Citrus Sinensis ID: 031168

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160----
MDGTRRVGVAVDFSACSKKALQWAADNVVRNGDHLILVTVVPEGGLEKGEQQLWEDSGSPLIPLAEFSEPTIMKKYGAKPDPETLDIVNTVARQKQIVVVMKIFWGDPREKICEAIDKIPLSCLVIGNRGLGKLKRAIMGSVSNYVVNNGSCPVTVVKQGIHET
cccccEEEEEEcccHHHHHHHHHHHHHHHccccEEEEEEEEccccccccccccccccccccccccccccHHHHHHHcccccHHHHHHHHHHHHHcccEEEEEEEEcccHHHHHHHHHHccccEEEEcccccccccccEEccHHHHHHccccccEEEEccccccc
cccccEEEEEEcccHHHHHHHHHHHHHHcccccEEEEEEEccccccccccccccccccccccccccccHHHHHHHHcccccHHHHHHHHHHHHHcccEEEEEEEEccHHHHHHHHHHHccccEEEEccccccHHHHHHHccccHHHHccccccEEEEEcccccc
MDGTRRVGVAVDFSACSKKALQWAADNVVRNGDHLILVTVvpegglekgeqqlwedsgspliplaefseptimkkygakpdpetlDIVNTVARQKQIVVVMKIFWGDPREKICEAIDkiplsclvignrglgklKRAIMGSVSNyvvnngscpVTVVKQGIHET
MDGTRRVGVAVDFSACSKKALQWAADNVVRNGDHLILVTVVPEGGLEKGEQQLWEDSGSPLIPLAEFSEPTIMKKYGAKPDPETLDIVNTVARQKQIVVVMKIFWGDPREKICEAIDKIPLSCLVIGNRGLGKLKRAIMGSVSnyvvnngscpvtvvkqgihet
MDGTRRVGVAVDFSACSKKALQWAADNVVRNGDHLILVTVVPEGGLEKGEQQLWEDSGSPLIPLAEFSEPTIMKKYGAKPDPETLDIVNTVARQKQIVVVMKIFWGDPREKICEAIDKIPLSCLVIGNRGLGKLKRAIMGSVSNYVVNNGSCPVTVVKQGIHET
******VGVAVDFSACSKKALQWAADNVVRNGDHLILVTVVPEGGLEK****LW******LIPLAEF****IMKKY******ETLDIVNTVARQKQIVVVMKIFWGDPREKICEAIDKIPLSCLVIGNRGLGKLKRAIMGSVSNYVVNNGSCPVTVVK******
*DGTRRVGVAVDFSACSKKALQWAADNVVRNGDHLILVTVVPEGGLEKGEQQLWEDSGSPLIPLAEFSEPTIMKKYGAKPDPETLDIVNTVARQKQIVVVMKIFWGDPREKICEAIDKIPLSCLVIGNRGLGKLKRAIMGSVSNYVVNNGSCPV***KQ*****
********VAVDFSACSKKALQWAADNVVRNGDHLILVTVVPEGGLEKGEQQLWEDSGSPLIPLAEFSEPTIMKKYGAKPDPETLDIVNTVARQKQIVVVMKIFWGDPREKICEAIDKIPLSCLVIGNRGLGKLKRAIMGSVSNYVVNNGSCPVTVVKQGIHET
***TRRVGVAVDFSACSKKALQWAADNVVRNGDHLILVTVVPEGGLEKGEQQLWEDSGSPLIPLAEFSEPTIMKKYGAKPDPETLDIVNTVARQKQIVVVMKIFWGDPREKICEAIDKIPLSCLVIGNRGLGKLKRAIMGSVSNYVVNNGSCPVTVVKQG****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDGTRRVGVAVDFSACSKKALQWAADNVVRNGDHLILVTVVPEGGLEKGEQQLWEDSGSPLIPLAEFSEPTIMKKYGAKPDPETLDIVNTVARQKQIVVVMKIFWGDPREKICEAIDKIPLSCLVIGNRGLGKLKRAIMGSVSNYVVNNGSCPVTVVKQGIHET
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query164 2.2.26 [Sep-21-2011]
Q8LGG8175 Universal stress protein no no 0.853 0.8 0.256 6e-09
P87132601 Uncharacterized protein C yes no 0.853 0.232 0.270 2e-06
Q57951170 Universal stress protein yes no 0.835 0.805 0.240 5e-05
O07552166 Stress response protein N yes no 0.859 0.849 0.289 0.0001
>sp|Q8LGG8|USPAL_ARATH Universal stress protein A-like protein OS=Arabidopsis thaliana GN=At3g01520 PE=1 SV=2 Back     alignment and function desciption
 Score = 60.1 bits (144), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 40/156 (25%), Positives = 72/156 (46%), Gaps = 16/156 (10%)

Query: 14  SACSKKALQWAADNVVRNGDH-----LILVTVVPEGGLEKGEQQLWEDSGSPLIPLAEFS 68
           S   K+A +W  + +VR+        L+ V VV E G        ++D  S      +F 
Sbjct: 24  SISCKRAFEWTLEKIVRSNTSDFKILLLHVQVVDEDG--------FDDVDSIYASPEDFR 75

Query: 69  EPTIMKKYGAKPDPETLDIVNTVARQKQIVVVMKIFWGDPREKICEAIDKIPLSCLVIGN 128
           +   M++         L+       +  +     I  GDP++ IC+ + ++    LV+G+
Sbjct: 76  D---MRQSNKAKGLHLLEFFVNKCHEIGVGCEAWIKTGDPKDVICQEVKRVRPDFLVVGS 132

Query: 129 RGLGKLKRAIMGSVSNYVVNNGSCPVTVVKQGIHET 164
           RGLG+ ++  +G+VS + V +  CPV  +K+   ET
Sbjct: 133 RGLGRFQKVFVGTVSAFCVKHAECPVMTIKRNADET 168

Arabidopsis thaliana (taxid: 3702)
>sp|P87132|YFK5_SCHPO Uncharacterized protein C167.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC167.05 PE=1 SV=2 Back     alignment and function description
>sp|Q57951|Y531_METJA Universal stress protein MJ0531 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0531 PE=3 SV=1 Back     alignment and function description
>sp|O07552|NHAX_BACSU Stress response protein NhaX OS=Bacillus subtilis (strain 168) GN=nhaX PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query164
255556366164 conserved hypothetical protein [Ricinus 1.0 1.0 0.823 3e-76
284520976164 universal stress protein [Jatropha curca 1.0 1.0 0.786 3e-72
224111960164 predicted protein [Populus trichocarpa] 0.993 0.993 0.785 4e-72
225431940165 PREDICTED: universal stress protein A-li 0.975 0.969 0.8 3e-70
449432916164 PREDICTED: uncharacterized protein C167. 1.0 1.0 0.737 3e-67
119720802163 unknown [Brassica rapa] 0.939 0.944 0.746 8e-62
297834602163 universal stress protein family protein 0.951 0.957 0.717 2e-61
18401345163 universal stress protein (USP) family pr 0.969 0.975 0.710 2e-61
356558131164 PREDICTED: universal stress protein A-li 0.987 0.987 0.679 3e-61
115462209167 Os05g0157200 [Oryza sativa Japonica Grou 0.939 0.922 0.701 6e-60
>gi|255556366|ref|XP_002519217.1| conserved hypothetical protein [Ricinus communis] gi|223541532|gb|EEF43081.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
 Score =  289 bits (739), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 135/164 (82%), Positives = 151/164 (92%)

Query: 1   MDGTRRVGVAVDFSACSKKALQWAADNVVRNGDHLILVTVVPEGGLEKGEQQLWEDSGSP 60
           M+G RRVGVAVDFS CSKKAL+WA DN+VRNGDHLIL+T++P+G  E+GE QLWE +GSP
Sbjct: 1   MEGERRVGVAVDFSTCSKKALKWAVDNLVRNGDHLILITILPDGYYEEGEMQLWEVTGSP 60

Query: 61  LIPLAEFSEPTIMKKYGAKPDPETLDIVNTVARQKQIVVVMKIFWGDPREKICEAIDKIP 120
           LIPL EFS+P +MKKYG KPDPETLDIVNTVA QKQIVVVMKI+WGDPREKICEAIDKIP
Sbjct: 61  LIPLHEFSDPAVMKKYGVKPDPETLDIVNTVANQKQIVVVMKIYWGDPREKICEAIDKIP 120

Query: 121 LSCLVIGNRGLGKLKRAIMGSVSNYVVNNGSCPVTVVKQGIHET 164
           LSCL+IGNRGLGK+KRAIMGSVSNYVVNNG+CPVTVVKQ  HE+
Sbjct: 121 LSCLIIGNRGLGKIKRAIMGSVSNYVVNNGTCPVTVVKQHDHES 164

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|284520976|gb|ADB93063.1| universal stress protein [Jatropha curcas] Back     alignment and taxonomy information
>gi|224111960|ref|XP_002316036.1| predicted protein [Populus trichocarpa] gi|118488605|gb|ABK96115.1| unknown [Populus trichocarpa] gi|222865076|gb|EEF02207.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225431940|ref|XP_002277653.1| PREDICTED: universal stress protein A-like protein isoform 1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449432916|ref|XP_004134244.1| PREDICTED: uncharacterized protein C167.05-like [Cucumis sativus] gi|449503863|ref|XP_004162211.1| PREDICTED: uncharacterized protein C167.05-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|119720802|gb|ABL97971.1| unknown [Brassica rapa] Back     alignment and taxonomy information
>gi|297834602|ref|XP_002885183.1| universal stress protein family protein [Arabidopsis lyrata subsp. lyrata] gi|297331023|gb|EFH61442.1| universal stress protein family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|18401345|ref|NP_566564.1| universal stress protein (USP) family protein [Arabidopsis thaliana] gi|14190421|gb|AAK55691.1|AF378888_1 AT3g17020/K14A17_14 [Arabidopsis thaliana] gi|7670026|dbj|BAA94980.1| unnamed protein product [Arabidopsis thaliana] gi|15215899|gb|AAK91493.1| AT3g17020/K14A17_14 [Arabidopsis thaliana] gi|332642374|gb|AEE75895.1| universal stress protein (USP) family protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356558131|ref|XP_003547361.1| PREDICTED: universal stress protein A-like protein-like [Glycine max] Back     alignment and taxonomy information
>gi|115462209|ref|NP_001054704.1| Os05g0157200 [Oryza sativa Japonica Group] gi|45267868|gb|AAS55767.1| unknown protein [Oryza sativa Japonica Group] gi|113578255|dbj|BAF16618.1| Os05g0157200 [Oryza sativa Japonica Group] gi|215686820|dbj|BAG89670.1| unnamed protein product [Oryza sativa Japonica Group] gi|222630265|gb|EEE62397.1| hypothetical protein OsJ_17188 [Oryza sativa Japonica Group] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query164
TAIR|locus:2086102163 AT3G17020 "AT3G17020" [Arabido 0.969 0.975 0.710 8.4e-58
TAIR|locus:2084525160 AT3G53990 "AT3G53990" [Arabido 0.957 0.981 0.493 6.1e-39
TAIR|locus:2097755201 AT3G03270 [Arabidopsis thalian 0.823 0.671 0.485 2.5e-33
TAIR|locus:2024291171 AT1G09740 "AT1G09740" [Arabido 0.914 0.877 0.305 2.3e-16
TAIR|locus:2076381204 AT3G58450 "AT3G58450" [Arabido 0.890 0.715 0.321 4.7e-16
TAIR|locus:2199282160 AT1G68300 "AT1G68300" [Arabido 0.884 0.906 0.337 2.6e-15
TAIR|locus:2200036242 AT1G11360 [Arabidopsis thalian 0.932 0.632 0.299 1.1e-14
TAIR|locus:2081531226 AT3G11930 "AT3G11930" [Arabido 0.835 0.606 0.299 2.4e-14
TAIR|locus:2131719260 PHOS34 "AT4G27320" [Arabidopsi 0.890 0.561 0.339 7.9e-14
TAIR|locus:2147319242 PHOS32 "AT5G54430" [Arabidopsi 0.890 0.603 0.335 1.6e-13
TAIR|locus:2086102 AT3G17020 "AT3G17020" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 594 (214.2 bits), Expect = 8.4e-58, P = 8.4e-58
 Identities = 113/159 (71%), Positives = 130/159 (81%)

Query:     3 GTRRVGVAVDFSACSKKALQWAADNVVRNGDHLILVTVVPEGGLEKGEQQLWEDSGSPLI 62
             G RR+GVAVDFS CSKKAL WA DNVVR+GDHLIL+T+  +   E+GE QLWE  GSP I
Sbjct:     5 GGRRIGVAVDFSDCSKKALSWAIDNVVRDGDHLILITIAHDMNYEEGEMQLWETVGSPFI 64

Query:    63 PLAEFSEPTIMKKYGAKPDPETLDIVNTVARQKQIVVVMKIFWGDPREKICEAIDKIPLS 122
             P++EFS+  +MKKY  KPD ETLDIVNT AR+K I VVMKI+WGDPREKIC A ++IPLS
Sbjct:    65 PMSEFSDAAVMKKYALKPDAETLDIVNTAARKKTITVVMKIYWGDPREKICAAAEQIPLS 124

Query:   123 CLVIGNRGLGKLKRAIMGSVSNYVVNNGSCPVTVVKQGI 161
              LV+GNRGLG LKR IMGSVSN+VVNN +CPVTVVK  I
Sbjct:   125 SLVMGNRGLGGLKRMIMGSVSNHVVNNVACPVTVVKAHI 163
GO:0003674 "molecular_function" evidence=ND
GO:0005737 "cytoplasm" evidence=ISM
GO:0009409 "response to cold" evidence=IEP
GO:0005886 "plasma membrane" evidence=IDA
GO:0002238 "response to molecule of fungal origin" evidence=RCA
GO:0006623 "protein targeting to vacuole" evidence=RCA
TAIR|locus:2084525 AT3G53990 "AT3G53990" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2097755 AT3G03270 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2024291 AT1G09740 "AT1G09740" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2076381 AT3G58450 "AT3G58450" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2199282 AT1G68300 "AT1G68300" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2200036 AT1G11360 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2081531 AT3G11930 "AT3G11930" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2131719 PHOS34 "AT4G27320" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2147319 PHOS32 "AT5G54430" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
estExt_fgenesh4_pm.C_LG_X0562
SubName- Full=Putative uncharacterized protein; (165 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query164
cd00293130 cd00293, USP_Like, Usp: Universal stress protein f 5e-27
pfam00582139 pfam00582, Usp, Universal stress protein family 3e-25
COG0589154 COG0589, UspA, Universal stress protein UspA and r 2e-16
>gnl|CDD|238182 cd00293, USP_Like, Usp: Universal stress protein family Back     alignment and domain information 
 Score = 98.2 bits (245), Expect = 5e-27
 Identities = 45/152 (29%), Positives = 70/152 (46%), Gaps = 22/152 (14%)

Query: 6   RVGVAVDFSACSKKALQWAADNVVRNGDHLILVTVVPEGGLEKGEQQLWEDSGSPLIPLA 65
           R+ VAVD S  S++AL+WAA    R G  L+L+ VV               S + L  L 
Sbjct: 1   RILVAVDGSEESERALRWAARLARRLGAELVLLHVVDP----------PPSSAAELAELL 50

Query: 66  EFSEPTIMKKYGAKPDPETLDIVNTVARQKQIVVVMKIFWGDPREKICEAIDKIPLSCLV 125
           E     +++                   +  + V   +  GDP E I EA +++    +V
Sbjct: 51  EEEARALLEALREA------------LAEAGVKVETVVLEGDPAEAILEAAEELGADLIV 98

Query: 126 IGNRGLGKLKRAIMGSVSNYVVNNGSCPVTVV 157
           +G+RG   L+R ++GSV+  V+ +  CPV VV
Sbjct: 99  MGSRGRSGLRRLLLGSVAERVLRHAPCPVLVV 130

The universal stress protein Usp is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents. Usp enhances the rate of cell survival during prolonged exposure to such conditions, and may provide a general "stress endurance" activity. The crystal structure of Haemophilus influenzae Usp reveals an alpha/beta fold similar to that of the Methanococcus jannaschii MJ0577 protein, which binds ATP, athough Usp lacks ATP-binding activity. Length = 130
>gnl|CDD|216006 pfam00582, Usp, Universal stress protein family Back     alignment and domain information
>gnl|CDD|223662 COG0589, UspA, Universal stress protein UspA and related nucleotide-binding proteins [Signal transduction mechanisms] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 164
PRK15456142 universal stress protein UspG; Provisional 99.96
PRK15005144 universal stress protein F; Provisional 99.96
PRK09982142 universal stress protein UspD; Provisional 99.96
cd01989146 STK_N The N-terminal domain of Eukaryotic Serine T 99.95
PRK15118144 universal stress global response regulator UspA; P 99.95
PRK10116142 universal stress protein UspC; Provisional 99.94
PF00582140 Usp: Universal stress protein family; InterPro: IP 99.93
PRK11175 305 universal stress protein UspE; Provisional 99.93
cd01988132 Na_H_Antiporter_C The C-terminal domain of a subfa 99.93
cd01987124 USP_OKCHK USP domain is located between the N-term 99.91
PRK11175305 universal stress protein UspE; Provisional 99.89
cd00293130 USP_Like Usp: Universal stress protein family. The 99.87
COG0589154 UspA Universal stress protein UspA and related nuc 99.86
PRK12652 357 putative monovalent cation/H+ antiporter subunit E 99.78
PRK10490 895 sensor protein KdpD; Provisional 99.54
COG2205 890 KdpD Osmosensitive K+ channel histidine kinase [Si 99.47
cd0198486 AANH_like Adenine nucleotide alpha hydrolases supe 98.7
PLN03159 832 cation/H(+) antiporter 15; Provisional 98.28
TIGR02432189 lysidine_TilS_N tRNA(Ile)-lysidine synthetase, N-t 97.74
PF01171182 ATP_bind_3: PP-loop family; InterPro: IPR011063 Th 97.68
cd01992185 PP-ATPase N-terminal domain of predicted ATPase of 97.46
PLN03159832 cation/H(+) antiporter 15; Provisional 97.45
PRK12342 254 hypothetical protein; Provisional 97.02
PRK03359 256 putative electron transfer flavoprotein FixA; Revi 96.96
cd01993185 Alpha_ANH_like_II This is a subfamily of Adenine n 96.93
COG0037 298 MesJ tRNA(Ile)-lysidine synthase MesJ [Cell cycle 96.87
PF01012164 ETF: Electron transfer flavoprotein domain; InterP 96.79
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 96.58
PRK10696258 tRNA 2-thiocytidine biosynthesis protein TtcA; Pro 96.58
COG2086 260 FixA Electron transfer flavoprotein, beta subunit 96.27
PRK05253 301 sulfate adenylyltransferase subunit 2; Provisional 95.74
PRK13820 394 argininosuccinate synthase; Provisional 95.65
COG0041162 PurE Phosphoribosylcarboxyaminoimidazole (NCAIR) m 95.55
PRK10660 436 tilS tRNA(Ile)-lysidine synthetase; Provisional 95.48
PRK14665 360 mnmA tRNA-specific 2-thiouridylase MnmA; Provision 95.25
PRK10867 433 signal recognition particle protein; Provisional 95.24
TIGR00268 252 conserved hypothetical protein TIGR00268. The N-te 95.03
TIGR01162156 purE phosphoribosylaminoimidazole carboxylase, Pur 95.02
TIGR00591 454 phr2 photolyase PhrII. All proteins in this family 94.9
cd01985181 ETF The electron transfer flavoprotein (ETF) serve 94.63
COG0299200 PurN Folate-dependent phosphoribosylglycinamide fo 94.53
TIGR00959 428 ffh signal recognition particle protein. This mode 94.21
PLN00200 404 argininosuccinate synthase; Provisional 94.19
TIGR02039 294 CysD sulfate adenylyltransferase, small subunit. I 94.16
PF00731150 AIRC: AIR carboxylase; InterPro: IPR000031 Phospho 94.05
cd01713173 PAPS_reductase This domain is found in phosphoaden 93.93
PRK05579 399 bifunctional phosphopantothenoylcysteine decarboxy 93.89
PRK07313182 phosphopantothenoylcysteine decarboxylase; Validat 93.61
TIGR01425 429 SRP54_euk signal recognition particle protein SRP5 93.26
COG1606 269 ATP-utilizing enzymes of the PP-loop superfamily [ 93.24
PF1316795 GTP-bdg_N: GTP-binding GTPase N-terminal 93.24
cd01990202 Alpha_ANH_like_I This is a subfamily of Adenine nu 93.23
PF00875165 DNA_photolyase: DNA photolyase from Prosite.; Inte 92.63
PRK12563 312 sulfate adenylyltransferase subunit 2; Provisional 92.58
TIGR00032 394 argG argininosuccinate synthase. argG in bacteria, 92.51
cd01994194 Alpha_ANH_like_IV This is a subfamily of Adenine n 92.45
COG1066 456 Sms Predicted ATP-dependent serine protease [Postt 92.43
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 92.13
cd01995169 ExsB ExsB is a transcription regulator related pro 91.56
COG0552340 FtsY Signal recognition particle GTPase [Intracell 91.45
TIGR02113177 coaC_strep phosphopantothenoylcysteine decarboxyla 90.95
TIGR02852187 spore_dpaB dipicolinic acid synthetase, B subunit. 90.78
PRK13982 475 bifunctional SbtC-like/phosphopantothenoylcysteine 90.66
cd01986103 Alpha_ANH_like Adenine nucleotide alpha hydrolases 90.54
COG0541 451 Ffh Signal recognition particle GTPase [Intracellu 90.32
PRK13398 266 3-deoxy-7-phosphoheptulonate synthase; Provisional 89.73
PRK00143 346 mnmA tRNA-specific 2-thiouridylase MnmA; Reviewed 89.71
TIGR00342371 thiazole biosynthesis/tRNA modification protein Th 89.58
TIGR02765 429 crypto_DASH cryptochrome, DASH family. Photolyases 89.56
PRK08576438 hypothetical protein; Provisional 89.31
TIGR00884 311 guaA_Cterm GMP synthase (glutamine-hydrolyzing), C 88.76
COG1927 277 Mtd Coenzyme F420-dependent N(5),N(10)-methenyltet 88.73
COG2876 286 AroA 3-deoxy-D-arabino-heptulosonate 7-phosphate ( 88.41
PRK14664 362 tRNA-specific 2-thiouridylase MnmA; Provisional 88.12
PRK06027286 purU formyltetrahydrofolate deformylase; Reviewed 88.0
PLN02948577 phosphoribosylaminoimidazole carboxylase 87.89
TIGR03556 471 photolyase_8HDF deoxyribodipyrimidine photo-lyase, 87.81
cd01715168 ETF_alpha The electron transfer flavoprotein (ETF) 87.79
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 87.64
PRK06029185 3-octaprenyl-4-hydroxybenzoate carboxy-lyase; Prov 87.51
PRK00074 511 guaA GMP synthase; Reviewed 87.51
TIGR00521 390 coaBC_dfp phosphopantothenoylcysteine decarboxylas 87.47
TIGR00064272 ftsY signal recognition particle-docking protein F 87.18
PRK14974336 cell division protein FtsY; Provisional 87.14
PRK00994 277 F420-dependent methylenetetrahydromethanopterin de 86.53
cd01712177 ThiI ThiI is required for thiazole synthesis in th 86.48
PRK00771 437 signal recognition particle protein Srp54; Provisi 86.06
), forming GARS-AIRS-GART. This entry represents the N-domain, which is related to the N-terminal domain of biotin carboxylase/carbamoyl phosphate synthetase (IPR005481 from INTERPRO).; GO: 0004637 phosphoribosylamine-glycine ligase activity, 0009113 purine base biosynthetic process; PDB: 3MJF_A 2XD4_A 2XCL_A 2IP4_A 2YW2_B 2YYA_A 3LP8_A 1VKZ_A 2YS6_A 2YRX_A ...." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF02844">PF02844100 GARS_N: Phosphoribosylglycinamide synthetase, N do 85.94
PF02601 319 Exonuc_VII_L: Exonuclease VII, large subunit; Inte 85.92
PF01596205 Methyltransf_3: O-methyltransferase; InterPro: IPR 85.62
cd02067119 B12-binding B12 binding domain (B12-BD). This doma 85.44
PF03652135 UPF0081: Uncharacterised protein family (UPF0081); 85.3
KOG1650769 consensus Predicted K+/H+-antiporter [Inorganic io 85.16
PRK00109138 Holliday junction resolvase-like protein; Reviewed 85.02
PRK00919 307 GMP synthase subunit B; Validated 84.88
TIGR00655280 PurU formyltetrahydrofolate deformylase. This mode 84.82
COG1646 240 Predicted phosphate-binding enzymes, TIM-barrel fo 84.54
TIGR00034 344 aroFGH phospho-2-dehydro-3-deoxyheptonate aldolase 84.22
KOG3180254 consensus Electron transfer flavoprotein, beta sub 84.01
COG2102223 Predicted ATPases of PP-loop superfamily [General 83.89
PRK10416318 signal recognition particle-docking protein FtsY; 83.42
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 83.4
TIGR02069 250 cyanophycinase cyanophycinase. This model describe 83.18
COG1597 301 LCB5 Sphingosine kinase and enzymes related to euk 83.14
TIGR0085395 pts-lac PTS system, lactose/cellobiose family IIB 83.1
PRK00509 399 argininosuccinate synthase; Provisional 83.03
PRK11070 575 ssDNA exonuclease RecJ; Provisional 82.76
PF01008282 IF-2B: Initiation factor 2 subunit family; InterPr 82.35
cd0556599 PTS_IIB_lactose PTS_IIB_lactose: subunit IIB of en 82.35
KOG0781587 consensus Signal recognition particle receptor, al 81.99
cd03115173 SRP The signal recognition particle (SRP) mediates 81.9
KOG1467556 consensus Translation initiation factor 2B, delta 81.83
TIGR02699174 archaeo_AfpA archaeoflavoprotein AfpA. The prototy 81.42
PLN02331207 phosphoribosylglycinamide formyltransferase 81.29
KOG0780 483 consensus Signal recognition particle, subunit Srp 81.08
PF12683 275 DUF3798: Protein of unknown function (DUF3798); In 80.89
TIGR00420 352 trmU tRNA (5-methylaminomethyl-2-thiouridylate)-me 80.86
cd01997 295 GMP_synthase_C The C-terminal domain of GMP synthe 80.79
PRK08349198 hypothetical protein; Validated 80.43
PRK09590104 celB cellobiose phosphotransferase system IIB comp 80.3
>PRK15456 universal stress protein UspG; Provisional Back     alignment and domain information 
Probab=99.96  E-value=4.8e-29  Score=162.21  Aligned_cols=140  Identities=19%  Similarity=0.229  Sum_probs=105.8

Q ss_pred             CCceEEEEeCCCh--hhHHHHHHHHhhcccCCCEEEEEEEecCCCCCccccccccCCCCCCCCCCCCccchhhhhhcCCC
Q 031168            3 GTRRVGVAVDFSA--CSKKALQWAADNVVRNGDHLILVTVVPEGGLEKGEQQLWEDSGSPLIPLAEFSEPTIMKKYGAKP   80 (164)
Q Consensus         3 ~~~~ILv~~d~s~--~~~~~l~~a~~la~~~~~~l~~l~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   80 (164)
                      ||++||||+|+|+  .+..++++|..+|+.. ++++++||.+......     +   ..   ....   .+...+..++.
T Consensus         1 m~~~ILv~vD~S~~~~s~~al~~A~~la~~~-~~l~llhv~~~~~~~~-----~---~~---~~~~---~~~~~~~~~~~   65 (142)
T PRK15456          1 MYKTIIMPVDVFEMELSDKAVRHAEFLAQDD-GVIHLLHVLPGSASLS-----L---HR---FAAD---VRRFEEHLQHE   65 (142)
T ss_pred             CCccEEEeccCCchhHHHHHHHHHHHHHhcC-CeEEEEEEecCccccc-----c---cc---cccc---hhhHHHHHHHH
Confidence            4899999999994  7999999999999875 6999999997653110     0   00   0000   01122222223


Q ss_pred             CchHHHHHHHHHHhcCceEEEEEeeCChhHHHHHHhhhcCCcEEEEeecCCCccceecccchhHHHhhcCCCcEEEEc
Q 031168           81 DPETLDIVNTVARQKQIVVVMKIFWGDPREKICEAIDKIPLSCLVIGNRGLGKLKRAIMGSVSNYVVNNGSCPVTVVK  158 (164)
Q Consensus        81 ~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~I~~~a~~~~~dliVig~~~~~~~~~~~~gs~~~~l~~~~~~pVlvv~  158 (164)
                      .++.++.+.+.+...+.+++.++..|++.++|++++++.++||||||+++++ +.++++||++++|+++++||||++|
T Consensus        66 ~~~~l~~~~~~~~~~~~~v~~~v~~G~~~~~I~~~a~~~~~DLIVmG~~g~~-~~~~llGS~a~~v~~~a~~pVLvV~  142 (142)
T PRK15456         66 AEERLQTMVSHFTIDPSRIKQHVRFGSVRDEVNELAEELGADVVVIGSRNPS-ISTHLLGSNASSVIRHANLPVLVVR  142 (142)
T ss_pred             HHHHHHHHHHHhCCCCcceEEEEcCCChHHHHHHHHhhcCCCEEEEcCCCCC-ccceecCccHHHHHHcCCCCEEEeC
Confidence            3445555555444457788999999999999999999999999999999976 7788999999999999999999986

>PRK15005 universal stress protein F; Provisional Back     alignment and domain information
>PRK09982 universal stress protein UspD; Provisional Back     alignment and domain information
>cd01989 STK_N The N-terminal domain of Eukaryotic Serine Threonine kinases Back     alignment and domain information
>PRK15118 universal stress global response regulator UspA; Provisional Back     alignment and domain information
>PRK10116 universal stress protein UspC; Provisional Back     alignment and domain information
>PF00582 Usp: Universal stress protein family; InterPro: IPR006016 The universal stress protein UspA P28242 from SWISSPROT [] is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents Back     alignment and domain information
>PRK11175 universal stress protein UspE; Provisional Back     alignment and domain information
>cd01988 Na_H_Antiporter_C The C-terminal domain of a subfamily of Na+ /H+ antiporter existed in bacteria and archea Back     alignment and domain information
>cd01987 USP_OKCHK USP domain is located between the N-terminal sensor domain and C-terminal catalytic domain of this Osmosensitive K+ channel histidine kinase family Back     alignment and domain information
>PRK11175 universal stress protein UspE; Provisional Back     alignment and domain information
>cd00293 USP_Like Usp: Universal stress protein family Back     alignment and domain information
>COG0589 UspA Universal stress protein UspA and related nucleotide-binding proteins [Signal transduction mechanisms] Back     alignment and domain information
>PRK12652 putative monovalent cation/H+ antiporter subunit E; Reviewed Back     alignment and domain information
>PRK10490 sensor protein KdpD; Provisional Back     alignment and domain information
>COG2205 KdpD Osmosensitive K+ channel histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd01984 AANH_like Adenine nucleotide alpha hydrolases superfamily including N type ATP PPases, ATP sulphurylases Universal Stress Response protein and electron transfer flavoprotein (ETF) Back     alignment and domain information
>PLN03159 cation/H(+) antiporter 15; Provisional Back     alignment and domain information
>TIGR02432 lysidine_TilS_N tRNA(Ile)-lysidine synthetase, N-terminal domain Back     alignment and domain information
>PF01171 ATP_bind_3: PP-loop family; InterPro: IPR011063 This entry represents the PP-loop motif superfamily [,] Back     alignment and domain information
>cd01992 PP-ATPase N-terminal domain of predicted ATPase of the PP-loop faimly implicated in cell cycle control [Cell division and chromosome partitioning] Back     alignment and domain information
>PLN03159 cation/H(+) antiporter 15; Provisional Back     alignment and domain information
>PRK12342 hypothetical protein; Provisional Back     alignment and domain information
>PRK03359 putative electron transfer flavoprotein FixA; Reviewed Back     alignment and domain information
>cd01993 Alpha_ANH_like_II This is a subfamily of Adenine nucleotide alpha hydrolases superfamily Back     alignment and domain information
>COG0037 MesJ tRNA(Ile)-lysidine synthase MesJ [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF01012 ETF: Electron transfer flavoprotein domain; InterPro: IPR014730 Electron transfer flavoproteins (ETFs) serve as specific electron acceptors for primary dehydrogenases, transferring the electrons to terminal respiratory systems Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PRK10696 tRNA 2-thiocytidine biosynthesis protein TtcA; Provisional Back     alignment and domain information
>COG2086 FixA Electron transfer flavoprotein, beta subunit [Energy production and conversion] Back     alignment and domain information
>PRK05253 sulfate adenylyltransferase subunit 2; Provisional Back     alignment and domain information
>PRK13820 argininosuccinate synthase; Provisional Back     alignment and domain information
>COG0041 PurE Phosphoribosylcarboxyaminoimidazole (NCAIR) mutase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK10660 tilS tRNA(Ile)-lysidine synthetase; Provisional Back     alignment and domain information
>PRK14665 mnmA tRNA-specific 2-thiouridylase MnmA; Provisional Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>TIGR00268 conserved hypothetical protein TIGR00268 Back     alignment and domain information
>TIGR01162 purE phosphoribosylaminoimidazole carboxylase, PurE protein Back     alignment and domain information
>TIGR00591 phr2 photolyase PhrII Back     alignment and domain information
>cd01985 ETF The electron transfer flavoprotein (ETF) serves as a specific electron acceptor for various mitochondrial dehydrogenases Back     alignment and domain information
>COG0299 PurN Folate-dependent phosphoribosylglycinamide formyltransferase PurN [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>PLN00200 argininosuccinate synthase; Provisional Back     alignment and domain information
>TIGR02039 CysD sulfate adenylyltransferase, small subunit Back     alignment and domain information
>PF00731 AIRC: AIR carboxylase; InterPro: IPR000031 Phosphoribosylaminoimidazole carboxylase is a fusion protein in plants and fungi, but consists of two non-interacting proteins in bacteria, PurK and PurE Back     alignment and domain information
>cd01713 PAPS_reductase This domain is found in phosphoadenosine phosphosulphate (PAPS) reductase enzymes or PAPS sulphotransferase Back     alignment and domain information
>PRK05579 bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Validated Back     alignment and domain information
>PRK07313 phosphopantothenoylcysteine decarboxylase; Validated Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>COG1606 ATP-utilizing enzymes of the PP-loop superfamily [General function prediction only] Back     alignment and domain information
>PF13167 GTP-bdg_N: GTP-binding GTPase N-terminal Back     alignment and domain information
>cd01990 Alpha_ANH_like_I This is a subfamily of Adenine nucleotide alpha hydrolases superfamily Back     alignment and domain information
>PF00875 DNA_photolyase: DNA photolyase from Prosite Back     alignment and domain information
>PRK12563 sulfate adenylyltransferase subunit 2; Provisional Back     alignment and domain information
>TIGR00032 argG argininosuccinate synthase Back     alignment and domain information
>cd01994 Alpha_ANH_like_IV This is a subfamily of Adenine nucleotide alpha hydrolases superfamily Back     alignment and domain information
>COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd01995 ExsB ExsB is a transcription regulator related protein Back     alignment and domain information
>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR02113 coaC_strep phosphopantothenoylcysteine decarboxylase, streptococcal Back     alignment and domain information
>TIGR02852 spore_dpaB dipicolinic acid synthetase, B subunit Back     alignment and domain information
>PRK13982 bifunctional SbtC-like/phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Provisional Back     alignment and domain information
>cd01986 Alpha_ANH_like Adenine nucleotide alpha hydrolases superfamily including N type ATP PPases and ATP sulphurylases Back     alignment and domain information
>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK13398 3-deoxy-7-phosphoheptulonate synthase; Provisional Back     alignment and domain information
>PRK00143 mnmA tRNA-specific 2-thiouridylase MnmA; Reviewed Back     alignment and domain information
>TIGR00342 thiazole biosynthesis/tRNA modification protein ThiI Back     alignment and domain information
>TIGR02765 crypto_DASH cryptochrome, DASH family Back     alignment and domain information
>PRK08576 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00884 guaA_Cterm GMP synthase (glutamine-hydrolyzing), C-terminal domain or B subunit Back     alignment and domain information
>COG1927 Mtd Coenzyme F420-dependent N(5),N(10)-methenyltetrahydromethanopterin dehydrogenase [Energy production and conversion] Back     alignment and domain information
>COG2876 AroA 3-deoxy-D-arabino-heptulosonate 7-phosphate (DAHP) synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14664 tRNA-specific 2-thiouridylase MnmA; Provisional Back     alignment and domain information
>PRK06027 purU formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>PLN02948 phosphoribosylaminoimidazole carboxylase Back     alignment and domain information
>TIGR03556 photolyase_8HDF deoxyribodipyrimidine photo-lyase, 8-HDF type Back     alignment and domain information
>cd01715 ETF_alpha The electron transfer flavoprotein (ETF) serves as a specific electron acceptor for various mitochondrial dehydrogenases Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK06029 3-octaprenyl-4-hydroxybenzoate carboxy-lyase; Provisional Back     alignment and domain information
>PRK00074 guaA GMP synthase; Reviewed Back     alignment and domain information
>TIGR00521 coaBC_dfp phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase, prokaryotic Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>PRK00994 F420-dependent methylenetetrahydromethanopterin dehydrogenase; Provisional Back     alignment and domain information
>cd01712 ThiI ThiI is required for thiazole synthesis in the thiamine biosynthesis pathway Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>PF02844 GARS_N: Phosphoribosylglycinamide synthetase, N domain; InterPro: IPR020562 Phosphoribosylglycinamide synthetase (6 Back     alignment and domain information
>PF02601 Exonuc_VII_L: Exonuclease VII, large subunit; InterPro: IPR020579 Exonuclease VII 3 Back     alignment and domain information
>PF01596 Methyltransf_3: O-methyltransferase; InterPro: IPR002935 Members of this family are O-methyltransferases Back     alignment and domain information
>cd02067 B12-binding B12 binding domain (B12-BD) Back     alignment and domain information
>PF03652 UPF0081: Uncharacterised protein family (UPF0081); InterPro: IPR005227 Holliday junction resolvases (HJRs) are key enzymes of DNA recombination Back     alignment and domain information
>KOG1650 consensus Predicted K+/H+-antiporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK00109 Holliday junction resolvase-like protein; Reviewed Back     alignment and domain information
>PRK00919 GMP synthase subunit B; Validated Back     alignment and domain information
>TIGR00655 PurU formyltetrahydrofolate deformylase Back     alignment and domain information
>COG1646 Predicted phosphate-binding enzymes, TIM-barrel fold [General function prediction only] Back     alignment and domain information
>TIGR00034 aroFGH phospho-2-dehydro-3-deoxyheptonate aldolase Back     alignment and domain information
>KOG3180 consensus Electron transfer flavoprotein, beta subunit [Energy production and conversion] Back     alignment and domain information
>COG2102 Predicted ATPases of PP-loop superfamily [General function prediction only] Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR02069 cyanophycinase cyanophycinase Back     alignment and domain information
>COG1597 LCB5 Sphingosine kinase and enzymes related to eukaryotic diacylglycerol kinase [Lipid metabolism / General function prediction only] Back     alignment and domain information
>TIGR00853 pts-lac PTS system, lactose/cellobiose family IIB component Back     alignment and domain information
>PRK00509 argininosuccinate synthase; Provisional Back     alignment and domain information
>PRK11070 ssDNA exonuclease RecJ; Provisional Back     alignment and domain information
>PF01008 IF-2B: Initiation factor 2 subunit family; InterPro: IPR000649 Initiation factor 2 binds to Met-tRNA, GTP and the small ribosomal subunit Back     alignment and domain information
>cd05565 PTS_IIB_lactose PTS_IIB_lactose: subunit IIB of enzyme II (EII) of the lactose-specific phosphoenolpyruvate:carbohydrate phosphotransferase system (PTS) found in Firmicutes as well as Actinobacteria Back     alignment and domain information
>KOG0781 consensus Signal recognition particle receptor, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>KOG1467 consensus Translation initiation factor 2B, delta subunit (eIF-2Bdelta/GCD2) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR02699 archaeo_AfpA archaeoflavoprotein AfpA Back     alignment and domain information
>PLN02331 phosphoribosylglycinamide formyltransferase Back     alignment and domain information
>KOG0780 consensus Signal recognition particle, subunit Srp54 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12683 DUF3798: Protein of unknown function (DUF3798); InterPro: IPR024258 This entry represents functionally uncharacterised proteins that are found in bacteria Back     alignment and domain information
>TIGR00420 trmU tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase Back     alignment and domain information
>cd01997 GMP_synthase_C The C-terminal domain of GMP synthetase Back     alignment and domain information
>PRK08349 hypothetical protein; Validated Back     alignment and domain information
>PRK09590 celB cellobiose phosphotransferase system IIB component; Reviewed Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query164
2gm3_A175 Crystal Structure Of An Universal Stress Protein Fa 1e-09
1wjg_A137 Crystal Structure Of A Probable Atp Binding Protein 3e-04
3loq_A294 The Crystal Structure Of A Universal Stress Protein 4e-04
2dum_A170 Crystal Structure Of Hypothetical Protein, Ph0823 L 9e-04
>pdb|2GM3|A Chain A, Crystal Structure Of An Universal Stress Protein Family Protein From Arabidopsis Thaliana At3g01520 With Amp Bound Length = 175 Back     alignment and structure 
Iteration: 1

 Score = 59.3 bits (142), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 38/159 (23%), Positives = 72/159 (45%), Gaps = 22/159 (13%)
Query: 14  SACSKKALQWAADNVVRNGDH-----LILVTVVPEGGLEKGEQQLWEDSGSPLIPLAEFS 68
           S   K+A +W  + +VR+        L+ V VV E G +  +              + ++
Sbjct: 24  SISCKRAFEWTLEKIVRSNTSDFKILLLHVQVVDEDGFDDVD--------------SIYA 69
Query: 69  EPTIMKKYGAKPDPETLDIVNTVARQKQIVVVMKIFW---GDPREKICEAIDKIPLSCLV 125
            P   +        + L ++     +   + V    W   GDP++ IC+ + ++    LV
Sbjct: 70  SPEDFRDXRQSNKAKGLHLLEFFVNKCHEIGVGCEAWIKTGDPKDVICQEVKRVRPDFLV 129
Query: 126 IGNRGLGKLKRAIMGSVSNYVVNNGSCPVTVVKQGIHET 164
           +G+RGLG+ ++  +G+VS + V +  CPV  +K+   ET
Sbjct: 130 VGSRGLGRFQKVFVGTVSAFCVKHAECPVXTIKRNADET 168
>pdb|1WJG|A Chain A, Crystal Structure Of A Probable Atp Binding Protein From Thermus Themophilus Hb8 Length = 137 Back     alignment and structure
>pdb|3LOQ|A Chain A, The Crystal Structure Of A Universal Stress Protein From Archaeoglobus Fulgidus Dsm 4304 Length = 294 Back     alignment and structure
>pdb|2DUM|A Chain A, Crystal Structure Of Hypothetical Protein, Ph0823 Length = 170 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query164
2gm3_A175 Unknown protein; AT3G01520, putative ethylene-resp 3e-42
3idf_A138 USP-like protein; universal, stress, PSI, MCSG, st 7e-29
1mjh_A162 Protein (ATP-binding domain of protein MJ0577); hy 2e-26
1tq8_A163 Hypothetical protein RV1636; MTCY01B2.28, structur 7e-26
3hgm_A147 Universal stress protein TEAD; rossman fold, signa 4e-23
2z08_A137 Universal stress protein family; uncharacterized c 5e-23
3s3t_A146 Nucleotide-binding protein, universal stress PROT 9e-23
2dum_A170 Hypothetical protein PH0823; conserved hypothetica 2e-22
3dlo_A155 Universal stress protein; unknown function, struct 4e-22
3loq_A294 Universal stress protein; structural genomics, PSI 2e-21
3loq_A 294 Universal stress protein; structural genomics, PSI 2e-18
3tnj_A150 Universal stress protein (USP); structural genomic 1e-19
3fg9_A156 Protein of universal stress protein USPA family; A 2e-18
1jmv_A141 USPA, universal stress protein A; chaperone; 1.85A 2e-18
3fdx_A143 Putative filament protein / universal stress PROT; 7e-18
3ab8_A 268 Putative uncharacterized protein TTHA0350; tandem- 4e-17
3ab8_A268 Putative uncharacterized protein TTHA0350; tandem- 5e-12
3cis_A 309 Uncharacterized protein; alpha/beta hydrolase, ATP 2e-16
3cis_A309 Uncharacterized protein; alpha/beta hydrolase, ATP 4e-13
3olq_A 319 Universal stress protein E; structural genomics, P 2e-14
3olq_A319 Universal stress protein E; structural genomics, P 1e-11
3mt0_A 290 Uncharacterized protein PA1789; structural genomic 2e-11
3mt0_A290 Uncharacterized protein PA1789; structural genomic 8e-10
1q77_A138 Hypothetical protein AQ_178; structural genomics, 7e-06
>2gm3_A Unknown protein; AT3G01520, putative ethylene-responsive protein, USP domain, nucleotide binding domain, AMP; HET: MSE AMP; 2.46A {Arabidopsis thaliana} SCOP: c.26.2.4 Length = 175 Back     alignment and structure
 Score =  138 bits (348), Expect = 3e-42
 Identities = 41/172 (23%), Positives = 75/172 (43%), Gaps = 21/172 (12%)

Query: 5   RRVGVAVDFSAC---------SKKALQWAADNVVRNGDH---LILVTVVPEGGLEKGEQQ 52
            +V VAV+ S            K+A +W  + +VR+      ++L+ V      E G   
Sbjct: 6   TKVMVAVNASTIKDYPNPSISCKRAFEWTLEKIVRSNTSDFKILLLHVQVV--DEDGFDD 63

Query: 53  LWEDSGSPLIPLAEFSEPTIMKKYGAKPDPETLDIVNTVARQKQIVVVMKIFWGDPREKI 112
           +     SP        +   M++         L+       +  +     I  GDP++ I
Sbjct: 64  VDSIYASP-------EDFRDMRQSNKAKGLHLLEFFVNKCHEIGVGCEAWIKTGDPKDVI 116

Query: 113 CEAIDKIPLSCLVIGNRGLGKLKRAIMGSVSNYVVNNGSCPVTVVKQGIHET 164
           C+ + ++    LV+G+RGLG+ ++  +G+VS + V +  CPV  +K+   ET
Sbjct: 117 CQEVKRVRPDFLVVGSRGLGRFQKVFVGTVSAFCVKHAECPVMTIKRNADET 168
>3idf_A USP-like protein; universal, stress, PSI, MCSG, structural genomics, midwest center for structural genomics structure initiative; 2.00A {Wolinella succinogenes} Length = 138 Back     alignment and structure
>1mjh_A Protein (ATP-binding domain of protein MJ0577); hypothetical protein, structural genomics, functional assignment; HET: ATP; 1.70A {Methanocaldococcus jannaschii} SCOP: c.26.2.4 Length = 162 Back     alignment and structure
>1tq8_A Hypothetical protein RV1636; MTCY01B2.28, structural target, NYSGXRC, PSI, protein structure initiative; 2.40A {Mycobacterium tuberculosis} SCOP: c.26.2.4 Length = 163 Back     alignment and structure
>3hgm_A Universal stress protein TEAD; rossman fold, signaling protein; HET: ATP; 1.90A {Halomonas elongata} Length = 147 Back     alignment and structure
>2z08_A Universal stress protein family; uncharacterized conserved protein, structural genomics, unknown function, NPPSFA; HET: ATP; 1.55A {Thermus thermophilus} SCOP: c.26.2.4 PDB: 1wjg_A* 2z09_A* 2z3v_A Length = 137 Back     alignment and structure
>3s3t_A Nucleotide-binding protein, universal stress PROT family; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: ATP; 1.90A {Lactobacillus plantarum} Length = 146 Back     alignment and structure
>2dum_A Hypothetical protein PH0823; conserved hypothetical protein, putative universal protein A structural genomics, NPPSFA; 2.75A {Pyrococcus horikoshii} Length = 170 Back     alignment and structure
>3dlo_A Universal stress protein; unknown function, structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics; HET: MSE; 1.97A {Archaeoglobus fulgidus} PDB: 3qtb_A* Length = 155 Back     alignment and structure
>3loq_A Universal stress protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: AMP; 2.32A {Archaeoglobus fulgidus} Length = 294 Back     alignment and structure
>3loq_A Universal stress protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: AMP; 2.32A {Archaeoglobus fulgidus} Length = 294 Back     alignment and structure
>3tnj_A Universal stress protein (USP); structural genomics, PSI-biology, midwest center for structu genomics, MCSG, chaperone; HET: AMP; 2.00A {Nitrosomonas europaea} PDB: 2pfs_A* Length = 150 Back     alignment and structure
>3fg9_A Protein of universal stress protein USPA family; APC60691, nucleotide- binding, lactobacillus plantarum WCFS1, structural genomics PSI-2; 1.47A {Lactobacillus plantarum} Length = 156 Back     alignment and structure
>1jmv_A USPA, universal stress protein A; chaperone; 1.85A {Haemophilus influenzae} SCOP: c.26.2.4 Length = 141 Back     alignment and structure
>3fdx_A Putative filament protein / universal stress PROT; structural genomics, APC60640.1, universal protein F, PSI-2; HET: MSE ATP; 1.58A {Klebsiella pneumoniae subsp} PDB: 3fh0_A* Length = 143 Back     alignment and structure
>3ab8_A Putative uncharacterized protein TTHA0350; tandem-type universal stress protein, unknown function; HET: ATP; 1.70A {Thermus thermophilus} PDB: 3ab7_A* Length = 268 Back     alignment and structure
>3ab8_A Putative uncharacterized protein TTHA0350; tandem-type universal stress protein, unknown function; HET: ATP; 1.70A {Thermus thermophilus} PDB: 3ab7_A* Length = 268 Back     alignment and structure
>3cis_A Uncharacterized protein; alpha/beta hydrolase, ATP, universal stress protein, unknown function; HET: ATP; 2.90A {Mycobacterium tuberculosis} PDB: 2jax_A* Length = 309 Back     alignment and structure
>3cis_A Uncharacterized protein; alpha/beta hydrolase, ATP, universal stress protein, unknown function; HET: ATP; 2.90A {Mycobacterium tuberculosis} PDB: 2jax_A* Length = 309 Back     alignment and structure
>3olq_A Universal stress protein E; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: UNL; 1.82A {Proteus mirabilis} Length = 319 Back     alignment and structure
>3olq_A Universal stress protein E; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: UNL; 1.82A {Proteus mirabilis} Length = 319 Back     alignment and structure
>3mt0_A Uncharacterized protein PA1789; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 1.58A {Pseudomonas aeruginosa} Length = 290 Back     alignment and structure
>3mt0_A Uncharacterized protein PA1789; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 1.58A {Pseudomonas aeruginosa} Length = 290 Back     alignment and structure
>1q77_A Hypothetical protein AQ_178; structural genomics, universal stress protein, PSI, protein structure initiative; 2.70A {Aquifex aeolicus} SCOP: c.26.2.4 Length = 138 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query164
2dum_A170 Hypothetical protein PH0823; conserved hypothetica 99.97
3tnj_A150 Universal stress protein (USP); structural genomic 99.97
3s3t_A146 Nucleotide-binding protein, universal stress PROT 99.97
1mjh_A162 Protein (ATP-binding domain of protein MJ0577); hy 99.97
3fg9_A156 Protein of universal stress protein USPA family; A 99.96
3hgm_A147 Universal stress protein TEAD; rossman fold, signa 99.96
1tq8_A163 Hypothetical protein RV1636; MTCY01B2.28, structur 99.96
3dlo_A155 Universal stress protein; unknown function, struct 99.96
3idf_A138 USP-like protein; universal, stress, PSI, MCSG, st 99.96
2z08_A137 Universal stress protein family; uncharacterized c 99.96
2gm3_A175 Unknown protein; AT3G01520, putative ethylene-resp 99.95
1jmv_A141 USPA, universal stress protein A; chaperone; 1.85A 99.95
3fdx_A143 Putative filament protein / universal stress PROT; 99.95
3olq_A 319 Universal stress protein E; structural genomics, P 99.94
3loq_A 294 Universal stress protein; structural genomics, PSI 99.94
3mt0_A 290 Uncharacterized protein PA1789; structural genomic 99.93
3cis_A 309 Uncharacterized protein; alpha/beta hydrolase, ATP 99.92
3mt0_A290 Uncharacterized protein PA1789; structural genomic 99.92
3loq_A294 Universal stress protein; structural genomics, PSI 99.91
1q77_A138 Hypothetical protein AQ_178; structural genomics, 99.91
3ab8_A 268 Putative uncharacterized protein TTHA0350; tandem- 99.91
3olq_A319 Universal stress protein E; structural genomics, P 99.9
3cis_A309 Uncharacterized protein; alpha/beta hydrolase, ATP 99.89
3ab8_A268 Putative uncharacterized protein TTHA0350; tandem- 99.86
2iel_A138 Hypothetical protein TT0030; TT0030,thermus thermo 97.34
1wy5_A 317 TILS, hypothetical UPF0072 protein AQ_1887; N-type 96.52
3a2k_A 464 TRNA(Ile)-lysidine synthase; ligase, pseudo-knot, 96.34
3g40_A294 Na-K-CL cotransporter; alpha/beta fold 10-stranded 95.57
4b4k_A181 N5-carboxyaminoimidazole ribonucleotide mutase; is 95.55
1zun_A 325 Sulfate adenylyltransferase subunit 2; beta barrel 95.48
3oow_A166 Phosphoribosylaminoimidazole carboxylase,catalyic; 95.34
3ih5_A217 Electron transfer flavoprotein alpha-subunit; alph 95.12
2ywx_A157 Phosphoribosylaminoimidazole carboxylase catalyti; 94.96
3trh_A169 Phosphoribosylaminoimidazole carboxylase carboxylt 94.96
4grd_A173 N5-CAIR mutase, phosphoribosylaminoimidazole carbo 94.77
3g40_A 294 Na-K-CL cotransporter; alpha/beta fold 10-stranded 94.76
3kuu_A174 Phosphoribosylaminoimidazole carboxylase catalyti 94.72
1xmp_A170 PURE, phosphoribosylaminoimidazole carboxylase; pu 94.63
3ors_A163 N5-carboxyaminoimidazole ribonucleotide mutase; is 94.61
1k92_A 455 Argininosuccinate synthase, argininosuccinate SY; 94.57
3lp6_A174 Phosphoribosylaminoimidazole carboxylase catalyti; 94.5
1o4v_A183 Phosphoribosylaminoimidazole mutase PURE; structur 94.5
1o97_C 264 Electron transferring flavoprotein beta-subunit; F 94.45
2nz2_A 413 Argininosuccinate synthase; amino-acid biosynthesi 94.41
3kcq_A215 Phosphoribosylglycinamide formyltransferase; struc 94.34
3k32_A203 Uncharacterized protein MJ0690; predicted subunit 94.26
2xry_A 482 Deoxyribodipyrimidine photolyase; DNA damage, DNA 94.19
1ni5_A 433 Putative cell cycle protein MESJ; structural genom 94.11
1u11_A182 PURE (N5-carboxyaminoimidazole ribonucleotide MUT; 94.0
1sur_A215 PAPS reductase; assimilatory sulfate reduction, 3- 93.95
3rg8_A159 Phosphoribosylaminoimidazole carboxylase, PURE PR; 93.88
1efp_B252 ETF, protein (electron transfer flavoprotein); ele 93.29
3rjz_A 237 N-type ATP pyrophosphatase superfamily; structural 92.87
1efv_B255 Electron transfer flavoprotein; electron transport 92.55
3zqu_A209 Probable aromatic acid decarboxylase; lyase; HET: 92.55
2oq2_A261 Phosphoadenosine phosphosulfate reductase; sulfate 92.29
3bl5_A219 Queuosine biosynthesis protein QUEC; PREQ1 biosynt 91.98
1np7_A 489 DNA photolyase; protein with FAD cofactor; HET: DN 91.86
3umv_A 506 Deoxyribodipyrimidine photo-lyase; CPD cyclobutane 91.52
3p9x_A211 Phosphoribosylglycinamide formyltransferase; struc 91.37
2hma_A 376 Probable tRNA (5-methylaminomethyl-2-thiouridylat 91.22
4ds3_A209 Phosphoribosylglycinamide formyltransferase; struc 91.17
2ywb_A 503 GMP synthase [glutamine-hydrolyzing]; GMP syntheta 90.07
1iv0_A98 Hypothetical protein; rnaseh-like, YQGF, structura 89.84
2wsi_A 306 FAD synthetase; transferase, nucleotidyltransferas 89.76
3tqi_A 527 GMP synthase [glutamine-hydrolyzing]; ligase; 2.84 89.74
2wq7_A 543 RE11660P; lyase-DNA complex, DNA repair, DNA lesio 89.7
3da8_A215 Probable 5'-phosphoribosylglycinamide formyltransf 89.27
2c5s_A413 THII, probable thiamine biosynthesis protein THII; 89.1
1kor_A 400 Argininosuccinate synthetase; ligase, riken struct 89.1
3lqk_A201 Dipicolinate synthase subunit B; flavoprotein, PSI 88.83
3fy4_A 537 6-4 photolyase; DNA repair, clock cryptochrome; HE 88.41
3dm5_A 443 SRP54, signal recognition 54 kDa protein; protein- 88.04
2h31_A425 Multifunctional protein ADE2; alpha-beta-alpha, li 87.98
2dpl_A 308 GMP synthetase, GMP synthase [glutamine-hydrolyzin 87.81
2o8v_A252 Phosphoadenosine phosphosulfate reductase; disulfi 87.71
2pg3_A232 Queuosine biosynthesis protein QUEC; YP_049261.1, 87.52
2der_A 380 TRNA-specific 2-thiouridylase MNMA; protein-RNA co 87.37
1g63_A181 Epidermin modifying enzyme EPID; alpha, beta prote 86.44
2ywr_A216 Phosphoribosylglycinamide formyltransferase; rossm 85.86
1vl2_A 421 Argininosuccinate synthase; TM1780, structural gen 85.72
1ccw_A137 Protein (glutamate mutase); coenzyme B12, radical 85.63
3tqr_A215 Phosphoribosylglycinamide formyltransferase; purin 85.29
1vbk_A307 Hypothetical protein PH1313; structural genomics, 84.97
2xxa_A 433 Signal recognition particle protein; protein trans 84.16
3tvs_A 538 Cryptochrome-1; circadian clock light entrainment, 83.95
2ejb_A189 Probable aromatic acid decarboxylase; phenylacryli 83.63
3dff_A273 Teicoplanin pseudoaglycone deacetylases ORF2; lipo 83.25
3qjg_A175 Epidermin biosynthesis protein EPID; structural ge 83.23
3o1l_A302 Formyltetrahydrofolate deformylase; structural gen 83.08
4f3r_A162 Phosphopantetheine adenylyltransferase; phosphopan 82.59
2l69_A134 Rossmann 2X3 fold protein; structural genomics, no 82.37
3kl4_A 433 SRP54, signal recognition 54 kDa protein; signal r 82.1
3q0i_A 318 Methionyl-tRNA formyltransferase; structural genom 81.57
1p3y_1194 MRSD protein; flavoprotein, FMN, rossmann fold, HF 81.22
2qv7_A 337 Diacylglycerol kinase DGKB; alpha-beta domain 1, b 80.43
3f6p_A120 Transcriptional regulatory protein YYCF; unphospho 80.41
2gkg_A127 Response regulator homolog; social motility, recei 80.11
>2dum_A Hypothetical protein PH0823; conserved hypothetical protein, putative universal protein A structural genomics, NPPSFA; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
Probab=99.97  E-value=2.7e-30  Score=171.74  Aligned_cols=155  Identities=20%  Similarity=0.214  Sum_probs=114.2

Q ss_pred             CCCCceEEEEeCCChhhHHHHHHHHhhcccCCCEEEEEEEecCCCCCccccccccC-CCCCCCCCCCCccchhhhhhcCC
Q 031168            1 MDGTRRVGVAVDFSACSKKALQWAADNVVRNGDHLILVTVVPEGGLEKGEQQLWED-SGSPLIPLAEFSEPTIMKKYGAK   79 (164)
Q Consensus         1 m~~~~~ILv~~d~s~~~~~~l~~a~~la~~~~~~l~~l~v~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~   79 (164)
                      |+++++||||+|+++.+..++++|..+|+..+++|+++||.+........ ..+.. +.........      ..+...+
T Consensus         2 ~~m~~~ILv~vD~s~~s~~al~~A~~la~~~~a~l~ll~v~~~~~~~~~~-~~~~~~~~~~~~~~~~------~~~~~~~   74 (170)
T 2dum_A            2 IFMFRKVLFPTDFSEGAYRAVEVFEKRNKMEVGEVILLHVIDEGTLEELM-DGYSFFYDNAEIELKD------IKEKLKE   74 (170)
T ss_dssp             --CCSEEEEECCSSHHHHHHHHHHHHHCCSCCSEEEEEEEEETTGGGCCC-------------CCTT------SHHHHHH
T ss_pred             ccccceEEEEecCCHHHHHHHHHHHHHHHhcCCEEEEEEEecCccccccc-cccccccccccccHHH------HHHHHHH
Confidence            34789999999999999999999999999999999999998754311000 00000 0000000001      1111112


Q ss_pred             CCchHHHHHHHHHHhcCceEEE--EEeeCChhHHHHHHhhhcCCcEEEEeecCCCccceecccchhHHHhhcCCCcEEEE
Q 031168           80 PDPETLDIVNTVARQKQIVVVM--KIFWGDPREKICEAIDKIPLSCLVIGNRGLGKLKRAIMGSVSNYVVNNGSCPVTVV  157 (164)
Q Consensus        80 ~~~~~~~~~~~~~~~~~~~~~~--~~~~g~~~~~I~~~a~~~~~dliVig~~~~~~~~~~~~gs~~~~l~~~~~~pVlvv  157 (164)
                      ..++.++.+.+.+...|+++++  .+..|++.++|+++|++.++||||||+++++.+.++++||++++|+++++||||+|
T Consensus        75 ~~~~~l~~~~~~~~~~g~~~~~~~~~~~g~~~~~I~~~a~~~~~DlIV~G~~g~~~~~~~~~Gsv~~~vl~~~~~PVlvv  154 (170)
T 2dum_A           75 EASRKLQEKAEEVKRAFRAKNVRTIIRFGIPWDEIVKVAEEENVSLIILPSRGKLSLSHEFLGSTVMRVLRKTKKPVLII  154 (170)
T ss_dssp             HHHHHHHHHHHHHHHHTTCSEEEEEEEEECHHHHHHHHHHHTTCSEEEEESCCCCC--TTCCCHHHHHHHHHCSSCEEEE
T ss_pred             HHHHHHHHHHHHHHHcCCceeeeeEEecCChHHHHHHHHHHcCCCEEEECCCCCCccccceechHHHHHHHhCCCCEEEE
Confidence            3355677777777777998887  88899999999999999999999999999999999999999999999999999999


Q ss_pred             cCCCC
Q 031168          158 KQGIH  162 (164)
Q Consensus       158 ~~~~~  162 (164)
                      |+...
T Consensus       155 ~~~~~  159 (170)
T 2dum_A          155 KEVDE  159 (170)
T ss_dssp             CCCCC
T ss_pred             ccCCc
Confidence            97654
>3tnj_A Universal stress protein (USP); structural genomics, PSI-biology, midwest center for structu genomics, MCSG, chaperone; HET: AMP; 2.00A {Nitrosomonas europaea} PDB: 2pfs_A* Back     alignment and structure
>3s3t_A Nucleotide-binding protein, universal stress PROT family; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: ATP; 1.90A {Lactobacillus plantarum} SCOP: c.26.2.0 Back     alignment and structure
>1mjh_A Protein (ATP-binding domain of protein MJ0577); hypothetical protein, structural genomics, functional assignment; HET: ATP; 1.70A {Methanocaldococcus jannaschii} SCOP: c.26.2.4 Back     alignment and structure
>3fg9_A Protein of universal stress protein USPA family; APC60691, nucleotide- binding, lactobacillus plantarum WCFS1, structural genomics PSI-2; 1.47A {Lactobacillus plantarum} Back     alignment and structure
>3hgm_A Universal stress protein TEAD; rossman fold, signaling protein; HET: ATP; 1.90A {Halomonas elongata} SCOP: c.26.2.0 Back     alignment and structure
>1tq8_A Hypothetical protein RV1636; MTCY01B2.28, structural target, NYSGXRC, PSI, protein structure initiative; 2.40A {Mycobacterium tuberculosis} SCOP: c.26.2.4 Back     alignment and structure
>3dlo_A Universal stress protein; unknown function, structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics; HET: MSE; 1.97A {Archaeoglobus fulgidus} PDB: 3qtb_A* Back     alignment and structure
>3idf_A USP-like protein; universal, stress, PSI, MCSG, structural genomics, midwest center for structural genomics structure initiative; 2.00A {Wolinella succinogenes} Back     alignment and structure
>2z08_A Universal stress protein family; uncharacterized conserved protein, structural genomics, unknown function, NPPSFA; HET: ATP; 1.55A {Thermus thermophilus} SCOP: c.26.2.4 PDB: 1wjg_A* 2z09_A* 2z3v_A Back     alignment and structure
>2gm3_A Unknown protein; AT3G01520, putative ethylene-responsive protein, USP domain, nucleotide binding domain, AMP; HET: MSE AMP; 2.46A {Arabidopsis thaliana} SCOP: c.26.2.4 Back     alignment and structure
>1jmv_A USPA, universal stress protein A; chaperone; 1.85A {Haemophilus influenzae} SCOP: c.26.2.4 Back     alignment and structure
>3fdx_A Putative filament protein / universal stress PROT; structural genomics, APC60640.1, universal protein F, PSI-2; HET: MSE ATP; 1.58A {Klebsiella pneumoniae subsp} PDB: 3fh0_A* Back     alignment and structure
>3olq_A Universal stress protein E; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: UNL; 1.82A {Proteus mirabilis} Back     alignment and structure
>3loq_A Universal stress protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: AMP; 2.32A {Archaeoglobus fulgidus} Back     alignment and structure
>3mt0_A Uncharacterized protein PA1789; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 1.58A {Pseudomonas aeruginosa} Back     alignment and structure
>3cis_A Uncharacterized protein; alpha/beta hydrolase, ATP, universal stress protein, unknown function; HET: ATP; 2.90A {Mycobacterium tuberculosis} PDB: 2jax_A* Back     alignment and structure
>3mt0_A Uncharacterized protein PA1789; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 1.58A {Pseudomonas aeruginosa} Back     alignment and structure
>3loq_A Universal stress protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: AMP; 2.32A {Archaeoglobus fulgidus} Back     alignment and structure
>1q77_A Hypothetical protein AQ_178; structural genomics, universal stress protein, PSI, protein structure initiative; 2.70A {Aquifex aeolicus} SCOP: c.26.2.4 Back     alignment and structure
>3ab8_A Putative uncharacterized protein TTHA0350; tandem-type universal stress protein, unknown function; HET: ATP; 1.70A {Thermus thermophilus} PDB: 3ab7_A* Back     alignment and structure
>3olq_A Universal stress protein E; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: UNL; 1.82A {Proteus mirabilis} Back     alignment and structure
>3cis_A Uncharacterized protein; alpha/beta hydrolase, ATP, universal stress protein, unknown function; HET: ATP; 2.90A {Mycobacterium tuberculosis} PDB: 2jax_A* Back     alignment and structure
>3ab8_A Putative uncharacterized protein TTHA0350; tandem-type universal stress protein, unknown function; HET: ATP; 1.70A {Thermus thermophilus} PDB: 3ab7_A* Back     alignment and structure
>2iel_A Hypothetical protein TT0030; TT0030,thermus thermophilus, structural genomics, PSI, protein structure initiative; 1.60A {Thermus thermophilus} SCOP: c.26.2.4 Back     alignment and structure
>1wy5_A TILS, hypothetical UPF0072 protein AQ_1887; N-type ATP-ppase, structural genomics, translation, NPPSFA; 2.42A {Aquifex aeolicus} SCOP: c.26.2.5 d.229.1.1 PDB: 2e21_A* 2e89_A* Back     alignment and structure
>3a2k_A TRNA(Ile)-lysidine synthase; ligase, pseudo-knot, ligase/RNA complex; 3.65A {Geobacillus kaustophilus} Back     alignment and structure
>3g40_A Na-K-CL cotransporter; alpha/beta fold 10-stranded twisted beta sheet, transport protein; 1.90A {Methanosarcina acetivorans} Back     alignment and structure
>4b4k_A N5-carboxyaminoimidazole ribonucleotide mutase; isomerase; 2.50A {Bacillus anthracis} Back     alignment and structure
>1zun_A Sulfate adenylyltransferase subunit 2; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae} SCOP: c.26.2.2 Back     alignment and structure
>3oow_A Phosphoribosylaminoimidazole carboxylase,catalyic; structural genomics, center for structural genomics of infec diseases, csgid; HET: MSE; 1.75A {Francisella tularensis subsp} SCOP: c.23.8.1 PDB: 3opq_A* Back     alignment and structure
>3ih5_A Electron transfer flavoprotein alpha-subunit; alpha-beta-alpha sandwich, structural genomics, PSI-2, protein structure initiative; 2.60A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ywx_A Phosphoribosylaminoimidazole carboxylase catalyti; rossmann fold, structural genomics, NPPSFA; 2.31A {Methanocaldococcus jannaschii} Back     alignment and structure
>3trh_A Phosphoribosylaminoimidazole carboxylase carboxyltransferase subunit; purines, pyrimidines, nucleosides, nucleotides, lyase; 2.20A {Coxiella burnetii} Back     alignment and structure
>4grd_A N5-CAIR mutase, phosphoribosylaminoimidazole carboxylase catalyti; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures; 1.85A {Burkholderia cenocepacia} Back     alignment and structure
>3g40_A Na-K-CL cotransporter; alpha/beta fold 10-stranded twisted beta sheet, transport protein; 1.90A {Methanosarcina acetivorans} Back     alignment and structure
>3kuu_A Phosphoribosylaminoimidazole carboxylase catalyti PURE; 3-layer (ABA) sandwich, rossmann fold, csgid, lyase, structu genomics; 1.41A {Yersinia pestis} SCOP: c.23.8.1 PDB: 1d7a_A* 1qcz_A 2ate_A* 2nsl_A* 2nsh_A* 2nsj_A* Back     alignment and structure
>1xmp_A PURE, phosphoribosylaminoimidazole carboxylase; purine biosynthesis, spine, lyase; 1.80A {Bacillus anthracis} SCOP: c.23.8.1 Back     alignment and structure
>3ors_A N5-carboxyaminoimidazole ribonucleotide mutase; isomerase, isomerase,biosynthetic protein; 1.45A {Staphylococcus aureus subsp} Back     alignment and structure
>1k92_A Argininosuccinate synthase, argininosuccinate SY; N-type ATP pyrophosphatase, ligase; 1.60A {Escherichia coli} SCOP: c.26.2.1 d.210.1.1 PDB: 1k97_A* 1kp2_A* 1kp3_A* Back     alignment and structure
>3lp6_A Phosphoribosylaminoimidazole carboxylase catalyti; alpha and beta protein, structural genomics, PSI-2, protein initiative; 1.70A {Mycobacterium tuberculosis} SCOP: c.23.8.0 Back     alignment and structure
>1o4v_A Phosphoribosylaminoimidazole mutase PURE; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; 1.77A {Thermotoga maritima} SCOP: c.23.8.1 Back     alignment and structure
>1o97_C Electron transferring flavoprotein beta-subunit; FAD binding; HET: AMP FAD; 1.6A {Methylophilus methylotrophus} SCOP: c.26.2.3 PDB: 1o95_C* 1o96_A* 1o94_C* 3clr_C* 3cls_C* 3clt_C* 3clu_C* Back     alignment and structure
>2nz2_A Argininosuccinate synthase; amino-acid biosynthesis, aspartate, citrulline, ST genomics, structural genomics consortium, SGC, ligase; HET: CIR; 2.40A {Homo sapiens} Back     alignment and structure
>3kcq_A Phosphoribosylglycinamide formyltransferase; structural genomics, niaid, seattle structural center for infectious disease, ssgcid; 2.20A {Anaplasma phagocytophilum} SCOP: c.65.1.0 Back     alignment and structure
>3k32_A Uncharacterized protein MJ0690; predicted subunit of tRNA methyltransferase, methanocaldococcus jannaschii DSM , PSI- 2; 2.50A {Methanocaldococcus jannaschii} Back     alignment and structure
>2xry_A Deoxyribodipyrimidine photolyase; DNA damage, DNA repair; HET: FAD; 1.50A {Methanosarcina mazei} PDB: 2xrz_A* Back     alignment and structure
>1ni5_A Putative cell cycle protein MESJ; structural genomics, ATPase, PP-type, putative cell cycle PR PSI, protein structure initiative; 2.65A {Escherichia coli} SCOP: b.153.1.2 c.26.2.5 d.229.1.1 Back     alignment and structure
>1u11_A PURE (N5-carboxyaminoimidazole ribonucleotide MUT; acidophIle, protein stability, lyase; HET: CIT; 1.55A {Acetobacter aceti} SCOP: c.23.8.1 PDB: 2fwj_A* 2fw1_A* 2fwb_A 2fwa_A 2fw9_A 2fw7_A 2fw6_A 2fwp_A* 2fwi_A* 2fw8_A Back     alignment and structure
>1sur_A PAPS reductase; assimilatory sulfate reduction, 3-phospho-adenylyl-sulfate reductase, oxidoreductase; 2.00A {Escherichia coli} SCOP: c.26.2.2 Back     alignment and structure
>3rg8_A Phosphoribosylaminoimidazole carboxylase, PURE PR; purine biosynthesis, lyase; 1.74A {Treponema denticola} SCOP: c.23.8.0 PDB: 3rgg_A* Back     alignment and structure
>1efp_B ETF, protein (electron transfer flavoprotein); electron transport, glutaric acidemia type II; HET: FAD AMP; 2.60A {Paracoccus denitrificans} SCOP: c.26.2.3 Back     alignment and structure
>3rjz_A N-type ATP pyrophosphatase superfamily; structural genomics, PSI-biology, northeast structural genom consortium, NESG, alpha-beta protein; 2.30A {Pyrococcus furiosus} SCOP: c.26.2.1 PDB: 3h7e_A 3rk0_A* 3rk1_A* 1ru8_A 2d13_A Back     alignment and structure
>1efv_B Electron transfer flavoprotein; electron transport, glutaric acidemia type II; HET: FAD AMP; 2.10A {Homo sapiens} SCOP: c.26.2.3 PDB: 1t9g_S* 2a1u_B* 2a1t_S* Back     alignment and structure
>3zqu_A Probable aromatic acid decarboxylase; lyase; HET: FNR; 1.50A {Pseudomonas aeruginosa} SCOP: c.34.1.0 Back     alignment and structure
>2oq2_A Phosphoadenosine phosphosulfate reductase; sulfate reduction, PAPS reductase, oxidoreductase; HET: A3P; 2.10A {Saccharomyces cerevisiae} Back     alignment and structure
>3bl5_A Queuosine biosynthesis protein QUEC; PREQ1 biosynthesis, RNA modification, tRNA, hydrolase; 2.95A {Bacillus subtilis} Back     alignment and structure
>1np7_A DNA photolyase; protein with FAD cofactor; HET: DNA FAD; 1.90A {Synechocystis SP} SCOP: a.99.1.1 c.28.1.1 Back     alignment and structure
>3umv_A Deoxyribodipyrimidine photo-lyase; CPD cyclobutane pyrimidine dimers, UV damaged DNA, DNA repai flavoprotein; HET: FAD; 1.71A {Oryza sativa japonica group} Back     alignment and structure
>3p9x_A Phosphoribosylglycinamide formyltransferase; structural genomics, PSI-biology, protein STRU initiative; 1.90A {Bacillus halodurans} Back     alignment and structure
>2hma_A Probable tRNA (5-methylaminomethyl-2-thiouridylat methyltransferase; alpha-beta, beta barrel, structural genomics, PSI-2; HET: MSE SAM; 2.41A {Streptococcus pneumoniae} Back     alignment and structure
>4ds3_A Phosphoribosylglycinamide formyltransferase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.85A {Brucella melitensis BV} Back     alignment and structure
>2ywb_A GMP synthase [glutamine-hydrolyzing]; GMP synthetase, XMP binding, ATP binding, purine nucleotide biosynthetic pathway, structural genomics; 2.10A {Thermus thermophilus} PDB: 2ywc_A* Back     alignment and structure
>1iv0_A Hypothetical protein; rnaseh-like, YQGF, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Thermus thermophilus} SCOP: c.55.3.8 Back     alignment and structure
>2wsi_A FAD synthetase; transferase, nucleotidyltransferase, nucleotide-binding; HET: FAD; 1.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3tqi_A GMP synthase [glutamine-hydrolyzing]; ligase; 2.84A {Coxiella burnetii} Back     alignment and structure
>2wq7_A RE11660P; lyase-DNA complex, DNA repair, DNA lesion, lyase; HET: TDY Z FAD; 2.00A {Drosophila melanogaster} PDB: 2wb2_A* 2wq6_A* 3cvu_A* 3cvv_A* 3cvy_A* 3cvw_A* 3cvx_A* Back     alignment and structure
>3da8_A Probable 5'-phosphoribosylglycinamide formyltransferase PURN; glycinamide ribonucleotide transformylase, structure; 1.30A {Mycobacterium tuberculosis} PDB: 3dcj_A* Back     alignment and structure
>2c5s_A THII, probable thiamine biosynthesis protein THII; RNA-binding protein, RNA binding protein, tRNA modification, 4-thiouridine synthase; HET: AMP; 2.5A {Bacillus anthracis} SCOP: c.26.2.6 d.308.1.1 Back     alignment and structure
>1kor_A Argininosuccinate synthetase; ligase, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: ANP ARG; 1.95A {Thermus thermophilus} SCOP: c.26.2.1 d.210.1.1 PDB: 1j1z_A* 1j21_A* 1kh1_A 1kh2_A* 1kh3_A* 1j20_A* Back     alignment and structure
>3lqk_A Dipicolinate synthase subunit B; flavoprotein, PSI2, MCSG, structural protein structure initiative, midwest center for structural genomics; 2.10A {Bacillus halodurans} Back     alignment and structure
>3fy4_A 6-4 photolyase; DNA repair, clock cryptochrome; HET: MES FAD; 2.70A {Arabidopsis thaliana} Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>2h31_A Multifunctional protein ADE2; alpha-beta-alpha, ligase, lyase; 2.80A {Homo sapiens} Back     alignment and structure
>2dpl_A GMP synthetase, GMP synthase [glutamine-hydrolyzing] subunit B; pyrococcus horikoshii OT3, structural genomics, NPPSFA; 1.43A {Pyrococcus horikoshii} PDB: 2z0c_A 3a4i_A Back     alignment and structure
>2o8v_A Phosphoadenosine phosphosulfate reductase; disulfide crosslinked complex, oxidoreductase; 3.00A {Escherichia coli} Back     alignment and structure
>2pg3_A Queuosine biosynthesis protein QUEC; YP_049261.1, hypothetical protein, structural genomics, JOIN for structural genomics; 2.40A {Pectobacterium atrosepticum SCRI1043} SCOP: c.26.2.1 Back     alignment and structure
>2der_A TRNA-specific 2-thiouridylase MNMA; protein-RNA complex, transferase/RNA complex; 3.10A {Escherichia coli} PDB: 2det_A 2deu_A* Back     alignment and structure
>1g63_A Epidermin modifying enzyme EPID; alpha, beta protein, rossmann like fold, oxidoreductase; HET: FMN; 2.50A {Staphylococcus epidermidis} SCOP: c.34.1.1 PDB: 1g5q_A* Back     alignment and structure
>2ywr_A Phosphoribosylglycinamide formyltransferase; rossmann fold, structural genomics, NPPSFA; 1.77A {Aquifex aeolicus} Back     alignment and structure
>1vl2_A Argininosuccinate synthase; TM1780, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics, ligase; 1.65A {Thermotoga maritima} SCOP: c.26.2.1 d.210.1.1 Back     alignment and structure
>1ccw_A Protein (glutamate mutase); coenzyme B12, radical reaction, TIM-barrel rossman-fold, isomerase; HET: CNC TAR; 1.60A {Clostridium cochlearium} SCOP: c.23.6.1 PDB: 1cb7_A* 1b1a_A 1i9c_A* 1be1_A 1fmf_A 1id8_A* Back     alignment and structure
>3tqr_A Phosphoribosylglycinamide formyltransferase; purines, pyrimidines, nucleosides, nucleotides; HET: NHE; 1.97A {Coxiella burnetii} SCOP: c.65.1.0 Back     alignment and structure
>1vbk_A Hypothetical protein PH1313; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 1.90A {Pyrococcus horikoshii} SCOP: c.26.2.6 d.308.1.1 Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>2ejb_A Probable aromatic acid decarboxylase; phenylacrylic acid decarboxylase, X-RAY diffraction, structural genomics, NPPSFA; 2.15A {Aquifex aeolicus} Back     alignment and structure
>3dff_A Teicoplanin pseudoaglycone deacetylases ORF2; lipoglycopeptide, zinc dependen hydrolase; HET: MSE PG4; 1.60A {Actinoplanes teichomyceticus} PDB: 2x9l_A* 3dfk_A* 3dfm_A 2xad_A* Back     alignment and structure
>3qjg_A Epidermin biosynthesis protein EPID; structural genomics, center for structural genomics of infec diseases, csgid, oxidoreductase; HET: FMN; 2.04A {Staphylococcus aureus} SCOP: c.34.1.0 Back     alignment and structure
>3o1l_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 2.20A {Pseudomonas syringae PV} Back     alignment and structure
>4f3r_A Phosphopantetheine adenylyltransferase; phosphopantetheine adenylyltranferase; 2.25A {Coxiella burnetii} Back     alignment and structure
>2l69_A Rossmann 2X3 fold protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Artificial gene} Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>3q0i_A Methionyl-tRNA formyltransferase; structural genomics, center for structural genomics of infec diseases, csgid; 1.89A {Vibrio cholerae} Back     alignment and structure
>1p3y_1 MRSD protein; flavoprotein, FMN, rossmann fold, HFCD family, oxdidative decarboxylation, cystein, lantibiotics, mersacidin, oxidore; HET: FAD; 2.54A {Bacillus SP} SCOP: c.34.1.1 Back     alignment and structure
>2qv7_A Diacylglycerol kinase DGKB; alpha-beta domain 1, beta sandwich domain 2, protein-ADP COM transferase; HET: ADP; 2.30A {Staphylococcus aureus} SCOP: e.52.1.2 PDB: 2qvl_A Back     alignment and structure
>3f6p_A Transcriptional regulatory protein YYCF; unphosphorelated, receiver domain, cytoplasm, DNA-binding, phosphoprotein, transcription regulation; 1.95A {Bacillus subtilis} SCOP: c.23.1.1 PDB: 2zwm_A Back     alignment and structure
>2gkg_A Response regulator homolog; social motility, receiver domain, signalling, high resolutio signaling protein; 1.00A {Myxococcus xanthus} PDB: 2i6f_A 2nt4_A 2nt3_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 164
d2gm3a1171 c.26.2.4 (A:5-175) Putative ethylene-responsive pr 3e-27
d1mjha_160 c.26.2.4 (A:) "Hypothetical" protein MJ0577 {Archa 5e-24
d1tq8a_147 c.26.2.4 (A:) Hypothetical protein Rv1636 {Mycobac 2e-21
d2z3va1135 c.26.2.4 (A:2-136) Hypothetical protein TTHA0895 { 2e-20
d1jmva_140 c.26.2.4 (A:) Universal stress protein A, UspA {Ha 1e-16
d1q77a_138 c.26.2.4 (A:) Hypothetical protein Aq_178 {Aquifex 3e-10
>d2gm3a1 c.26.2.4 (A:5-175) Putative ethylene-responsive protein AT3g01520/F4P13_7 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 171 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Adenine nucleotide alpha hydrolase-like
superfamily: Adenine nucleotide alpha hydrolases-like
family: Universal stress protein-like
domain: Putative ethylene-responsive protein AT3g01520/F4P13 7
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

 Score = 98.0 bits (243), Expect = 3e-27
 Identities = 38/169 (22%), Positives = 78/169 (46%), Gaps = 15/169 (8%)

Query: 5   RRVGVAVDFS---------ACSKKALQWAADNVVRNGDHLILVTVVPEGGLEKGEQQLWE 55
            +V VAV+ S            K+A +W  + +VR+      + ++    ++  ++  ++
Sbjct: 2   TKVMVAVNASTIKDYPNPSISCKRAFEWTLEKIVRSNTSDFKILLLH---VQVVDEDGFD 58

Query: 56  DSGSPLIPLAEFSEPTIMKKYGAKPDPETLDIVNTVARQKQIVVVMKIFWGDPREKICEA 115
           D  S      +F +   M++         L+       +  +     I  GDP++ IC+ 
Sbjct: 59  DVDSIYASPEDFRD---MRQSNKAKGLHLLEFFVNKCHEIGVGCEAWIKTGDPKDVICQE 115

Query: 116 IDKIPLSCLVIGNRGLGKLKRAIMGSVSNYVVNNGSCPVTVVKQGIHET 164
           + ++    LV+G+RGLG+ ++  +G+VS + V +  CPV  +K+   ET
Sbjct: 116 VKRVRPDFLVVGSRGLGRFQKVFVGTVSAFCVKHAECPVMTIKRNADET 164
>d1mjha_ c.26.2.4 (A:) "Hypothetical" protein MJ0577 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 160 Back     information, alignment and structure
>d1tq8a_ c.26.2.4 (A:) Hypothetical protein Rv1636 {Mycobacterium tuberculosis [TaxId: 1773]} Length = 147 Back     information, alignment and structure
>d2z3va1 c.26.2.4 (A:2-136) Hypothetical protein TTHA0895 {Thermus thermophilus [TaxId: 274]} Length = 135 Back     information, alignment and structure
>d1jmva_ c.26.2.4 (A:) Universal stress protein A, UspA {Haemophilus influenzae [TaxId: 727]} Length = 140 Back     information, alignment and structure
>d1q77a_ c.26.2.4 (A:) Hypothetical protein Aq_178 {Aquifex aeolicus [TaxId: 63363]} Length = 138 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query164
d1mjha_160 "Hypothetical" protein MJ0577 {Archaeon Methanococ 100.0
d1tq8a_147 Hypothetical protein Rv1636 {Mycobacterium tubercu 99.97
d2z3va1135 Hypothetical protein TTHA0895 {Thermus thermophilu 99.96
d2gm3a1171 Putative ethylene-responsive protein AT3g01520/F4P 99.96
d1jmva_140 Universal stress protein A, UspA {Haemophilus infl 99.95
d1q77a_138 Hypothetical protein Aq_178 {Aquifex aeolicus [Tax 99.91
d1wy5a1216 TilS-like protein Aq_1887 {Aquifex aeolicus [TaxId 97.15
d3clsc1 262 Small, beta subunit of electron transfer flavoprot 96.64
d1ni5a1227 tRNA-Ile-lysidine synthetase, TilS, N-terminal dom 96.4
d1efpb_246 Small, beta subunit of electron transfer flavoprot 96.3
d1np7a2204 Cryptochrome {Synechocystis sp., pcc 6803 [TaxId: 95.67
d1u11a_159 N5-CAIR mutase (phosphoribosylaminoimidazole carbo 95.59
d1xmpa_155 N5-CAIR mutase (phosphoribosylaminoimidazole carbo 95.45
d1qcza_163 N5-CAIR mutase (phosphoribosylaminoimidazole carbo 95.36
d1o4va_169 N5-CAIR mutase (phosphoribosylaminoimidazole carbo 95.15
d1efvb_252 Small, beta subunit of electron transfer flavoprot 95.01
d1ls1a2207 GTPase domain of the signal sequence recognition p 94.72
d2a9pa1117 DNA-binding response regulator MicA, N-terminal do 93.98
d1p3y1_183 MrsD {Bacillus sp. hil-y85/54728 [TaxId: 69002]} 93.21
d3clsd1192 Large, alpha subunit of electron transfer flavopro 93.04
d2qy9a2211 GTPase domain of the signal recognition particle r 92.42
d1xhfa1121 Aerobic respiration control protein ArcA, N-termin 92.01
d1vmaa2213 GTPase domain of the signal recognition particle r 91.8
d1w25a1139 Response regulator PleD, receiver domain {Caulobac 90.64
d1owla2202 DNA photolyase {Synechococcus elongatus [TaxId: 32 90.3
d2c5sa1218 Thiamine biosynthesis protein ThiI, C-terminal dom 90.09
d1j8yf2211 GTPase domain of the signal sequence recognition p 89.96
d1okkd2207 GTPase domain of the signal recognition particle r 89.71
d1zh2a1119 Transcriptional regulatory protein KdpE, N-termina 88.89
d1ccwa_137 Glutamate mutase, small subunit {Clostridium cochl 88.52
d1vbka1132 Hypothetical protein PH1313, C-terminal domain {Ar 88.47
d1s8na_ 190 Probable two-component system transcriptional regu 87.8
d1qzua_181 4'-phosphopantothenoylcysteine decarboxylase (PPC 87.78
d1xkya1 292 Dihydrodipicolinate synthase {Bacillus anthracis [ 87.63
d2pjua1 186 Propionate catabolism operon regulatory protein Pr 87.58
d2bona1 295 Lipid kinase YegS {Escherichia coli [TaxId: 562]} 87.21
d1ycga1149 Nitric oxide reductase C-terminal domain {Moorella 86.85
d1mb3a_123 Cell division response regulator DivK {Caulobacter 86.28
d1zesa1121 PhoB receiver domain {Escherichia coli [TaxId: 562 86.28
d1uana_227 Hypothetical protein TT1542 {Thermus thermophilus 86.12
d2j07a2170 DNA photolyase {Thermus thermophilus [TaxId: 274]} 84.48
d1gsoa2105 Glycinamide ribonucleotide synthetase (GAR-syn), N 84.31
d1zuna1211 Sulfate adenylyltransferase subunit 2, CysD {Pseud 83.44
d7reqa2168 Methylmalonyl-CoA mutase alpha subunit, C-terminal 83.14
d2d13a1226 Hypothetical protein PH1257 {Archaeon Pyrococcus h 82.95
d1krwa_123 NTRC receiver domain {Salmonella typhimurium [TaxI 82.47
d1nu0a_138 Hypothetical protein YqgF (RuvX) {Escherichia coli 81.8
d2c4va1158 Type II 3-dehydroquinate dehydratase {Helicobacter 81.61
d1e5da1152 Rubredoxin oxygen:oxidoreductase (ROO), C-terminal 81.21
d1ys7a2121 Transcriptional regulatory protein PrrA, N-termina 80.71
d3bzka5149 Transcriptional accessory factor Tex {Pseudomonas 80.27
>d1mjha_ c.26.2.4 (A:) "Hypothetical" protein MJ0577 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Adenine nucleotide alpha hydrolase-like
superfamily: Adenine nucleotide alpha hydrolases-like
family: Universal stress protein-like
domain: "Hypothetical" protein MJ0577
species: Archaeon Methanococcus jannaschii [TaxId: 2190]

Probab=100.00  E-value=7.9e-34  Score=185.61  Aligned_cols=159  Identities=19%  Similarity=0.231  Sum_probs=120.7

Q ss_pred             CCCceEEEEeCCChhhHHHHHHHHhhcccCCCEEEEEEEecCCCCCccccccccCCCCCCCCCCCCccchhhhhhcCCCC
Q 031168            2 DGTRRVGVAVDFSACSKKALQWAADNVVRNGDHLILVTVVPEGGLEKGEQQLWEDSGSPLIPLAEFSEPTIMKKYGAKPD   81 (164)
Q Consensus         2 ~~~~~ILv~~d~s~~~~~~l~~a~~la~~~~~~l~~l~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   81 (164)
                      |||||||||+|+|+.+..++++|..+|+..+++|+++||.++....... ......+................+...+..
T Consensus         1 ~m~~~ILvavD~s~~s~~al~~a~~la~~~~a~l~llhV~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   79 (160)
T d1mjha_           1 VMYKKILYPTDFSETAEIALKHVKAFKTLKAEEVILLHVIDEREIKKRD-IFSLLLGVAGLNKSVEEFENELKNKLTEEA   79 (160)
T ss_dssp             CCCCEEEEECCSCHHHHHHHHHHHHTCCSSCCEEEEEEEEEGGGTC------------------CHHHHHHHHHHHHHHH
T ss_pred             CCcCeEEEEECCCHHHHHHHHHHHHHHHhcCCEEEEEEecccccccccc-cccccccccccchhHHHHHHHHHHHHHHHH
Confidence            5799999999999999999999999999999999999998765432111 000000000000000000112222223344


Q ss_pred             chHHHHHHHHHHhcCceEEEEEeeCChhHHHHHHhhhcCCcEEEEeecCCCccceecccchhHHHhhcCCCcEEEEcCCC
Q 031168           82 PETLDIVNTVARQKQIVVVMKIFWGDPREKICEAIDKIPLSCLVIGNRGLGKLKRAIMGSVSNYVVNNGSCPVTVVKQGI  161 (164)
Q Consensus        82 ~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~I~~~a~~~~~dliVig~~~~~~~~~~~~gs~~~~l~~~~~~pVlvv~~~~  161 (164)
                      ++.++.+...+...|++++.++..|++.+.|++++++.++||||||+++++.+.++++||++++|+++++||||+||++.
T Consensus        80 ~~~l~~~~~~~~~~gv~~~~~~~~G~~~~~I~~~a~~~~~dliV~G~~~~~~~~~~~~GS~a~~vl~~s~~pVlvV~~~~  159 (160)
T d1mjha_          80 KNKMENIKKELEDVGFKVKDIIVVGIPHEEIVKIAEDEGVDIIIMGSHGKTNLKEILLGSVTENVIKKSNKPVLVVKRKN  159 (160)
T ss_dssp             HHHHHHHHHHHHHTTCEEEEEEEEECHHHHHHHHHHHTTCSEEEEESCCSSCCTTCSSCHHHHHHHHHCCSCEEEECCCC
T ss_pred             HHHHHHHHHHHHhcCCeEEEEEEeccHHHHHhhhhhccccceEEeccCCCCcccccccCcHHHHHHhcCCCCEEEEcCCC
Confidence            66777777888889999999999999999999999999999999999999999999999999999999999999999864
>d1tq8a_ c.26.2.4 (A:) Hypothetical protein Rv1636 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2z3va1 c.26.2.4 (A:2-136) Hypothetical protein TTHA0895 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2gm3a1 c.26.2.4 (A:5-175) Putative ethylene-responsive protein AT3g01520/F4P13_7 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1jmva_ c.26.2.4 (A:) Universal stress protein A, UspA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1q77a_ c.26.2.4 (A:) Hypothetical protein Aq_178 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1wy5a1 c.26.2.5 (A:1-216) TilS-like protein Aq_1887 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d3clsc1 c.26.2.3 (C:1-262) Small, beta subunit of electron transfer flavoprotein ETFP {Methylophilus methylotrophus [TaxId: 17]} Back     information, alignment and structure
>d1ni5a1 c.26.2.5 (A:0-226) tRNA-Ile-lysidine synthetase, TilS, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1efpb_ c.26.2.3 (B:) Small, beta subunit of electron transfer flavoprotein ETFP {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1np7a2 c.28.1.1 (A:1-204) Cryptochrome {Synechocystis sp., pcc 6803 [TaxId: 1143]} Back     information, alignment and structure
>d1u11a_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Acetobacter aceti [TaxId: 435]} Back     information, alignment and structure
>d1xmpa_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Bacillus anthracis [TaxId: 1392]} Back     information, alignment and structure
>d1qcza_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o4va_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1efvb_ c.26.2.3 (B:) Small, beta subunit of electron transfer flavoprotein ETFP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2a9pa1 c.23.1.1 (A:2-118) DNA-binding response regulator MicA, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1p3y1_ c.34.1.1 (1:) MrsD {Bacillus sp. hil-y85/54728 [TaxId: 69002]} Back     information, alignment and structure
>d3clsd1 c.26.2.3 (D:1-192) Large, alpha subunit of electron transfer flavoprotein ETFP, N-terminal domain {Methylophilus methylotrophus [TaxId: 17]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xhfa1 c.23.1.1 (A:2-122) Aerobic respiration control protein ArcA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1w25a1 c.23.1.1 (A:2-140) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]} Back     information, alignment and structure
>d1owla2 c.28.1.1 (A:3-204) DNA photolyase {Synechococcus elongatus [TaxId: 32046]} Back     information, alignment and structure
>d2c5sa1 c.26.2.6 (A:174-391) Thiamine biosynthesis protein ThiI, C-terminal domain {Bacillus anthracis [TaxId: 1392]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1zh2a1 c.23.1.1 (A:2-120) Transcriptional regulatory protein KdpE, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ccwa_ c.23.6.1 (A:) Glutamate mutase, small subunit {Clostridium cochlearium [TaxId: 1494]} Back     information, alignment and structure
>d1vbka1 c.26.2.6 (A:176-307) Hypothetical protein PH1313, C-terminal domain {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1s8na_ c.23.1.1 (A:) Probable two-component system transcriptional regulator Rv1626 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1qzua_ c.34.1.1 (A:) 4'-phosphopantothenoylcysteine decarboxylase (PPC decarboxylase, halotolerance protein Hal3a) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkya1 c.1.10.1 (A:1-292) Dihydrodipicolinate synthase {Bacillus anthracis [TaxId: 1392]} Back     information, alignment and structure
>d2pjua1 c.92.3.1 (A:11-196) Propionate catabolism operon regulatory protein PrpR {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bona1 e.52.1.2 (A:5-299) Lipid kinase YegS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ycga1 c.23.5.1 (A:251-399) Nitric oxide reductase C-terminal domain {Moorella thermoacetica [TaxId: 1525]} Back     information, alignment and structure
>d1mb3a_ c.23.1.1 (A:) Cell division response regulator DivK {Caulobacter crescentus [TaxId: 155892]} Back     information, alignment and structure
>d1zesa1 c.23.1.1 (A:3-123) PhoB receiver domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uana_ c.134.1.1 (A:) Hypothetical protein TT1542 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2j07a2 c.28.1.1 (A:2-171) DNA photolyase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1zuna1 c.26.2.2 (A:1-211) Sulfate adenylyltransferase subunit 2, CysD {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d7reqa2 c.23.6.1 (A:561-728) Methylmalonyl-CoA mutase alpha subunit, C-terminal domain {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} Back     information, alignment and structure
>d2d13a1 c.26.2.1 (A:2-227) Hypothetical protein PH1257 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1krwa_ c.23.1.1 (A:) NTRC receiver domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1nu0a_ c.55.3.8 (A:) Hypothetical protein YqgF (RuvX) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2c4va1 c.23.13.1 (A:1-158) Type II 3-dehydroquinate dehydratase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1e5da1 c.23.5.1 (A:251-402) Rubredoxin oxygen:oxidoreductase (ROO), C-terminal domain {Desulfovibrio gigas [TaxId: 879]} Back     information, alignment and structure
>d1ys7a2 c.23.1.1 (A:7-127) Transcriptional regulatory protein PrrA, N-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d3bzka5 c.55.3.13 (A:325-473) Transcriptional accessory factor Tex {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure