Citrus Sinensis ID: 031020


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------
MPGLITDFLISLDDRFLYFSNWLHGDIRQYNIEDPKNPVLTGQIWVGGLFRKGSPVVAVTDDGQPYQSDVPEVQGHRLRGGPQMIQLSLDGKRLYVTNSLFSAWDCQFYPELKEKGSHMLQIDVNSEKGGMAINPNFFVDFEAEPDGPALAHEMRYPGGDCTSDIWI
ccccEEEEEEEEcccEEEEEEccccEEEEEEcccccccEEEcEEEEccEEEccccEEEEccccccccccccccccccccccccEEEEEEcccEEEEEEccccccccccccccccccEEEEEEEEccccccEEEcccEEEEccccccccccEEEEccccccccccccc
ccccEEEEEEEccccEEEEEccccccEEEEEccccccccEEEEEEEEEEEEccccEEEEEccccccccccccccccEccccccEEEEEccccEEEEEccccccHHHHcccHHcccccEEEEEEcccccccEEEcccEEEEcccccccccccEEEEcccccccccEcc
MPGLITDFLISLDDRFLYFsnwlhgdirqyniedpknpvltgqiwvgglfrkgspvvavtddgqpyqsdvpevqghrlrggpqMIQLSLDGKRLYVTNSlfsawdcqfypelkekgshmlqidvnsekggmainpnffvdfeaepdgpalahemrypggdctsdiwi
MPGLITDFLISLDDRFLYFSNWLHGDIRQYNIEDPKNPVLTGQIWVGGLFRKGSPVVAVTDDGQPYQSDVpevqghrlrgGPQMIQLSLDGKRLYVTNSLFSAWDCQFYPELKEKGSHMLQIDVNSEKGGMAINPNFFVDFEAEPDGPALAHemrypggdctsdiwi
MPGLITDFLISLDDRFLYFSNWLHGDIRQYNIEDPKNPVLTGQIWVGGLFRKGSPVVAVTDDGQPYQSDVPEVQGHRLRGGPQMIQLSLDGKRLYVTNSLFSAWDCQFYPELKEKGSHMLQIDVNSEKGGMAINPNFFVDFEAEPDGPALAHEMRYPGGDCTSDIWI
***LITDFLISLDDRFLYFSNWLHGDIRQYNIEDPKNPVLTGQIWVGGLFRKGSPVVAVTD*********************QMIQLSLDGKRLYVTNSLFSAWDCQFYP**********************INPNFFVDF**************************
*PGLITDFLISLDDRFLYFSNWLHGDIRQYNIEDPKNPVLTGQIWVGGLFRKGSPVVAVTDDGQPYQSDVPEVQGHRLRGGPQMIQLSLDGKRLYVTNSLFSAWDCQFYPELKEKGSHMLQIDVNSEKGGMAINPNFFVDFEAEPDGPALAHEMRYPGGDCTSDIWI
MPGLITDFLISLDDRFLYFSNWLHGDIRQYNIEDPKNPVLTGQIWVGGLFRKGSPVVAVTDDGQPYQSDVPEVQGHRLRGGPQMIQLSLDGKRLYVTNSLFSAWDCQFYPELKEKGSHMLQIDVNSEKGGMAINPNFFVDFEAEPDGPALAHEMRYPGGDCTSDIWI
*PGLITDFLISLDDRFLYFSNWLHGDIRQYNIEDPKNPVLTGQIWVGGLFRKGSPVVAVTDDGQPYQSDVPEVQGHRLRGGPQMIQLSLDGKRLYVTNSLFSAWDCQFYPELKEKGSHMLQIDVNSEKGGMAINPNFFVDFEAEPDGPALAHEMRYPGGDCTSDIWI
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPGLITDFLISLDDRFLYFSNWLHGDIRQYNIEDPKNPVLTGQIWVGGLFRKGSPVVAVTDDGQPYQSDVPEVQGHRLRGGPQMIQLSLDGKRLYVTNSLFSAWDCQFYPELKEKGSHMLQIDVNSEKGGMAINPNFFVDFEAEPDGPALAHEMRYPGGDCTSDIWI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query167 2.2.26 [Sep-21-2011]
O23264490 Selenium-binding protein yes no 1.0 0.340 0.814 5e-79
Q93WN0487 Selenium-binding protein no no 1.0 0.342 0.808 3e-78
Q9LK38480 Selenium-binding protein no no 1.0 0.347 0.808 2e-77
Q569D5472 Selenium-binding protein yes no 1.0 0.353 0.682 2e-63
Q5RF48472 Selenium-binding protein yes no 1.0 0.353 0.682 1e-62
Q52KZ7472 Selenium-binding protein N/A no 1.0 0.353 0.676 2e-62
Q13228472 Selenium-binding protein yes no 1.0 0.353 0.670 3e-62
Q6DCH7472 Selenium-binding protein N/A no 1.0 0.353 0.664 2e-61
Q8VIF7472 Selenium-binding protein yes no 1.0 0.353 0.682 3e-61
Q2KJ32472 Selenium-binding protein yes no 1.0 0.353 0.664 1e-60
>sp|O23264|SEBP1_ARATH Selenium-binding protein 1 OS=Arabidopsis thaliana GN=SBP1 PE=1 SV=1 Back     alignment and function desciption
 Score =  292 bits (748), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 136/167 (81%), Positives = 152/167 (91%)

Query: 1   MPGLITDFLISLDDRFLYFSNWLHGDIRQYNIEDPKNPVLTGQIWVGGLFRKGSPVVAVT 60
           MPGLITDFLISLDDRF+YF NWLHGDIRQYNIEDPKNPVLTGQIWVGGL +KGSPV AV 
Sbjct: 324 MPGLITDFLISLDDRFIYFVNWLHGDIRQYNIEDPKNPVLTGQIWVGGLLQKGSPVKAVG 383

Query: 61  DDGQPYQSDVPEVQGHRLRGGPQMIQLSLDGKRLYVTNSLFSAWDCQFYPELKEKGSHML 120
           +DG  +Q +VP+++G  LRGGPQMIQLSLDGKRLY TNSLFSAWD QFYPE+ EKGSH++
Sbjct: 384 EDGNTFQFEVPQIKGKSLRGGPQMIQLSLDGKRLYATNSLFSAWDRQFYPEIMEKGSHII 443

Query: 121 QIDVNSEKGGMAINPNFFVDFEAEPDGPALAHEMRYPGGDCTSDIWI 167
           QIDV++EKGG+ INP+FFVDF  EPDGP+LAHEMRYPGGDCTSDIWI
Sbjct: 444 QIDVDTEKGGLTINPDFFVDFGDEPDGPSLAHEMRYPGGDCTSDIWI 490




Binds cadmium and mediates lower sensitivity to stress requiring glutathione (GSH) for tolerance (e.g. cadmium, selenate, and hydrogen peroxide excess). Probably helps to detoxify cadmium potentially through direct binding.
Arabidopsis thaliana (taxid: 3702)
>sp|Q93WN0|SEBP2_ARATH Selenium-binding protein 2 OS=Arabidopsis thaliana GN=SBP2 PE=2 SV=1 Back     alignment and function description
>sp|Q9LK38|SEBP3_ARATH Selenium-binding protein 3 OS=Arabidopsis thaliana GN=SBP3 PE=2 SV=1 Back     alignment and function description
>sp|Q569D5|SBP1_XENTR Selenium-binding protein 1 OS=Xenopus tropicalis GN=selenbp1 PE=2 SV=1 Back     alignment and function description
>sp|Q5RF48|SBP1_PONAB Selenium-binding protein 1 OS=Pongo abelii GN=SELENBP1 PE=2 SV=1 Back     alignment and function description
>sp|Q52KZ7|SBP1A_XENLA Selenium-binding protein 1-A OS=Xenopus laevis GN=selenbp1-a PE=2 SV=1 Back     alignment and function description
>sp|Q13228|SBP1_HUMAN Selenium-binding protein 1 OS=Homo sapiens GN=SELENBP1 PE=1 SV=2 Back     alignment and function description
>sp|Q6DCH7|SBP1B_XENLA Selenium-binding protein 1-B OS=Xenopus laevis GN=selenbp1-b PE=2 SV=1 Back     alignment and function description
>sp|Q8VIF7|SBP1_RAT Selenium-binding protein 1 OS=Rattus norvegicus GN=Selenbp1 PE=1 SV=1 Back     alignment and function description
>sp|Q2KJ32|SBP1_BOVIN Selenium-binding protein 1 OS=Bos taurus GN=SELENBP1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query167
224055825 483 predicted protein [Populus trichocarpa] 1.0 0.345 0.844 6e-81
356525197 484 PREDICTED: selenium-binding protein 2 [G 1.0 0.345 0.844 2e-80
15485716 487 selenium binding protein [Lotus japonicu 1.0 0.342 0.850 4e-80
388520385 488 unknown [Medicago truncatula] 1.0 0.342 0.850 6e-80
357462825 488 Selenium binding protein [Medicago trunc 1.0 0.342 0.844 2e-79
15485722 478 selenium binding protein [Glycine max] 1.0 0.349 0.838 2e-79
15485720 488 selenium binding protein [Medicago sativ 1.0 0.342 0.844 2e-79
255559184 475 selenium-binding protein, putative [Rici 1.0 0.351 0.838 2e-79
356568342 484 PREDICTED: selenium-binding protein 1-li 1.0 0.345 0.826 2e-79
356540103 480 PREDICTED: selenium-binding protein 1-li 1.0 0.347 0.826 3e-79
>gi|224055825|ref|XP_002298672.1| predicted protein [Populus trichocarpa] gi|222845930|gb|EEE83477.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  305 bits (780), Expect = 6e-81,   Method: Compositional matrix adjust.
 Identities = 141/167 (84%), Positives = 156/167 (93%)

Query: 1   MPGLITDFLISLDDRFLYFSNWLHGDIRQYNIEDPKNPVLTGQIWVGGLFRKGSPVVAVT 60
           MPGLITDFL+SLDDRFLYF NWLHGD+RQYNIEDPKNPVL GQ+WVGGL +KGSPVVA  
Sbjct: 317 MPGLITDFLLSLDDRFLYFVNWLHGDVRQYNIEDPKNPVLKGQVWVGGLIQKGSPVVAEG 376

Query: 61  DDGQPYQSDVPEVQGHRLRGGPQMIQLSLDGKRLYVTNSLFSAWDCQFYPELKEKGSHML 120
           +DG+ +Q DVPE+QGHRLRGGPQMIQLSLDGKRLYVTNSLFS WD QFYPE+ EKGSHML
Sbjct: 377 EDGKTWQYDVPEIQGHRLRGGPQMIQLSLDGKRLYVTNSLFSTWDRQFYPEVVEKGSHML 436

Query: 121 QIDVNSEKGGMAINPNFFVDFEAEPDGPALAHEMRYPGGDCTSDIWI 167
           QIDV++EKGG+AINPN+FVDF +EPDGP+LAHEMRYPGGDCTSDIWI
Sbjct: 437 QIDVDTEKGGLAINPNYFVDFASEPDGPSLAHEMRYPGGDCTSDIWI 483




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|356525197|ref|XP_003531213.1| PREDICTED: selenium-binding protein 2 [Glycine max] Back     alignment and taxonomy information
>gi|15485716|emb|CAC67491.1| selenium binding protein [Lotus japonicus] gi|15485718|emb|CAC67492.1| selenium binding protein [Lotus japonicus] Back     alignment and taxonomy information
>gi|388520385|gb|AFK48254.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|357462825|ref|XP_003601694.1| Selenium binding protein [Medicago truncatula] gi|355490742|gb|AES71945.1| Selenium binding protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|15485722|emb|CAC67472.1| selenium binding protein [Glycine max] Back     alignment and taxonomy information
>gi|15485720|emb|CAC67501.1| selenium binding protein [Medicago sativa] Back     alignment and taxonomy information
>gi|255559184|ref|XP_002520613.1| selenium-binding protein, putative [Ricinus communis] gi|223540174|gb|EEF41749.1| selenium-binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356568342|ref|XP_003552370.1| PREDICTED: selenium-binding protein 1-like [Glycine max] Back     alignment and taxonomy information
>gi|356540103|ref|XP_003538530.1| PREDICTED: selenium-binding protein 1-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query167
TAIR|locus:2129351490 SBP1 "selenium-binding protein 1.0 0.340 0.814 1.7e-75
TAIR|locus:2129356487 SBP2 "selenium-binding protein 1.0 0.342 0.808 9.3e-75
TAIR|locus:2095183480 SBP3 "selenium-binding protein 1.0 0.347 0.808 8.4e-74
UNIPROTKB|F1ST01472 SELENBP1 "Uncharacterized prot 1.0 0.353 0.682 3.9e-60
UNIPROTKB|Q13228472 SELENBP1 "Selenium-binding pro 1.0 0.353 0.670 8.1e-60
UNIPROTKB|F1PNH6502 SELENBP1 "Uncharacterized prot 1.0 0.332 0.670 3.5e-59
ZFIN|ZDB-GENE-040426-1436473 selenbp1 "selenium binding pro 0.976 0.344 0.666 4.5e-59
RGD|620571472 Selenbp1 "selenium binding pro 1.0 0.353 0.682 1.5e-58
UNIPROTKB|Q8VIF7472 Selenbp1 "Selenium-binding pro 1.0 0.353 0.682 1.5e-58
UNIPROTKB|Q2KJ32472 SELENBP1 "Selenium-binding pro 1.0 0.353 0.664 4e-58
TAIR|locus:2129351 SBP1 "selenium-binding protein 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 761 (272.9 bits), Expect = 1.7e-75, P = 1.7e-75
 Identities = 136/167 (81%), Positives = 152/167 (91%)

Query:     1 MPGLITDFLISLDDRFLYFSNWLHGDIRQYNIEDPKNPVLTGQIWVGGLFRKGSPVVAVT 60
             MPGLITDFLISLDDRF+YF NWLHGDIRQYNIEDPKNPVLTGQIWVGGL +KGSPV AV 
Sbjct:   324 MPGLITDFLISLDDRFIYFVNWLHGDIRQYNIEDPKNPVLTGQIWVGGLLQKGSPVKAVG 383

Query:    61 DDGQPYQSDVPEVQGHRLRGGPQMIQLSLDGKRLYVTNSLFSAWDCQFYPELKEKGSHML 120
             +DG  +Q +VP+++G  LRGGPQMIQLSLDGKRLY TNSLFSAWD QFYPE+ EKGSH++
Sbjct:   384 EDGNTFQFEVPQIKGKSLRGGPQMIQLSLDGKRLYATNSLFSAWDRQFYPEIMEKGSHII 443

Query:   121 QIDVNSEKGGMAINPNFFVDFEAEPDGPALAHEMRYPGGDCTSDIWI 167
             QIDV++EKGG+ INP+FFVDF  EPDGP+LAHEMRYPGGDCTSDIWI
Sbjct:   444 QIDVDTEKGGLTINPDFFVDFGDEPDGPSLAHEMRYPGGDCTSDIWI 490




GO:0005634 "nucleus" evidence=ISM
GO:0008430 "selenium binding" evidence=IEA;ISS
GO:0046686 "response to cadmium ion" evidence=IEP;IDA
GO:0000103 "sulfate assimilation" evidence=IEP
GO:0042542 "response to hydrogen peroxide" evidence=IDA
GO:0071291 "cellular response to selenium ion" evidence=IDA
GO:0005829 "cytosol" evidence=IDA
GO:0009506 "plasmodesma" evidence=IDA
TAIR|locus:2129356 SBP2 "selenium-binding protein 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2095183 SBP3 "selenium-binding protein 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|F1ST01 SELENBP1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q13228 SELENBP1 "Selenium-binding protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1PNH6 SELENBP1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1436 selenbp1 "selenium binding protein 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
RGD|620571 Selenbp1 "selenium binding protein 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q8VIF7 Selenbp1 "Selenium-binding protein 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q2KJ32 SELENBP1 "Selenium-binding protein 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O23264SEBP1_ARATHNo assigned EC number0.81431.00.3408yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
estExt_Genewise1_v1.C_LG_I3319
hypothetical protein (484 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query167
pfam05694461 pfam05694, SBP56, 56kDa selenium binding protein ( 1e-100
>gnl|CDD|218697 pfam05694, SBP56, 56kDa selenium binding protein (SBP56) Back     alignment and domain information
 Score =  294 bits (755), Expect = e-100
 Identities = 100/166 (60%), Positives = 122/166 (73%), Gaps = 15/166 (9%)

Query: 2   PGLITDFLISLDDRFLYFSNWLHGDIRQYNIEDPKNPVLTGQIWVGGLFRKGSPVVAVTD 61
           P L+TD L+SLDDRFLY S W HGD+RQY+I DP NP LTGQ+ +GG+ R+         
Sbjct: 311 PPLVTDILLSLDDRFLYVSCWGHGDLRQYDISDPFNPKLTGQVRLGGIIRRA-------- 362

Query: 62  DGQPYQSDVPEVQGHRLRGGPQMIQLSLDGKRLYVTNSLFSAWDCQFYPELKEKGSHMLQ 121
                    P V+G RL GGPQM+QLSLDGKRLYVTNSL+SAWD QFYP+  +KG  ML+
Sbjct: 363 -------PHPAVKGRRLNGGPQMVQLSLDGKRLYVTNSLYSAWDDQFYPDGVKKGGWMLK 415

Query: 122 IDVNSEKGGMAINPNFFVDFEAEPDGPALAHEMRYPGGDCTSDIWI 167
           IDV+ + GG++++PNFFVDF  EPDGPA AHE+R PGGDC+SD W 
Sbjct: 416 IDVDPDNGGLSLDPNFFVDFGKEPDGPARAHEIRLPGGDCSSDSWC 461


This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea. The exact function of this protein is unknown although it is thought that SBP56 participates in late stages of intra-Golgi protein transport. The Lotus japonicus homologue of SBP56, LjSBP is thought to have more than one physiological role and can be implicated in controlling the oxidation/reduction status of target proteins, in vesicular Golgi transport. Length = 461

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 167
KOG0918476 consensus Selenium-binding protein [Inorganic ion 100.0
PF05694461 SBP56: 56kDa selenium binding protein (SBP56); Int 100.0
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 99.73
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 99.72
PRK11028330 6-phosphogluconolactonase; Provisional 99.5
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 99.13
PRK11028330 6-phosphogluconolactonase; Provisional 99.08
TIGR02658 352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 98.92
PF02239 369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 98.87
PF02239 369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 98.58
TIGR0227642 beta_rpt_yvtn 40-residue YVTN family beta-propelle 98.55
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 98.53
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 98.42
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 98.39
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 98.18
PF07433 305 DUF1513: Protein of unknown function (DUF1513); In 98.13
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 98.06
TIGR03866 300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 98.05
PF0830942 LVIVD: LVIVD repeat; InterPro: IPR013211 This repe 97.77
COG3391 381 Uncharacterized conserved protein [Function unknow 97.68
PF06433 342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 97.67
PRK02888 635 nitrous-oxide reductase; Validated 97.6
PRK02888 635 nitrous-oxide reductase; Validated 97.49
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 97.44
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 97.42
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 97.15
COG3391381 Uncharacterized conserved protein [Function unknow 97.12
COG3386307 Gluconolactonase [Carbohydrate transport and metab 97.04
COG5276 370 Uncharacterized conserved protein [Function unknow 97.01
COG3490 366 Uncharacterized protein conserved in bacteria [Fun 96.36
TIGR0227642 beta_rpt_yvtn 40-residue YVTN family beta-propelle 96.34
PRK01742429 tolB translocation protein TolB; Provisional 96.01
COG5276370 Uncharacterized conserved protein [Function unknow 96.0
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 95.96
PRK03629429 tolB translocation protein TolB; Provisional 95.95
PF0173186 Arylesterase: Arylesterase; InterPro: IPR002640 Th 95.86
KOG2055514 consensus WD40 repeat protein [General function pr 95.8
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 95.74
PRK01742429 tolB translocation protein TolB; Provisional 95.71
KOG2096 420 consensus WD40 repeat protein [General function pr 95.69
PRK02889427 tolB translocation protein TolB; Provisional 95.65
PRK04792448 tolB translocation protein TolB; Provisional 95.52
PRK01029428 tolB translocation protein TolB; Provisional 95.48
cd00200 289 WD40 WD40 domain, found in a number of eukaryotic 95.47
PRK03629429 tolB translocation protein TolB; Provisional 95.36
PRK00178430 tolB translocation protein TolB; Provisional 95.28
KOG1539 910 consensus WD repeat protein [General function pred 95.27
PRK04792448 tolB translocation protein TolB; Provisional 95.23
COG3386307 Gluconolactonase [Carbohydrate transport and metab 95.15
PRK04922433 tolB translocation protein TolB; Provisional 95.14
PRK04922433 tolB translocation protein TolB; Provisional 95.07
PRK02889427 tolB translocation protein TolB; Provisional 94.99
PF06433 342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 94.68
PF13449326 Phytase-like: Esterase-like activity of phytase 94.58
PRK05137435 tolB translocation protein TolB; Provisional 94.47
PF0308889 Str_synth: Strictosidine synthase; InterPro: IPR01 94.44
PRK00178430 tolB translocation protein TolB; Provisional 94.4
PRK01029428 tolB translocation protein TolB; Provisional 94.24
PTZ00420 568 coronin; Provisional 94.19
PF07433 305 DUF1513: Protein of unknown function (DUF1513); In 94.11
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 93.75
TIGR02604 367 Piru_Ver_Nterm putative membrane-bound dehydrogena 93.74
smart0013543 LY Low-density lipoprotein-receptor YWTD domain. T 93.55
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 93.51
PRK04043419 tolB translocation protein TolB; Provisional 93.49
PRK04043419 tolB translocation protein TolB; Provisional 93.33
PRK05137435 tolB translocation protein TolB; Provisional 93.24
PF09826 521 Beta_propel: Beta propeller domain; InterPro: IPR0 92.97
KOG0266456 consensus WD40 repeat-containing protein [General 92.76
COG4946 668 Uncharacterized protein related to the periplasmic 92.67
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 92.62
TIGR02604 367 Piru_Ver_Nterm putative membrane-bound dehydrogena 92.55
KOG0315311 consensus G-protein beta subunit-like protein (con 92.54
PRK13616591 lipoprotein LpqB; Provisional 91.93
KOG2110391 consensus Uncharacterized conserved protein, conta 91.89
KOG0266456 consensus WD40 repeat-containing protein [General 91.82
KOG0639705 consensus Transducin-like enhancer of split protei 91.75
KOG0771398 consensus Prolactin regulatory element-binding pro 91.27
KOG0647 347 consensus mRNA export protein (contains WD40 repea 90.51
KOG0263707 consensus Transcription initiation factor TFIID, s 90.31
PF03022287 MRJP: Major royal jelly protein; InterPro: IPR0035 90.07
KOG3881412 consensus Uncharacterized conserved protein [Funct 90.03
PTZ00421 493 coronin; Provisional 89.81
KOG0271 480 consensus Notchless-like WD40 repeat-containing pr 89.64
PF06977 248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 89.62
KOG4499310 consensus Ca2+-binding protein Regucalcin/SMP30 [I 89.61
KOG0318603 consensus WD40 repeat stress protein/actin interac 89.52
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 89.49
PF0767639 PD40: WD40-like Beta Propeller Repeat; InterPro: I 89.22
PF05694461 SBP56: 56kDa selenium binding protein (SBP56); Int 89.2
KOG0772 641 consensus Uncharacterized conserved protein, conta 89.14
KOG2321 703 consensus WD40 repeat protein [General function pr 88.78
KOG0293 519 consensus WD40 repeat-containing protein [Function 88.72
PF09826521 Beta_propel: Beta propeller domain; InterPro: IPR0 88.72
smart0013543 LY Low-density lipoprotein-receptor YWTD domain. T 88.66
KOG2315 566 consensus Predicted translation initiation factor 88.64
KOG0318 603 consensus WD40 repeat stress protein/actin interac 88.47
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 87.82
PF0143628 NHL: NHL repeat; InterPro: IPR001258 The NHL repea 87.56
PTZ00421 493 coronin; Provisional 87.49
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 87.3
KOG2110391 consensus Uncharacterized conserved protein, conta 87.17
TIGR03032335 conserved hypothetical protein TIGR03032. This pro 87.13
COG0823425 TolB Periplasmic component of the Tol biopolymer t 86.97
KOG0639 705 consensus Transducin-like enhancer of split protei 86.6
PF0173186 Arylesterase: Arylesterase; InterPro: IPR002640 Th 86.4
TIGR03606 454 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH 86.38
PF0308889 Str_synth: Strictosidine synthase; InterPro: IPR01 86.18
PF00930 353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 86.11
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 86.07
KOG0291 893 consensus WD40-repeat-containing subunit of the 18 85.8
KOG0283712 consensus WD40 repeat-containing protein [Function 85.6
COG3823262 Glutamine cyclotransferase [Posttranslational modi 85.4
KOG1036 323 consensus Mitotic spindle checkpoint protein BUB3, 85.29
PF07995 331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 84.8
COG4946 668 Uncharacterized protein related to the periplasmic 84.33
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 83.48
KOG2096420 consensus WD40 repeat protein [General function pr 83.42
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 83.33
KOG0291 893 consensus WD40-repeat-containing subunit of the 18 83.25
KOG0283 712 consensus WD40 repeat-containing protein [Function 83.03
KOG0771398 consensus Prolactin regulatory element-binding pro 81.77
PTZ00420 568 coronin; Provisional 81.73
KOG1407313 consensus WD40 repeat protein [Function unknown] 81.43
KOG0293519 consensus WD40 repeat-containing protein [Function 80.74
KOG1273 405 consensus WD40 repeat protein [General function pr 80.7
COG0823425 TolB Periplasmic component of the Tol biopolymer t 80.43
PF00930 353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 80.26
>KOG0918 consensus Selenium-binding protein [Inorganic ion transport and metabolism] Back     alignment and domain information
Probab=100.00  E-value=2.6e-84  Score=581.28  Aligned_cols=167  Identities=74%  Similarity=1.296  Sum_probs=166.2

Q ss_pred             CCCceeEEEEecCCCEEEEEeCCCCcEEEEeccCCCCCeEEEEEEeCceeecCCceeEeeCCCCCCCCCCccccCccCCC
Q 031020            1 MPGLITDFLISLDDRFLYFSNWLHGDIRQYNIEDPKNPVLTGQIWVGGLFRKGSPVVAVTDDGQPYQSDVPEVQGHRLRG   80 (167)
Q Consensus         1 ~p~l~tdI~IS~DdRfLYVSnw~hg~I~qyDIsdp~~pklvg~v~~GG~~~~~~~v~v~~~~~~~~~p~~~~~~g~~~~g   80 (167)
                      ||||||||+||+||||||||||+||+||||||+||.+|||.|||++||++.++++|+|++++++..|||+++||||+++|
T Consensus       310 MP~LITDilISmDDRFLYvs~WLHGDirQYdIsDP~n~kLtgQi~lGG~i~~~s~vkvl~~e~~~~~~ea~~vKGrkl~G  389 (476)
T KOG0918|consen  310 MPGLITDILISLDDRFLYVSNWLHGDIRQYDISDPKNPKLTGQIFLGGSIQKGSPVKVLEEEGLKKQPEALYVKGRKLRG  389 (476)
T ss_pred             cchhhheeEEeecCcEEEEEeeeecceeeeccCCCCCcceEEEEEECcEeecCCceEEeccccccCCCccceecCccccC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCceEEEccCCCEEEEEeCCCccccccccccccccCcEEEEEEeeCCCCCeeecCceeEeccCCCCCCcceeeeecCCCC
Q 031020           81 GPQMIQLSLDGKRLYVTNSLFSAWDCQFYPELKEKGSHMLQIDVNSEKGGMAINPNFFVDFEAEPDGPALAHEMRYPGGD  160 (167)
Q Consensus        81 ~P~~~~LS~DGkrLyVaNsl~s~wD~Qfyp~~~~~g~~~~~~dvD~~~G~l~l~~~F~vDf~~~p~gp~~~he~r~pggd  160 (167)
                      ||||||||+|||||||||||||+||+|||||++++|++|+|+|||+++|+|+||++|+|||++||+||+|||||||||||
T Consensus       390 GPQMlQLSLDGKRLYVt~SLys~WD~QFYPE~v~~G~~miqidvdt~~g~~~lN~~flvDf~~ep~gPsL~hemRypggd  469 (476)
T KOG0918|consen  390 GPQMLQLSLDGKRLYVTNSLYSAWDRQFYPELVSKGSHMIQIDVDTVKGGLSLNPDFLVDFGKEPDGPSLAHEMRYPGGD  469 (476)
T ss_pred             CceeEEeccCCcEEEEEchhhhhhHhhhCHHHHhcCceEEEEeeeccCCceeeCccceEEccCCCCCcchhhhcccCCCc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCccccC
Q 031020          161 CTSDIWI  167 (167)
Q Consensus       161 ctsd~~~  167 (167)
                      |||||||
T Consensus       470 Ctsdiwi  476 (476)
T KOG0918|consen  470 CTSDIWI  476 (476)
T ss_pred             ccccccC
Confidence            9999997



>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>TIGR02276 beta_rpt_yvtn 40-residue YVTN family beta-propeller repeat Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>PF08309 LVIVD: LVIVD repeat; InterPro: IPR013211 This repeat is found in bacterial and archaeal cell surface proteins, many of which are hypothetical Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG5276 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>TIGR02276 beta_rpt_yvtn 40-residue YVTN family beta-propeller repeat Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG5276 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF01731 Arylesterase: Arylesterase; InterPro: IPR002640 The serum paraoxonases/arylesterases are enzymes that catalyse the hydrolysis of the toxic metabolites of a variety of organophosphorus insecticides Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2096 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>PF13449 Phytase-like: Esterase-like activity of phytase Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF03088 Str_synth: Strictosidine synthase; InterPro: IPR018119 This entry represents a conserved region found in strictosidine synthase (4 Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>smart00135 LY Low-density lipoprotein-receptor YWTD domain Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF09826 Beta_propel: Beta propeller domain; InterPro: IPR019198 This entry consists of predicted secreted proteins containing a C-terminal beta-propeller domain distantly related to WD-40 repeats Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>PF03022 MRJP: Major royal jelly protein; InterPro: IPR003534 The major royal jelly proteins (MRJPs) comprise 12 Back     alignment and domain information
>KOG3881 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>KOG4499 consensus Ca2+-binding protein Regucalcin/SMP30 [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>PF07676 PD40: WD40-like Beta Propeller Repeat; InterPro: IPR011659 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PF09826 Beta_propel: Beta propeller domain; InterPro: IPR019198 This entry consists of predicted secreted proteins containing a C-terminal beta-propeller domain distantly related to WD-40 repeats Back     alignment and domain information
>smart00135 LY Low-density lipoprotein-receptor YWTD domain Back     alignment and domain information
>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PF01436 NHL: NHL repeat; InterPro: IPR001258 The NHL repeat, named after NCL-1, HT2A and Lin-41, is found largely in a large number of eukaryotic and prokaryotic proteins Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>TIGR03032 conserved hypothetical protein TIGR03032 Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] Back     alignment and domain information
>PF01731 Arylesterase: Arylesterase; InterPro: IPR002640 The serum paraoxonases/arylesterases are enzymes that catalyse the hydrolysis of the toxic metabolites of a variety of organophosphorus insecticides Back     alignment and domain information
>TIGR03606 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH family Back     alignment and domain information
>PF03088 Str_synth: Strictosidine synthase; InterPro: IPR018119 This entry represents a conserved region found in strictosidine synthase (4 Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>COG3823 Glutamine cyclotransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG2096 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query167
2ece_A462 X-Ray Structure Of Hypothetical Selenium-Binding Pr 2e-32
>pdb|2ECE|A Chain A, X-Ray Structure Of Hypothetical Selenium-Binding Protein From Sulfolobus Tokodaii, St0059 Length = 462 Back     alignment and structure

Iteration: 1

Score = 134 bits (338), Expect = 2e-32, Method: Compositional matrix adjust. Identities = 76/165 (46%), Positives = 107/165 (64%), Gaps = 27/165 (16%) Query: 1 MPGLITDFLISLDDRFLYFSNWLHGDIRQYNIEDPKNPVLTGQIWVGGLFRKGSPVVAVT 60 +P L+TD ISLDD+FLY S W G++RQY+I +P PVLTG++ +GG+F Sbjct: 319 VPPLVTDIDISLDDKFLYLSLWGIGEVRQYDISNPFKPVLTGKVKLGGIF---------- 368 Query: 61 DDGQPYQSDVPEVQGHRLRGGPQMIQLSLDGKRLYVTNSLFSAWDCQFYPE-LKEKGSHM 119 +++D P GH+L G PQM+++S DG+R+YVTNSL+S WD QFYPE LK M Sbjct: 369 -----HRADHP--AGHKLTGAPQMLEISRDGRRVYVTNSLYSTWDNQFYPEGLK---GWM 418 Query: 120 LQIDVNSEKGGMAINPNFFVDFEAEPDGPALAHEMRYPGGDCTSD 164 ++++ N GG+ I+ FFVDF G A +H++R GGD +SD Sbjct: 419 VKLNANPS-GGLEIDKEFFVDF-----GEARSHQVRLSGGDASSD 457

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query167
2ece_A462 462AA long hypothetical selenium-binding protein; 2e-61
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 4e-05
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 9e-04
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Length = 462 Back     alignment and structure
 Score =  195 bits (497), Expect = 2e-61
 Identities = 72/166 (43%), Positives = 102/166 (61%), Gaps = 25/166 (15%)

Query: 1   MPGLITDFLISLDDRFLYFSNWLHGDIRQYNIEDPKNPVLTGQIWVGGLFRKGSPVVAVT 60
           +P L+TD  ISLDD+FLY S W  G++RQY+I +P  PVLTG++ +GG+F +        
Sbjct: 319 VPPLVTDIDISLDDKFLYLSLWGIGEVRQYDISNPFKPVLTGKVKLGGIFHRA------- 371

Query: 61  DDGQPYQSDVPEVQGHRLRGGPQMIQLSLDGKRLYVTNSLFSAWDCQFYPELKEKGSHML 120
                         GH+L G PQM+++S DG+R+YVTNSL+S WD QFYPE       M+
Sbjct: 372 ----------DHPAGHKLTGAPQMLEISRDGRRVYVTNSLYSTWDNQFYPE--GLKGWMV 419

Query: 121 QIDVNSEKGGMAINPNFFVDFEAEPDGPALAHEMRYPGGDCTSDIW 166
           +++ N   GG+ I+  FFVDF     G A +H++R  GGD +SD +
Sbjct: 420 KLNAN-PSGGLEIDKEFFVDF-----GEARSHQVRLSGGDASSDSY 459


>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Length = 331 Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Length = 331 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query167
2ece_A462 462AA long hypothetical selenium-binding protein; 100.0
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.44
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.37
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.19
2mad_H 373 Methylamine dehydrogenase (heavy subunit); oxidore 99.13
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.12
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.1
2oiz_A 361 Aromatic amine dehydrogenase, large subunit; oxido 99.04
3sjl_D 386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 99.02
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.02
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.02
1mda_H 368 Methylamine dehydrogenase (heavy subunit); electro 98.99
3c75_H 426 MADH, methylamine dehydrogenase heavy chain; coppe 98.99
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 98.97
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 98.83
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 98.8
1qks_A 567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 98.79
1nir_A 543 Nitrite reductase; hemoprotein, denitrification, d 98.73
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 98.72
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 98.7
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 98.66
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 98.62
1qks_A 567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 98.61
3sjl_D 386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 98.6
2ece_A462 462AA long hypothetical selenium-binding protein; 98.6
1nir_A 543 Nitrite reductase; hemoprotein, denitrification, d 98.58
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 98.57
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 98.56
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 98.53
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 98.53
1jmx_B 349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 98.51
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 98.49
1pby_B 337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 98.47
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 98.45
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 98.43
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 98.42
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 98.41
1fwx_A 595 Nitrous oxide reductase; beta-propeller domain, cu 98.41
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 98.37
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 98.36
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 98.36
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 98.32
1fwx_A 595 Nitrous oxide reductase; beta-propeller domain, cu 98.31
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 98.24
3kya_A 496 Putative phosphatase; structural genomics, joint c 98.23
2p4o_A306 Hypothetical protein; putative lactonase, structur 98.22
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 98.17
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 98.16
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 98.15
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 98.14
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 98.07
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 98.05
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 98.04
2p4o_A306 Hypothetical protein; putative lactonase, structur 98.0
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 97.95
3v65_B386 Low-density lipoprotein receptor-related protein; 97.93
2fp8_A322 Strictosidine synthase; six bladed beta propeller 97.88
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 97.86
2qe8_A343 Uncharacterized protein; structural genomics, join 97.85
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 97.85
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 97.85
3p5b_L400 Low density lipoprotein receptor variant; B-propel 97.84
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 97.83
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 97.8
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 97.8
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 97.78
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 97.76
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 97.76
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 97.74
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 97.74
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 97.72
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 97.68
2ism_A 352 Putative oxidoreductase; BL41XU spring-8, bladed b 97.67
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 97.64
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 97.63
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 97.62
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 97.61
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 97.6
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 97.57
3v65_B386 Low-density lipoprotein receptor-related protein; 97.57
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 97.55
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 97.54
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 97.54
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 97.53
2vdu_B 450 TRNA (guanine-N(7)-)-methyltransferase- associated 97.51
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 97.5
2fp8_A322 Strictosidine synthase; six bladed beta propeller 97.5
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 97.49
2ojh_A 297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 97.49
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 97.48
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 97.47
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 97.47
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 97.44
2ism_A 352 Putative oxidoreductase; BL41XU spring-8, bladed b 97.43
4h5i_A 365 Guanine nucleotide-exchange factor SEC12; copii ve 97.43
1gxr_A 337 ESG1, transducin-like enhancer protein 1; transcri 97.42
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 97.41
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 97.4
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 97.4
3amr_A 355 3-phytase; beta-propeller, phytate, MYO-inositol h 97.39
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 97.39
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 97.39
2qe8_A 343 Uncharacterized protein; structural genomics, join 97.39
2xyi_A430 Probable histone-binding protein CAF1; transcripti 97.36
3a9g_A 354 Putative uncharacterized protein; PQQ dependent de 97.35
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 97.34
3p5b_L400 Low density lipoprotein receptor variant; B-propel 97.32
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 97.3
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 97.26
3a9g_A 354 Putative uncharacterized protein; PQQ dependent de 97.25
2g8s_A 353 Glucose/sorbosone dehydrogenases; bladed beta-prop 97.25
3qqz_A 255 Putative uncharacterized protein YJIK; MCSG, PSI-2 97.19
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 97.13
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 97.12
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 97.12
2hqs_A 415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 97.09
3s94_A 619 LRP-6, low-density lipoprotein receptor-related pr 97.07
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 97.06
3tc9_A 430 Hypothetical hydrolase; 6-bladed beta-propeller, i 97.01
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 97.0
3zwl_B 369 Eukaryotic translation initiation factor 3 subuni; 97.0
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 96.99
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 96.96
3pe7_A 388 Oligogalacturonate lyase; seven-bladed beta-propel 96.94
2g8s_A 353 Glucose/sorbosone dehydrogenases; bladed beta-prop 96.93
1k32_A 1045 Tricorn protease; protein degradation, substrate g 96.93
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 96.91
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 96.91
3zwl_B 369 Eukaryotic translation initiation factor 3 subuni; 96.91
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 96.88
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 96.84
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 96.83
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 96.8
2gop_A 347 Trilobed protease; beta propeller, open velcro, hy 96.78
1k8k_C 372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 96.78
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 96.77
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 96.75
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 96.72
3kya_A 496 Putative phosphatase; structural genomics, joint c 96.7
1cru_A 454 Protein (soluble quinoprotein glucose dehydrogena; 96.7
4aow_A 340 Guanine nucleotide-binding protein subunit beta-2; 96.69
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 96.68
2ynn_A 304 Coatomer subunit beta'; protein transport, peptide 96.67
3ow8_A321 WD repeat-containing protein 61; structural genomi 96.65
2xyi_A430 Probable histone-binding protein CAF1; transcripti 96.65
3s94_A 619 LRP-6, low-density lipoprotein receptor-related pr 96.61
2ymu_A 577 WD-40 repeat protein; unknown function, two domain 96.6
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 96.57
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 96.53
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 96.5
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 96.5
1got_B 340 GT-beta; complex (GTP-binding/transducer), G prote 96.5
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 96.47
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 96.47
3c5m_A 396 Oligogalacturonate lyase; blade-shaped beta-propel 96.43
2aq5_A 402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 96.41
4ery_A 312 WD repeat-containing protein 5; WD40, WIN motif, b 96.41
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 96.4
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 96.38
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 96.35
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 96.34
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 96.3
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 96.28
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 96.25
1k32_A 1045 Tricorn protease; protein degradation, substrate g 96.25
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 96.24
3f3f_A 351 Nucleoporin SEH1; structural protein, protein comp 96.23
4g56_B 357 MGC81050 protein; protein arginine methyltransfera 96.22
1erj_A 393 Transcriptional repressor TUP1; beta-propeller, tr 96.21
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.2
1yfq_A 342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 96.18
1r5m_A 425 SIR4-interacting protein SIF2; transcription corep 96.17
3vl1_A 420 26S proteasome regulatory subunit RPN14; beta-prop 96.17
3ow8_A321 WD repeat-containing protein 61; structural genomi 96.16
3jrp_A379 Fusion protein of protein transport protein SEC13 96.16
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 96.14
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 96.12
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 96.12
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 96.12
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 96.07
3k26_A 366 Polycomb protein EED; WD40, structural genomics, N 96.06
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 96.05
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 96.03
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 96.03
4ery_A 312 WD repeat-containing protein 5; WD40, WIN motif, b 96.02
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 95.98
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 95.97
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 95.96
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 95.94
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 95.94
3fm0_A 345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 95.94
3sbq_A 638 Nitrous-oxide reductase; beta-propeller, cupredoxi 95.89
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 95.89
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 95.87
3mmy_A 368 MRNA export factor; mRNA export, nuclear protein; 95.83
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 95.8
3fm0_A 345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 95.8
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 95.8
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 95.71
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 95.69
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 95.68
1cru_A 454 Protein (soluble quinoprotein glucose dehydrogena; 95.66
2xzm_R 343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 95.62
2ymu_A 577 WD-40 repeat protein; unknown function, two domain 95.6
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 95.57
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 95.55
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 95.51
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 95.51
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 95.49
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 95.47
4g56_B357 MGC81050 protein; protein arginine methyltransfera 95.47
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 95.4
3i2n_A 357 WD repeat-containing protein 92; WD40 repeats, str 95.39
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 95.38
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 95.36
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 95.33
3das_A 347 Putative oxidoreductase; aldose sugar dehydrogenas 95.28
2oit_A 434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 95.24
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 95.23
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 95.23
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 95.19
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 95.11
3dwl_C 377 Actin-related protein 2/3 complex subunit 1; prope 95.08
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 95.06
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 95.04
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 95.01
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 94.96
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 94.94
2hes_X 330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 94.92
2oit_A 434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 94.91
4ggc_A 318 P55CDC, cell division cycle protein 20 homolog; ce 94.9
3das_A 347 Putative oxidoreductase; aldose sugar dehydrogenas 94.86
4e54_B435 DNA damage-binding protein 2; beta barrel, double 94.85
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 94.84
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 94.84
3f3f_A 351 Nucleoporin SEH1; structural protein, protein comp 94.8
3frx_A 319 Guanine nucleotide-binding protein subunit beta- l 94.8
3dm0_A 694 Maltose-binding periplasmic protein fused with RAC 94.77
3gre_A 437 Serine/threonine-protein kinase VPS15; seven-blade 94.69
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 94.62
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 94.51
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 94.49
2xe4_A 751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 94.46
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 94.31
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 94.31
2pm7_B297 Protein transport protein SEC13, protein transport 94.26
3jrp_A379 Fusion protein of protein transport protein SEC13 94.21
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 94.19
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 93.86
4gga_A 420 P55CDC, cell division cycle protein 20 homolog; ce 93.78
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 93.78
1vyh_C 410 Platelet-activating factor acetylhydrolase IB alph 93.77
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 93.69
2wg3_C 463 Hedgehog-interacting protein; lipoprotein, develop 93.63
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 93.39
2pm7_B 297 Protein transport protein SEC13, protein transport 93.33
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 93.3
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 93.19
4e54_B 435 DNA damage-binding protein 2; beta barrel, double 93.07
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 93.02
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 92.73
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 92.72
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 92.66
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 92.53
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 92.48
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 92.14
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 91.95
3q6k_A381 43.2 kDa salivary protein; beta propeller, binding 91.91
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 91.79
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 91.67
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 91.34
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 91.28
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 91.22
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 91.09
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 90.7
3jro_A 753 Fusion protein of protein transport protein SEC13 90.09
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 89.39
3bg1_A 316 Protein SEC13 homolog; NPC, transport, WD repeat, 89.38
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 89.36
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 89.16
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 89.07
2wg3_C 463 Hedgehog-interacting protein; lipoprotein, develop 88.4
3sbq_A 638 Nitrous-oxide reductase; beta-propeller, cupredoxi 88.23
3jro_A 753 Fusion protein of protein transport protein SEC13 86.68
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 86.3
1xip_A 388 Nucleoporin NUP159; beta-propeller, transport prot 85.85
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 84.47
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 84.02
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 83.6
1p22_A 435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 82.99
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 81.21
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
Probab=100.00  E-value=4.4e-55  Score=395.86  Aligned_cols=141  Identities=51%  Similarity=0.979  Sum_probs=133.5

Q ss_pred             CCceeEEEEecCCCEEEEEeCCCCcEEEEeccCCCCCeEEEEEEeCceeecCCceeEeeCCCCCCCCCCccccCccCCCC
Q 031020            2 PGLITDFLISLDDRFLYFSNWLHGDIRQYNIEDPKNPVLTGQIWVGGLFRKGSPVVAVTDDGQPYQSDVPEVQGHRLRGG   81 (167)
Q Consensus         2 p~l~tdI~IS~DdRfLYVSnw~hg~I~qyDIsdp~~pklvg~v~~GG~~~~~~~v~v~~~~~~~~~p~~~~~~g~~~~g~   81 (167)
                      ++++++|+||+||||||||||+||+|+||||+|+++++++++|++||.+               ++++.+  +|+++.|+
T Consensus       320 ~~~pa~I~lS~DGrfLYVSnrg~d~VavfdV~d~~~~~lv~~I~tGG~~---------------~~~~~~--~G~~~~gg  382 (462)
T 2ece_A          320 PPLVTDIDISLDDKFLYLSLWGIGEVRQYDISNPFKPVLTGKVKLGGIF---------------HRADHP--AGHKLTGA  382 (462)
T ss_dssp             CCCCCCEEECTTSCEEEEEETTTTEEEEEECSSTTSCEEEEEEECBTTT---------------TCBCCT--TSCCCCSC
T ss_pred             CCceeEEEECCCCCEEEEEeCCCCEEEEEEecCCCCcEEEEEEEeCCee---------------cccccc--ccccCCCC
Confidence            3789999999999999999999999999999999999999999999965               455544  99999999


Q ss_pred             CceEEEccCCCEEEEEeCCCccccccccccccccCcEEEEEEeeCCCCCeeecCceeEeccCCCCCCcceeeeecCCCCc
Q 031020           82 PQMIQLSLDGKRLYVTNSLFSAWDCQFYPELKEKGSHMLQIDVNSEKGGMAINPNFFVDFEAEPDGPALAHEMRYPGGDC  161 (167)
Q Consensus        82 P~~~~LS~DGkrLyVaNsl~s~wD~Qfyp~~~~~g~~~~~~dvD~~~G~l~l~~~F~vDf~~~p~gp~~~he~r~pggdc  161 (167)
                      ||||+||||||||||||||||+||+||||+  +++.+|+++|||+++| |+++++|+|||++     +||||||||||||
T Consensus       383 Pr~~~lSpDGk~LyVaNsl~~~wd~Qfyp~--~~~~~~~~~~vd~~~G-L~~~~~f~vdf~~-----~~~h~~r~~ggd~  454 (462)
T 2ece_A          383 PQMLEISRDGRRVYVTNSLYSTWDNQFYPE--GLKGWMVKLNANPSGG-LEIDKEFFVDFGE-----ARSHQVRLSGGDA  454 (462)
T ss_dssp             CCCEEECTTSSEEEEECCCCHHHHHHHSTT--CCCCEEEEEEECTTSC-EEEEEEEEEECTT-----SEEEEEEETTCCT
T ss_pred             CCEEEEcCCCCEEEEEcCCcccccccccCC--CCceEEEEEEecCCCC-ceeCCCEEeeccc-----CcceeeecCCCCc
Confidence            999999999999999999999999999999  7899999999999999 9999999999988     7999999999999


Q ss_pred             CccccC
Q 031020          162 TSDIWI  167 (167)
Q Consensus       162 tsd~~~  167 (167)
                      |||||+
T Consensus       455 ~sd~~~  460 (462)
T 2ece_A          455 SSDSYC  460 (462)
T ss_dssp             TTCCCS
T ss_pred             Cccccc
Confidence            999996



>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>3sbq_A Nitrous-oxide reductase; beta-propeller, cupredoxin domain, copper-contain periplasmic, oxidoreductase; 1.70A {Pseudomonas stutzeri} PDB: 3sbp_A 3sbr_A 1qni_A Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>3q6k_A 43.2 kDa salivary protein; beta propeller, binding protein, serotonin, salivary gland, binding, ligand binging protein; HET: CIT SRO; 2.52A {Lutzomyia longipalpis} PDB: 3q6p_A* 3q6t_A* Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>3sbq_A Nitrous-oxide reductase; beta-propeller, cupredoxin domain, copper-contain periplasmic, oxidoreductase; 1.70A {Pseudomonas stutzeri} PDB: 3sbp_A 3sbr_A 1qni_A Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query167
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.51
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 99.3
d1ri6a_ 333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.19
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 98.97
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 98.95
d1jmxb_ 346 Quinohemoprotein amine dehydrogenase B chain {Pseu 98.8
d1l0qa2 301 Surface layer protein {Archaeon Methanosarcina maz 98.78
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 98.73
d1mdah_ 368 Methylamine dehydrogenase, H-chain {Paracoccus den 98.71
d1pbyb_ 337 Quinohemoprotein amine dehydrogenase B chain {Para 98.69
d2madh_ 373 Methylamine dehydrogenase, H-chain {Gram negative 98.68
d1jmxb_ 346 Quinohemoprotein amine dehydrogenase B chain {Pseu 98.68
d2bbkh_ 355 Methylamine dehydrogenase, H-chain {Paracoccus den 98.55
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 98.54
d2bbkh_ 355 Methylamine dehydrogenase, H-chain {Paracoccus den 98.51
d1hzua2 426 C-terminal (heme d1) domain of cytochrome cd1-nitr 98.51
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 98.47
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 98.33
d1hzua2 426 C-terminal (heme d1) domain of cytochrome cd1-nitr 98.29
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 98.15
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 98.03
d1qnia2 441 Nitrous oxide reductase, N-terminal domain {Pseudo 97.99
d2p4oa1 302 Hypothetical protein All0351 homologue {Nostoc pun 97.96
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 97.89
d1gxra_ 337 Groucho/tle1, C-terminal domain {Human (Homo sapie 97.86
d1qnia2 441 Nitrous oxide reductase, N-terminal domain {Pseudo 97.85
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 97.73
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 97.57
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 97.54
d1k32a3 360 Tricorn protease domain 2 {Archaeon Thermoplasma a 97.44
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 97.42
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 97.34
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 97.28
d1fwxa2 459 Nitrous oxide reductase, N-terminal domain {Paraco 97.23
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 97.22
d1k32a3 360 Tricorn protease domain 2 {Archaeon Thermoplasma a 97.17
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 97.12
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 97.1
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 97.03
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 96.95
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 96.95
d1k32a2 281 Tricorn protease N-terminal domain {Archaeon Therm 96.91
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 96.89
d1tbga_ 340 beta1-subunit of the signal-transducing G protein 96.77
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 96.72
d1tbga_340 beta1-subunit of the signal-transducing G protein 96.67
d1erja_ 388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 96.66
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 96.61
d1yfqa_ 342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 96.6
d1k8kc_ 371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 96.59
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 96.5
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 96.49
d1nr0a1 311 Actin interacting protein 1 {Nematode (Caenorhabdi 96.47
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 96.43
d1k8kc_ 371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 96.4
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 96.37
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 96.33
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 96.28
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 96.27
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 96.23
d1nr0a2 299 Actin interacting protein 1 {Nematode (Caenorhabdi 96.16
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 96.1
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 96.07
d1vyhc1 317 Platelet-activating factor acetylhydrolase IB subu 96.01
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 95.94
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 95.53
d2bgra1 470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 95.37
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 95.09
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 94.17
d1xfda1 465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 94.14
d1p22a2 293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 93.92
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 93.59
d2bgra1 470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 92.99
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 92.48
d1crua_450 Soluble quinoprotein glucose dehydrogenase {Acinet 90.93
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 90.69
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 86.6
d1h6la_ 353 Thermostable phytase (3-phytase) {Bacillus amyloli 82.99
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 82.73
d1s6la2132 Alkylmercury lyase MerB {Escherichia coli [TaxId: 82.14
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: Putative isomerase YbhE
family: Putative isomerase YbhE
domain: Putative isomerase YbhE
species: Escherichia coli [TaxId: 562]
Probab=99.51  E-value=1.6e-13  Score=104.07  Aligned_cols=89  Identities=19%  Similarity=0.267  Sum_probs=73.1

Q ss_pred             ceeEEEEecCCCEEEEEeCCCCcEEEEeccCCCC-CeEEEEEEeCceeecCCceeEeeCCCCCCCCCCccccCccCCCCC
Q 031020            4 LITDFLISLDDRFLYFSNWLHGDIRQYNIEDPKN-PVLTGQIWVGGLFRKGSPVVAVTDDGQPYQSDVPEVQGHRLRGGP   82 (167)
Q Consensus         4 l~tdI~IS~DdRfLYVSnw~hg~I~qyDIsdp~~-pklvg~v~~GG~~~~~~~v~v~~~~~~~~~p~~~~~~g~~~~g~P   82 (167)
                      .++++++|+|++++|++++..+.++.|++..... .+..+.+..|+                            .    |
T Consensus       231 ~~~~~~~s~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~----------------------------~----p  278 (333)
T d1ri6a_         231 WAADIHITPDGRHLYACDRTASLITVFSVSEDGSVLSKEGFQPTET----------------------------Q----P  278 (333)
T ss_dssp             CEEEEEECTTSSEEEEEETTTTEEEEEEECTTSCCEEEEEEEECSS----------------------------S----C
T ss_pred             cceeEEEecccCceeeecccCCeEEEEEEcCCCCEEEEEEEeCCCC----------------------------C----e
Confidence            4578999999999999999999999999986433 34455555554                            2    9


Q ss_pred             ceEEEccCCCEEEEEeCCCccccccccccccccCcEEEEEEeeCCCCCeeecCceeE
Q 031020           83 QMIQLSLDGKRLYVTNSLFSAWDCQFYPELKEKGSHMLQIDVNSEKGGMAINPNFFV  139 (167)
Q Consensus        83 ~~~~LS~DGkrLyVaNsl~s~wD~Qfyp~~~~~g~~~~~~dvD~~~G~l~l~~~F~v  139 (167)
                      +.+++|||||+|||+|               ++++++..+++|.++|.|+....+-+
T Consensus       279 ~~~a~spDGk~l~va~---------------~~~~~v~v~~id~~tG~l~~~~~~~~  320 (333)
T d1ri6a_         279 RGFNVDHSGKYLIAAG---------------QKSHHISVYEIVGEQGLLHEKGRYAV  320 (333)
T ss_dssp             CCEEECTTSSEEEEEC---------------TTTCEEEEEEEETTTTEEEEEEEEEC
T ss_pred             eEEEEeCCCCEEEEEE---------------CCCCeEEEEEEECCCCcEEEEEeccC
Confidence            9999999999999999               35778888999999999987776644



>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s6la2 d.357.1.2 (A:81-212) Alkylmercury lyase MerB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure