNQMLVEMDGFEGNEGIIVIAATNRPDVLDPALLRPGR  172 (256)
T ss_dssp             HHHHHHHHHTTCSEEEEETTHHHHTCCCSTTSCCTTCHHHHHHHHHHHHHHTCCSSSCEEEEEEESCTTTSCGGGGSTTS
T ss_pred             HHHHHHHHHHcCCEEEEEEChhhhCccCCCCCCCCcHHHHHHHHHHHHHhhCCCCCCCEEEEEeCCCcccCCHhHcCCCC
Confidence            68999999999999999999999999887666655566678999999999999888899999999999999999999999


Q ss_pred             cceEEecCCCCHHHHHHHHHhhcC-----CCCCHHHHHhCCCCCCHHHHHHHHHHHHHHHHHhCCCccCHHHHHHHHHhh
Q 030960           82 LDRKIEFPLPDRRQKRLVFQMNLS-----DEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTN  156 (168)
Q Consensus        82 f~~~i~~~~P~~~~R~~il~~~l~-----~~~~~~~la~~t~g~s~~di~~l~~~a~~~a~~~~~~~i~~~d~~~al~~~  156 (168)
                      ||+.|+|++|+.++|.+||+.++.     .+.++..+++.|+|||++||.++|++|+..++++++..++.+||+.|++++
T Consensus       173 fd~~i~i~~P~~~~R~~il~~~l~~~~~~~~~~~~~la~~t~G~s~adi~~l~~~A~~~a~~~~~~~i~~~d~~~Al~rv  252 (256)
T d1lv7a_         173 FDRQVVVGLPDVRGREQILKVHMRRVPLAPDIDAAIIARGTPGFSGADLANLVNEAALFAARGNKRVVSMVEFEKAKDKI  252 (256)
T ss_dssp             SCEEEECCCCCHHHHHHHHHHHHTTSCBCTTCCHHHHHHTCTTCCHHHHHHHHHHHHHHHHHTTCSSBCHHHHHHHHHHH
T ss_pred             CCEEEECCCcCHHHHHHHHHHhccCCCcCcccCHHHHHHhCCCCCHHHHHHHHHHHHHHHHHcCCCccCHHHHHHHHHHH
Confidence            999999999999999999997776     478999999999999999999999999999999999999999999999987


Q ss_pred             c
Q 030960          157 V  157 (168)
Q Consensus       157 ~  157 (168)
                      .
T Consensus       253 ~  253 (256)
T d1lv7a_         253 M  253 (256)
T ss_dssp             T
T ss_pred             h
Confidence            5



>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1htaa_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanothermus fervidus, histone A [TaxId: 2180]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ku5a_ a.22.1.2 (A:) Archaeal histone {Archaeon (Pyrococcus horikoshii) [TaxId: 53953]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure