Citrus Sinensis ID: 031195

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160----
MAGDRKIGVALDFSPSSKFALSWAVNNLLDKGDTLYIIHINPNSLDESRNLMWAKSGSPLIPLTEFREPETMEKYNVKTDIDALDLLDTASRQKEANIVAKIYWGDARERLLEAIEDLKLDSLVMGSRGLGTVRRIILGSVSNYVMTHAPCPVTIVKDPSFGKH
cccccEEEEEEcccHHHHHHHHHHHHHHHccccEEEEEEEEccccccHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEccHHHHHHHHHHHccccEEEEcccccccccccEEccHHHHHHccccccEEEEEccccccc
cccccEEEEEEcccHHHHHHHHHHHHHHHccccEEEEEEEEcccccccccccccccccccccccccHHHHHHHHHHHcccHHHHHHHHHHHHHcccEEEEEEEEccHHHHHHHHHHHccccEEEEEcccccHHHEEEEccccHHHHccccccEEEEEcccHccc
magdrkigvaldfspsskFALSWAVNNlldkgdtlyiihinpnsldesrnlmwaksgsplipltefrepetmekynvktdidaldLLDTASRQKEANIVAKIYWGDARERLLEAIEDLKLDSLVMGSRGLGTVRRIILGSVSnyvmthapcpvtivkdpsfgkh
magdrkigvaldfspsskFALSWAVNNLLDKGDTLYIIHINPNSLDESRNLMWAKSGSPLIPLTEFREPETMEKYNVKTDIDALDLLDTASRQKEANIVAKIYWGDARERLLEAIEDLKLDSLVMGSRGLGTVRRIILGSVsnyvmthapcpvtivkdpsfgkh
MAGDRKIGVALDFSPSSKFALSWAVNNLLDKGDTLYIIHINPNSLDESRNLMWAKSGSPLIPLTEFREPETMEKYNVKtdidaldlldtaSRQKEANIVAKIYWGDARERLLEAIEDLKLDSLVMGSRGLGTVRRIILGSVSNYVMTHAPCPVTIVKDPSFGKH
********VALDFSPSSKFALSWAVNNLLDKGDTLYIIHINPNSLDESRNLMWAKSGSPLIPLTEFR****MEKYNVKTDIDALDLLDTASRQKEANIVAKIYWGDARERLLEAIEDLKLDSLVMGSRGLGTVRRIILGSVSNYVMTHAPCPVTIV********
*AGDRKIGVALDFSPSSKFALSWAVNNLLDKGDTLYIIHINPNSLDESRNLMWAKSGSPLIPLTEFREPETMEKYNVKTDIDALDLLDTASRQKEANIVAKIYWGDARERLLEAIEDLKLDSLVMGSRGLGTVRRIILGSVSNYVMTHAPCPV****D******
MAGDRKIGVALDFSPSSKFALSWAVNNLLDKGDTLYIIHINPNSLDESRNLMWAKSGSPLIPLTEFREPETMEKYNVKTDIDALDLLDTASRQKEANIVAKIYWGDARERLLEAIEDLKLDSLVMGSRGLGTVRRIILGSVSNYVMTHAPCPVTIVKDPSFGKH
***DRKIGVALDFSPSSKFALSWAVNNLLDKGDTLYIIHINPNSLDESRNLMWAKSGSPLIPLTEFREPETMEKYNVKTDIDALDLLDTASRQKEANIVAKIYWGDARERLLEAIEDLKLDSLVMGSRGLGTVRRIILGSVSNYVMTHAPCPVTIVKDP*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAGDRKIGVALDFSPSSKFALSWAVNNLLDKGDTLYIIHINPNSLDESRNLMWAKSGSPLIPLTEFREPETMEKYNVKTDIDALDLLDTASRQKEANIVAKIYWGDARERLLEAIEDLKLDSLVMGSRGLGTVRRIILGSVSNYVMTHAPCPVTIVKDPSFGKH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query164 2.2.26 [Sep-21-2011]
Q8LGG8175 Universal stress protein no no 0.810 0.76 0.24 3e-07
P87132601 Uncharacterized protein C yes no 0.798 0.217 0.300 1e-06
P74897137 Universal stress protein N/A no 0.353 0.423 0.448 4e-06
Q57951170 Universal stress protein yes no 0.304 0.294 0.44 8e-05
Q4L751165 Putative universal stress yes no 0.426 0.424 0.309 0.0001
P42297148 Universal stress protein yes no 0.865 0.959 0.251 0.0002
P0A5F8 317 Universal stress protein yes no 0.853 0.441 0.245 0.0005
P0A5F7 317 Universal stress protein yes no 0.853 0.441 0.245 0.0005
Q8CS61166 Putative universal stress yes no 0.25 0.246 0.439 0.0007
Q5HNJ5166 Putative universal stress yes no 0.25 0.246 0.439 0.0007
>sp|Q8LGG8|USPAL_ARATH Universal stress protein A-like protein OS=Arabidopsis thaliana GN=At3g01520 PE=1 SV=2 Back     alignment and function desciption
 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 36/150 (24%), Positives = 71/150 (47%), Gaps = 17/150 (11%)

Query: 14  SPSSKFALSWAVNNLLDKGDT------LYIIHINPNSLDESRNLMWAKSGSPLIPLTEFR 67
           S S K A  W +  ++    +      L++  ++ +  D+  ++      SP     +FR
Sbjct: 24  SISCKRAFEWTLEKIVRSNTSDFKILLLHVQVVDEDGFDDVDSIY----ASP----EDFR 75

Query: 68  EPETMEKYNVKTDIDALDLLDTASRQKEANIVAKIYWGDARERLLEAIEDLKLDSLVMGS 127
           +   M + N    +  L+       +      A I  GD ++ + + ++ ++ D LV+GS
Sbjct: 76  D---MRQSNKAKGLHLLEFFVNKCHEIGVGCEAWIKTGDPKDVICQEVKRVRPDFLVVGS 132

Query: 128 RGLGTVRRIILGSVSNYVMTHAPCPVTIVK 157
           RGLG  +++ +G+VS + + HA CPV  +K
Sbjct: 133 RGLGRFQKVFVGTVSAFCVKHAECPVMTIK 162

Arabidopsis thaliana (taxid: 3702)
>sp|P87132|YFK5_SCHPO Uncharacterized protein C167.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC167.05 PE=1 SV=2 Back     alignment and function description
>sp|P74897|YQA3_THEAQ Universal stress protein in QAH/OAS sulfhydrylase 3'region OS=Thermus aquaticus PE=3 SV=1 Back     alignment and function description
>sp|Q57951|Y531_METJA Universal stress protein MJ0531 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0531 PE=3 SV=1 Back     alignment and function description
>sp|Q4L751|Y1215_STAHJ Putative universal stress protein SH1215 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=SH1215 PE=3 SV=1 Back     alignment and function description
>sp|P42297|YXIE_BACSU Universal stress protein YxiE OS=Bacillus subtilis (strain 168) GN=yxiE PE=3 SV=1 Back     alignment and function description
>sp|P0A5F8|Y2019_MYCBO Universal stress protein Mb2019 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb2019 PE=3 SV=1 Back     alignment and function description
>sp|P0A5F7|Y1996_MYCTU Universal stress protein Rv1996/MT2052 OS=Mycobacterium tuberculosis GN=Rv1996 PE=1 SV=1 Back     alignment and function description
>sp|Q8CS61|Y1385_STAES Putative universal stress protein SE_1385 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_1385 PE=3 SV=1 Back     alignment and function description
>sp|Q5HNJ5|Y1273_STAEQ Putative universal stress protein SERP1273 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=SERP1273 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query164
388511717164 unknown [Lotus japonicus] 0.975 0.975 0.806 2e-70
351721446164 uncharacterized protein LOC100499951 [Gl 0.969 0.969 0.798 1e-69
351727411167 uncharacterized protein LOC100306513 [Gl 0.975 0.958 0.787 1e-68
449511086164 PREDICTED: uncharacterized protein C167. 1.0 1.0 0.725 3e-67
225440536164 PREDICTED: universal stress protein A-li 1.0 1.0 0.737 2e-66
217071128165 unknown [Medicago truncatula] gi|3885173 0.963 0.957 0.746 3e-65
217071366165 unknown [Medicago truncatula] 0.963 0.957 0.746 3e-65
255586970164 conserved hypothetical protein [Ricinus 0.993 0.993 0.713 1e-64
449439956162 PREDICTED: uncharacterized protein C167. 0.987 1.0 0.707 6e-64
224090821157 predicted protein [Populus trichocarpa] 0.939 0.980 0.735 5e-63
>gi|388511717|gb|AFK43920.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
 Score =  270 bits (690), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 129/160 (80%), Positives = 141/160 (88%)

Query: 1   MAGDRKIGVALDFSPSSKFALSWAVNNLLDKGDTLYIIHINPNSLDESRNLMWAKSGSPL 60
           MA DR IGVALDFS SSK AL WA+ NL DKGD +YIIHINPNSLDESRN +W KSGSPL
Sbjct: 1   MAKDRTIGVALDFSKSSKNALKWALENLADKGDNIYIIHINPNSLDESRNKLWGKSGSPL 60

Query: 61  IPLTEFREPETMEKYNVKTDIDALDLLDTASRQKEANIVAKIYWGDARERLLEAIEDLKL 120
           IPL EFREPE M KY+V+ DI+ LDLLDTASRQKE NIV KIYWGDARE+LL+A+EDLKL
Sbjct: 61  IPLKEFREPEVMTKYDVQIDIEVLDLLDTASRQKEVNIVTKIYWGDAREQLLDAVEDLKL 120

Query: 121 DSLVMGSRGLGTVRRIILGSVSNYVMTHAPCPVTIVKDPS 160
           DSLVMGSRGL T++RIILGSVSN+VMTHAPCPVTIVKD S
Sbjct: 121 DSLVMGSRGLSTIQRIILGSVSNFVMTHAPCPVTIVKDSS 160

Source: Lotus japonicus

Species: Lotus japonicus

Genus: Lotus

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|351721446|ref|NP_001238489.1| uncharacterized protein LOC100499951 [Glycine max] gi|255627933|gb|ACU14311.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|351727411|ref|NP_001236136.1| uncharacterized protein LOC100306513 [Glycine max] gi|255628745|gb|ACU14717.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|449511086|ref|XP_004163858.1| PREDICTED: uncharacterized protein C167.05-like isoform 2 [Cucumis sativus] Back     alignment and taxonomy information
>gi|225440536|ref|XP_002275745.1| PREDICTED: universal stress protein A-like protein [Vitis vinifera] gi|147866185|emb|CAN81966.1| hypothetical protein VITISV_034082 [Vitis vinifera] gi|297740283|emb|CBI30465.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|217071128|gb|ACJ83924.1| unknown [Medicago truncatula] gi|388517399|gb|AFK46761.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|217071366|gb|ACJ84043.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|255586970|ref|XP_002534082.1| conserved hypothetical protein [Ricinus communis] gi|223525875|gb|EEF28298.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|449439956|ref|XP_004137751.1| PREDICTED: uncharacterized protein C167.05-like isoform 2 [Cucumis sativus] Back     alignment and taxonomy information
>gi|224090821|ref|XP_002309096.1| predicted protein [Populus trichocarpa] gi|118485531|gb|ABK94618.1| unknown [Populus trichocarpa] gi|222855072|gb|EEE92619.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query164
TAIR|locus:2084525160 AT3G53990 "AT3G53990" [Arabido 0.963 0.987 0.651 6.3e-53
TAIR|locus:2086102163 AT3G17020 "AT3G17020" [Arabido 0.951 0.957 0.458 5.8e-34
TAIR|locus:2097755201 AT3G03270 [Arabidopsis thalian 0.823 0.671 0.474 8.5e-33
TAIR|locus:2200036242 AT1G11360 [Arabidopsis thalian 0.939 0.636 0.349 2.5e-17
TAIR|locus:2147319242 PHOS32 "AT5G54430" [Arabidopsi 0.902 0.611 0.357 1.4e-16
TAIR|locus:2076381204 AT3G58450 "AT3G58450" [Arabido 0.914 0.735 0.323 2.9e-16
TAIR|locus:2024291171 AT1G09740 "AT1G09740" [Arabido 0.896 0.859 0.322 6e-16
TAIR|locus:2131719260 PHOS34 "AT4G27320" [Arabidopsi 0.914 0.576 0.359 6e-16
TAIR|locus:2096089162 AT3G62550 "AT3G62550" [Arabido 0.878 0.888 0.335 7.7e-16
TAIR|locus:2081531226 AT3G11930 "AT3G11930" [Arabido 0.841 0.610 0.243 1.9e-13
TAIR|locus:2084525 AT3G53990 "AT3G53990" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 548 (198.0 bits), Expect = 6.3e-53, P = 6.3e-53
 Identities = 103/158 (65%), Positives = 124/158 (78%)

Query:     1 MAGDRKIGVALDFSPSSKFALSWAVNNLLDKGDTLYIIHINPNSLDESRNLMWAKSGSPL 60
             M  DR IG+A+DFS SSK AL WA+ NL DKGDT+YIIH  P S DESRN +W KSGSPL
Sbjct:     1 MPKDRNIGIAMDFSESSKNALKWAIENLADKGDTIYIIHTLPLSGDESRNSLWFKSGSPL 60

Query:    61 IPLTEFREPETMEKYNVKXXXXXXXXXXXXSRQKEANIVAKIYWGDARERLLEAIEDLKL 120
             IPL EFREPE MEKY VK            SRQKE ++V K+YWGDARE+L++A++DLKL
Sbjct:    61 IPLAEFREPEIMEKYGVKTDIACLDMLDTGSRQKEVHVVTKLYWGDAREKLVDAVKDLKL 120

Query:   121 DSLVMGSRGLGTVRRIILGSVSNYVMTHAPCPVTIVKD 158
             DS+VMGSRGL  ++RII+GSVS++V+ HAPCPVT+VKD
Sbjct:   121 DSIVMGSRGLSALQRIIMGSVSSFVIQHAPCPVTVVKD 158
GO:0003674 "molecular_function" evidence=ND
GO:0005737 "cytoplasm" evidence=ISM
GO:0009409 "response to cold" evidence=IEP
GO:0009506 "plasmodesma" evidence=IDA
GO:0005886 "plasma membrane" evidence=IDA
TAIR|locus:2086102 AT3G17020 "AT3G17020" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2097755 AT3G03270 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2200036 AT1G11360 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2147319 PHOS32 "AT5G54430" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2076381 AT3G58450 "AT3G58450" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2024291 AT1G09740 "AT1G09740" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2131719 PHOS34 "AT4G27320" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2096089 AT3G62550 "AT3G62550" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2081531 AT3G11930 "AT3G11930" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
estExt_fgenesh4_pm.C_LG_VI0311
SubName- Full=Putative uncharacterized protein; (157 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query164
cd00293130 cd00293, USP_Like, Usp: Universal stress protein f 1e-28
pfam00582139 pfam00582, Usp, Universal stress protein family 1e-27
COG0589154 COG0589, UspA, Universal stress protein UspA and r 2e-19
cd01989146 cd01989, STK_N, The N-terminal domain of Eukaryoti 3e-10
cd01988132 cd01988, Na_H_Antiporter_C, The C-terminal domain 5e-04
>gnl|CDD|238182 cd00293, USP_Like, Usp: Universal stress protein family Back     alignment and domain information 
 Score =  102 bits (256), Expect = 1e-28
 Identities = 49/151 (32%), Positives = 69/151 (45%), Gaps = 21/151 (13%)

Query: 6   KIGVALDFSPSSKFALSWAVNNLLDKGDTLYIIHINPNSLDESRNLMWAKSGSPLIPLTE 65
           +I VA+D S  S+ AL WA       G  L ++H+       +  L             E
Sbjct: 1   RILVAVDGSEESERALRWAARLARRLGAELVLLHVVDPPPSSAAELA------------E 48

Query: 66  FREPETMEKYNVKTDIDALDLLDTASRQKEANIVAKIYWGDARERLLEAIEDLKLDSLVM 125
             E E             L+ L  A  +    +   +  GD  E +LEA E+L  D +VM
Sbjct: 49  LLEEEARAL---------LEALREALAEAGVKVETVVLEGDPAEAILEAAEELGADLIVM 99

Query: 126 GSRGLGTVRRIILGSVSNYVMTHAPCPVTIV 156
           GSRG   +RR++LGSV+  V+ HAPCPV +V
Sbjct: 100 GSRGRSGLRRLLLGSVAERVLRHAPCPVLVV 130

The universal stress protein Usp is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents. Usp enhances the rate of cell survival during prolonged exposure to such conditions, and may provide a general "stress endurance" activity. The crystal structure of Haemophilus influenzae Usp reveals an alpha/beta fold similar to that of the Methanococcus jannaschii MJ0577 protein, which binds ATP, athough Usp lacks ATP-binding activity. Length = 130
>gnl|CDD|216006 pfam00582, Usp, Universal stress protein family Back     alignment and domain information
>gnl|CDD|223662 COG0589, UspA, Universal stress protein UspA and related nucleotide-binding proteins [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|238947 cd01989, STK_N, The N-terminal domain of Eukaryotic Serine Threonine kinases Back     alignment and domain information
>gnl|CDD|238946 cd01988, Na_H_Antiporter_C, The C-terminal domain of a subfamily of Na+ /H+ antiporter existed in bacteria and archea Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 164
PRK15005144 universal stress protein F; Provisional 99.96
PRK15456142 universal stress protein UspG; Provisional 99.96
PRK09982142 universal stress protein UspD; Provisional 99.95
cd01989146 STK_N The N-terminal domain of Eukaryotic Serine T 99.95
PRK15118144 universal stress global response regulator UspA; P 99.94
PRK10116142 universal stress protein UspC; Provisional 99.93
PF00582140 Usp: Universal stress protein family; InterPro: IP 99.93
PRK11175 305 universal stress protein UspE; Provisional 99.93
cd01988132 Na_H_Antiporter_C The C-terminal domain of a subfa 99.92
cd01987124 USP_OKCHK USP domain is located between the N-term 99.91
PRK11175305 universal stress protein UspE; Provisional 99.89
cd00293130 USP_Like Usp: Universal stress protein family. The 99.86
COG0589154 UspA Universal stress protein UspA and related nuc 99.84
PRK12652 357 putative monovalent cation/H+ antiporter subunit E 99.74
PRK10490 895 sensor protein KdpD; Provisional 99.51
COG2205 890 KdpD Osmosensitive K+ channel histidine kinase [Si 99.47
cd0198486 AANH_like Adenine nucleotide alpha hydrolases supe 98.66
PLN03159 832 cation/H(+) antiporter 15; Provisional 98.24
TIGR02432189 lysidine_TilS_N tRNA(Ile)-lysidine synthetase, N-t 97.65
PF01171182 ATP_bind_3: PP-loop family; InterPro: IPR011063 Th 97.58
PLN03159832 cation/H(+) antiporter 15; Provisional 97.54
cd01992185 PP-ATPase N-terminal domain of predicted ATPase of 97.34
PRK12342 254 hypothetical protein; Provisional 96.88
COG2086 260 FixA Electron transfer flavoprotein, beta subunit 96.83
PRK03359256 putative electron transfer flavoprotein FixA; Revi 96.7
cd01993185 Alpha_ANH_like_II This is a subfamily of Adenine n 96.57
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 96.02
COG0037 298 MesJ tRNA(Ile)-lysidine synthase MesJ [Cell cycle 95.92
PF01012164 ETF: Electron transfer flavoprotein domain; InterP 95.83
PRK10696258 tRNA 2-thiocytidine biosynthesis protein TtcA; Pro 95.66
PRK13820 394 argininosuccinate synthase; Provisional 95.63
PRK05253 301 sulfate adenylyltransferase subunit 2; Provisional 94.96
TIGR00591 454 phr2 photolyase PhrII. All proteins in this family 94.56
PLN00200 404 argininosuccinate synthase; Provisional 94.51
PRK10867 433 signal recognition particle protein; Provisional 94.39
TIGR00268252 conserved hypothetical protein TIGR00268. The N-te 94.26
cd01985181 ETF The electron transfer flavoprotein (ETF) serve 94.06
COG0541 451 Ffh Signal recognition particle GTPase [Intracellu 93.4
PRK05579 399 bifunctional phosphopantothenoylcysteine decarboxy 93.24
TIGR02039 294 CysD sulfate adenylyltransferase, small subunit. I 93.22
COG0041162 PurE Phosphoribosylcarboxyaminoimidazole (NCAIR) m 93.21
TIGR01162156 purE phosphoribosylaminoimidazole carboxylase, Pur 93.05
PF02441129 Flavoprotein: Flavoprotein; InterPro: IPR003382 Th 93.03
TIGR00959 428 ffh signal recognition particle protein. This mode 92.98
PRK14665 360 mnmA tRNA-specific 2-thiouridylase MnmA; Provision 92.93
PRK07313182 phosphopantothenoylcysteine decarboxylase; Validat 92.89
KOG1467556 consensus Translation initiation factor 2B, delta 92.88
PRK10660 436 tilS tRNA(Ile)-lysidine synthetase; Provisional 92.6
TIGR01425 429 SRP54_euk signal recognition particle protein SRP5 92.2
TIGR00032 394 argG argininosuccinate synthase. argG in bacteria, 92.19
PRK13982 475 bifunctional SbtC-like/phosphopantothenoylcysteine 91.98
PF00731150 AIRC: AIR carboxylase; InterPro: IPR000031 Phospho 91.92
COG0299200 PurN Folate-dependent phosphoribosylglycinamide fo 91.9
PF02601 319 Exonuc_VII_L: Exonuclease VII, large subunit; Inte 91.45
cd01990202 Alpha_ANH_like_I This is a subfamily of Adenine nu 91.16
PF00875165 DNA_photolyase: DNA photolyase from Prosite.; Inte 91.08
TIGR0085395 pts-lac PTS system, lactose/cellobiose family IIB 90.84
PRK06027286 purU formyltetrahydrofolate deformylase; Reviewed 90.77
cd01713173 PAPS_reductase This domain is found in phosphoaden 90.71
PRK12563 312 sulfate adenylyltransferase subunit 2; Provisional 90.65
TIGR00655280 PurU formyltetrahydrofolate deformylase. This mode 90.33
cd0556599 PTS_IIB_lactose PTS_IIB_lactose: subunit IIB of en 90.23
COG1927 277 Mtd Coenzyme F420-dependent N(5),N(10)-methenyltet 90.16
KOG1650769 consensus Predicted K+/H+-antiporter [Inorganic io 90.04
COG1606 269 ATP-utilizing enzymes of the PP-loop superfamily [ 89.64
PRK13010289 purU formyltetrahydrofolate deformylase; Reviewed 89.53
TIGR03556 471 photolyase_8HDF deoxyribodipyrimidine photo-lyase, 89.4
TIGR02765 429 crypto_DASH cryptochrome, DASH family. Photolyases 89.32
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 89.3
cd01995169 ExsB ExsB is a transcription regulator related pro 89.12
cd0556496 PTS_IIB_chitobiose_lichenan PTS_IIB_chitobiose_lic 88.93
KOG3180254 consensus Electron transfer flavoprotein, beta sub 88.92
COG0552340 FtsY Signal recognition particle GTPase [Intracell 88.74
PF07355 349 GRDB: Glycine/sarcosine/betaine reductase selenopr 88.69
PRK09590104 celB cellobiose phosphotransferase system IIB comp 88.63
TIGR02113177 coaC_strep phosphopantothenoylcysteine decarboxyla 88.2
PRK00286 438 xseA exodeoxyribonuclease VII large subunit; Revie 87.16
COG1184301 GCD2 Translation initiation factor 2B subunit, eIF 87.15
TIGR02852187 spore_dpaB dipicolinic acid synthetase, B subunit. 87.02
cd01986103 Alpha_ANH_like Adenine nucleotide alpha hydrolases 86.6
PRK00109138 Holliday junction resolvase-like protein; Reviewed 86.5
PLN02331207 phosphoribosylglycinamide formyltransferase 86.32
PF07279218 DUF1442: Protein of unknown function (DUF1442); In 86.19
PRK15424 538 propionate catabolism operon regulatory protein Pr 85.92
COG1570 440 XseA Exonuclease VII, large subunit [DNA replicati 85.87
), forming GARS-AIRS-GART. This entry represents the N-domain, which is related to the N-terminal domain of biotin carboxylase/carbamoyl phosphate synthetase (IPR005481 from INTERPRO).; GO: 0004637 phosphoribosylamine-glycine ligase activity, 0009113 purine base biosynthetic process; PDB: 3MJF_A 2XD4_A 2XCL_A 2IP4_A 2YW2_B 2YYA_A 3LP8_A 1VKZ_A 2YS6_A 2YRX_A ...." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF02844">PF02844100 GARS_N: Phosphoribosylglycinamide synthetase, N do 85.31
PRK06029185 3-octaprenyl-4-hydroxybenzoate carboxy-lyase; Prov 85.3
cd02067119 B12-binding B12 binding domain (B12-BD). This doma 85.13
TIGR00237 432 xseA exodeoxyribonuclease VII, large subunit. This 84.72
PF04244224 DPRP: Deoxyribodipyrimidine photo-lyase-related pr 84.4
TIGR02329 526 propionate_PrpR propionate catabolism operon regul 84.28
PF05582287 Peptidase_U57: YabG peptidase U57; InterPro: IPR00 84.0
TIGR02069 250 cyanophycinase cyanophycinase. This model describe 83.91
PRK00994 277 F420-dependent methylenetetrahydromethanopterin de 83.82
KOG0780 483 consensus Signal recognition particle, subunit Srp 83.6
PF1316795 GTP-bdg_N: GTP-binding GTPase N-terminal 83.36
PF03652135 UPF0081: Uncharacterised protein family (UPF0081); 83.31
PRK00779 304 ornithine carbamoyltransferase; Provisional 83.28
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 83.22
cd08550 349 GlyDH-like Glycerol_dehydrogenase-like. Families o 82.51
TIGR02855283 spore_yabG sporulation peptidase YabG. Members of 82.49
PRK14664 362 tRNA-specific 2-thiouridylase MnmA; Provisional 81.99
COG0452 392 Dfp Phosphopantothenoylcysteine synthetase/decarbo 81.9
PRK08576438 hypothetical protein; Provisional 81.83
PRK00771 437 signal recognition particle protein Srp54; Provisi 81.53
cd01714202 ETF_beta The electron transfer flavoprotein (ETF) 81.49
PRK13011286 formyltetrahydrofolate deformylase; Reviewed 81.16
PRK11914 306 diacylglycerol kinase; Reviewed 81.09
PRK00509 399 argininosuccinate synthase; Provisional 80.89
TIGR00250130 RNAse_H_YqgF RNAse H-fold protein YqgF. This prote 80.61
COG1066 456 Sms Predicted ATP-dependent serine protease [Postt 80.12
PRK10674 472 deoxyribodipyrimidine photolyase; Provisional 80.09
>PRK15005 universal stress protein F; Provisional Back     alignment and domain information 
Probab=99.96  E-value=8.4e-28  Score=158.08  Aligned_cols=142  Identities=20%  Similarity=0.261  Sum_probs=106.6

Q ss_pred             CCceEEEEeCCCcc--HHHHHHHHHHhcCCCCCeEEEEEEecCCCchhhhhhccCCCCCCCCcccCcchhhhHhhcccch
Q 031195            3 GDRKIGVALDFSPS--SKFALSWAVNNLLDKGDTLYIIHINPNSLDESRNLMWAKSGSPLIPLTEFREPETMEKYNVKTD   80 (164)
Q Consensus         3 ~~~~iLv~vd~s~~--~~~al~~a~~la~~~~~~l~ll~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   80 (164)
                      ||++||+|+|+|+.  +..|+++|.++|+..+++++++||++......      ..+  ........   .. +...+..
T Consensus         1 m~~~ILv~~D~s~~~~~~~a~~~a~~la~~~~~~l~ll~v~~~~~~~~------~~~--~~~~~~~~---~~-~~~~~~~   68 (144)
T PRK15005          1 MNRTILVPIDISDSELTQRVISHVEAEAKIDDAEVHFLTVIPSLPYYA------SLG--LAYSAELP---AM-DDLKAEA   68 (144)
T ss_pred             CCccEEEecCCCchhHHHHHHHHHHHHHhccCCeEEEEEEEccCcccc------ccc--ccccccch---HH-HHHHHHH
Confidence            37999999999998  57999999999999999999999998653211      000  00000000   00 1112222


Q ss_pred             HHHHHHHHHHhhhcCCceEEEEecCChhHHHHHHHhhCCCCEEEEeccCCcccchhcccchhHHHhhcCCccEEEEe
Q 031195           81 IDALDLLDTASRQKEANIVAKIYWGDARERLLEAIEDLKLDSLVMGSRGLGTVRRIILGSVSNYVMTHAPCPVTIVK  157 (164)
Q Consensus        81 ~~~l~~~~~~~~~~~~~~~~~~~~g~~~~~I~~~a~~~~~dlivlg~~~~~~~~~~~~~s~~~~i~~~~~~pVliv~  157 (164)
                      .+.++.+.+.+...+.++++.+..|++.+.|++++++.++||||||+++ +++.++++||++++++++++||||+||
T Consensus        69 ~~~l~~~~~~~~~~~~~~~~~v~~G~p~~~I~~~a~~~~~DLIV~Gs~~-~~~~~~llGS~a~~vl~~a~cpVlvVr  144 (144)
T PRK15005         69 KSQLEEIIKKFKLPTDRVHVHVEEGSPKDRILELAKKIPADMIIIASHR-PDITTYLLGSNAAAVVRHAECSVLVVR  144 (144)
T ss_pred             HHHHHHHHHHhCCCCCceEEEEeCCCHHHHHHHHHHHcCCCEEEEeCCC-CCchheeecchHHHHHHhCCCCEEEeC
Confidence            3445555555555567788889999999999999999999999999884 568888999999999999999999996

>PRK15456 universal stress protein UspG; Provisional Back     alignment and domain information
>PRK09982 universal stress protein UspD; Provisional Back     alignment and domain information
>cd01989 STK_N The N-terminal domain of Eukaryotic Serine Threonine kinases Back     alignment and domain information
>PRK15118 universal stress global response regulator UspA; Provisional Back     alignment and domain information
>PRK10116 universal stress protein UspC; Provisional Back     alignment and domain information
>PF00582 Usp: Universal stress protein family; InterPro: IPR006016 The universal stress protein UspA P28242 from SWISSPROT [] is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents Back     alignment and domain information
>PRK11175 universal stress protein UspE; Provisional Back     alignment and domain information
>cd01988 Na_H_Antiporter_C The C-terminal domain of a subfamily of Na+ /H+ antiporter existed in bacteria and archea Back     alignment and domain information
>cd01987 USP_OKCHK USP domain is located between the N-terminal sensor domain and C-terminal catalytic domain of this Osmosensitive K+ channel histidine kinase family Back     alignment and domain information
>PRK11175 universal stress protein UspE; Provisional Back     alignment and domain information
>cd00293 USP_Like Usp: Universal stress protein family Back     alignment and domain information
>COG0589 UspA Universal stress protein UspA and related nucleotide-binding proteins [Signal transduction mechanisms] Back     alignment and domain information
>PRK12652 putative monovalent cation/H+ antiporter subunit E; Reviewed Back     alignment and domain information
>PRK10490 sensor protein KdpD; Provisional Back     alignment and domain information
>COG2205 KdpD Osmosensitive K+ channel histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd01984 AANH_like Adenine nucleotide alpha hydrolases superfamily including N type ATP PPases, ATP sulphurylases Universal Stress Response protein and electron transfer flavoprotein (ETF) Back     alignment and domain information
>PLN03159 cation/H(+) antiporter 15; Provisional Back     alignment and domain information
>TIGR02432 lysidine_TilS_N tRNA(Ile)-lysidine synthetase, N-terminal domain Back     alignment and domain information
>PF01171 ATP_bind_3: PP-loop family; InterPro: IPR011063 This entry represents the PP-loop motif superfamily [,] Back     alignment and domain information
>PLN03159 cation/H(+) antiporter 15; Provisional Back     alignment and domain information
>cd01992 PP-ATPase N-terminal domain of predicted ATPase of the PP-loop faimly implicated in cell cycle control [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK12342 hypothetical protein; Provisional Back     alignment and domain information
>COG2086 FixA Electron transfer flavoprotein, beta subunit [Energy production and conversion] Back     alignment and domain information
>PRK03359 putative electron transfer flavoprotein FixA; Reviewed Back     alignment and domain information
>cd01993 Alpha_ANH_like_II This is a subfamily of Adenine nucleotide alpha hydrolases superfamily Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>COG0037 MesJ tRNA(Ile)-lysidine synthase MesJ [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF01012 ETF: Electron transfer flavoprotein domain; InterPro: IPR014730 Electron transfer flavoproteins (ETFs) serve as specific electron acceptors for primary dehydrogenases, transferring the electrons to terminal respiratory systems Back     alignment and domain information
>PRK10696 tRNA 2-thiocytidine biosynthesis protein TtcA; Provisional Back     alignment and domain information
>PRK13820 argininosuccinate synthase; Provisional Back     alignment and domain information
>PRK05253 sulfate adenylyltransferase subunit 2; Provisional Back     alignment and domain information
>TIGR00591 phr2 photolyase PhrII Back     alignment and domain information
>PLN00200 argininosuccinate synthase; Provisional Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>TIGR00268 conserved hypothetical protein TIGR00268 Back     alignment and domain information
>cd01985 ETF The electron transfer flavoprotein (ETF) serves as a specific electron acceptor for various mitochondrial dehydrogenases Back     alignment and domain information
>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK05579 bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Validated Back     alignment and domain information
>TIGR02039 CysD sulfate adenylyltransferase, small subunit Back     alignment and domain information
>COG0041 PurE Phosphoribosylcarboxyaminoimidazole (NCAIR) mutase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR01162 purE phosphoribosylaminoimidazole carboxylase, PurE protein Back     alignment and domain information
>PF02441 Flavoprotein: Flavoprotein; InterPro: IPR003382 This entry contains a diverse range of flavoprotein enzymes, including epidermin biosynthesis protein, EpiD, which has been shown to be a flavoprotein that binds FMN [] Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>PRK14665 mnmA tRNA-specific 2-thiouridylase MnmA; Provisional Back     alignment and domain information
>PRK07313 phosphopantothenoylcysteine decarboxylase; Validated Back     alignment and domain information
>KOG1467 consensus Translation initiation factor 2B, delta subunit (eIF-2Bdelta/GCD2) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK10660 tilS tRNA(Ile)-lysidine synthetase; Provisional Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>TIGR00032 argG argininosuccinate synthase Back     alignment and domain information
>PRK13982 bifunctional SbtC-like/phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Provisional Back     alignment and domain information
>PF00731 AIRC: AIR carboxylase; InterPro: IPR000031 Phosphoribosylaminoimidazole carboxylase is a fusion protein in plants and fungi, but consists of two non-interacting proteins in bacteria, PurK and PurE Back     alignment and domain information
>COG0299 PurN Folate-dependent phosphoribosylglycinamide formyltransferase PurN [Nucleotide transport and metabolism] Back     alignment and domain information
>PF02601 Exonuc_VII_L: Exonuclease VII, large subunit; InterPro: IPR020579 Exonuclease VII 3 Back     alignment and domain information
>cd01990 Alpha_ANH_like_I This is a subfamily of Adenine nucleotide alpha hydrolases superfamily Back     alignment and domain information
>PF00875 DNA_photolyase: DNA photolyase from Prosite Back     alignment and domain information
>TIGR00853 pts-lac PTS system, lactose/cellobiose family IIB component Back     alignment and domain information
>PRK06027 purU formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>cd01713 PAPS_reductase This domain is found in phosphoadenosine phosphosulphate (PAPS) reductase enzymes or PAPS sulphotransferase Back     alignment and domain information
>PRK12563 sulfate adenylyltransferase subunit 2; Provisional Back     alignment and domain information
>TIGR00655 PurU formyltetrahydrofolate deformylase Back     alignment and domain information
>cd05565 PTS_IIB_lactose PTS_IIB_lactose: subunit IIB of enzyme II (EII) of the lactose-specific phosphoenolpyruvate:carbohydrate phosphotransferase system (PTS) found in Firmicutes as well as Actinobacteria Back     alignment and domain information
>COG1927 Mtd Coenzyme F420-dependent N(5),N(10)-methenyltetrahydromethanopterin dehydrogenase [Energy production and conversion] Back     alignment and domain information
>KOG1650 consensus Predicted K+/H+-antiporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1606 ATP-utilizing enzymes of the PP-loop superfamily [General function prediction only] Back     alignment and domain information
>PRK13010 purU formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>TIGR03556 photolyase_8HDF deoxyribodipyrimidine photo-lyase, 8-HDF type Back     alignment and domain information
>TIGR02765 crypto_DASH cryptochrome, DASH family Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd01995 ExsB ExsB is a transcription regulator related protein Back     alignment and domain information
>cd05564 PTS_IIB_chitobiose_lichenan PTS_IIB_chitobiose_lichenan: subunit IIB of enzyme II (EII) of the N,N-diacetylchitobiose-specific and lichenan-specific phosphoenolpyruvate:carbohydrate phosphotransferase system (PTS) Back     alignment and domain information
>KOG3180 consensus Electron transfer flavoprotein, beta subunit [Energy production and conversion] Back     alignment and domain information
>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>PF07355 GRDB: Glycine/sarcosine/betaine reductase selenoprotein B (GRDB); InterPro: IPR022787 This entry represents selenoprotein B of glycine reductase, sarcosine reductase, betaine reductase, D-proline reductase, and perhaps others Back     alignment and domain information
>PRK09590 celB cellobiose phosphotransferase system IIB component; Reviewed Back     alignment and domain information
>TIGR02113 coaC_strep phosphopantothenoylcysteine decarboxylase, streptococcal Back     alignment and domain information
>PRK00286 xseA exodeoxyribonuclease VII large subunit; Reviewed Back     alignment and domain information
>COG1184 GCD2 Translation initiation factor 2B subunit, eIF-2B alpha/beta/delta family [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR02852 spore_dpaB dipicolinic acid synthetase, B subunit Back     alignment and domain information
>cd01986 Alpha_ANH_like Adenine nucleotide alpha hydrolases superfamily including N type ATP PPases and ATP sulphurylases Back     alignment and domain information
>PRK00109 Holliday junction resolvase-like protein; Reviewed Back     alignment and domain information
>PLN02331 phosphoribosylglycinamide formyltransferase Back     alignment and domain information
>PF07279 DUF1442: Protein of unknown function (DUF1442); InterPro: IPR009902 This family consists of several hypothetical Arabidopsis thaliana proteins of around 225 residues in length Back     alignment and domain information
>PRK15424 propionate catabolism operon regulatory protein PrpR; Provisional Back     alignment and domain information
>COG1570 XseA Exonuclease VII, large subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>PF02844 GARS_N: Phosphoribosylglycinamide synthetase, N domain; InterPro: IPR020562 Phosphoribosylglycinamide synthetase (6 Back     alignment and domain information
>PRK06029 3-octaprenyl-4-hydroxybenzoate carboxy-lyase; Provisional Back     alignment and domain information
>cd02067 B12-binding B12 binding domain (B12-BD) Back     alignment and domain information
>TIGR00237 xseA exodeoxyribonuclease VII, large subunit Back     alignment and domain information
>PF04244 DPRP: Deoxyribodipyrimidine photo-lyase-related protein; InterPro: IPR007357 This family appears to be related to DNA photolyases Back     alignment and domain information
>TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR Back     alignment and domain information
>PF05582 Peptidase_U57: YabG peptidase U57; InterPro: IPR008764 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>TIGR02069 cyanophycinase cyanophycinase Back     alignment and domain information
>PRK00994 F420-dependent methylenetetrahydromethanopterin dehydrogenase; Provisional Back     alignment and domain information
>KOG0780 consensus Signal recognition particle, subunit Srp54 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13167 GTP-bdg_N: GTP-binding GTPase N-terminal Back     alignment and domain information
>PF03652 UPF0081: Uncharacterised protein family (UPF0081); InterPro: IPR005227 Holliday junction resolvases (HJRs) are key enzymes of DNA recombination Back     alignment and domain information
>PRK00779 ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>cd08550 GlyDH-like Glycerol_dehydrogenase-like Back     alignment and domain information
>TIGR02855 spore_yabG sporulation peptidase YabG Back     alignment and domain information
>PRK14664 tRNA-specific 2-thiouridylase MnmA; Provisional Back     alignment and domain information
>COG0452 Dfp Phosphopantothenoylcysteine synthetase/decarboxylase [Coenzyme metabolism] Back     alignment and domain information
>PRK08576 hypothetical protein; Provisional Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>cd01714 ETF_beta The electron transfer flavoprotein (ETF) serves as a specific electron acceptor for various mitochondrial dehydrogenases Back     alignment and domain information
>PRK13011 formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>PRK11914 diacylglycerol kinase; Reviewed Back     alignment and domain information
>PRK00509 argininosuccinate synthase; Provisional Back     alignment and domain information
>TIGR00250 RNAse_H_YqgF RNAse H-fold protein YqgF Back     alignment and domain information
>COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10674 deoxyribodipyrimidine photolyase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query164
2gm3_A175 Crystal Structure Of An Universal Stress Protein Fa 6e-08
1wjg_A137 Crystal Structure Of A Probable Atp Binding Protein 1e-06
3s3t_A146 Universal Stress Protein Uspa From Lactobacillus Pl 1e-04
1mjh_A162 Structure-Based Assignment Of The Biochemical Funct 7e-04
>pdb|2GM3|A Chain A, Crystal Structure Of An Universal Stress Protein Family Protein From Arabidopsis Thaliana At3g01520 With Amp Bound Length = 175 Back     alignment and structure 
Iteration: 1

 Score = 53.1 bits (126), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 38/56 (67%)
Query: 102 IYWGDARERLLEAIEDLKLDSLVMGSRGLGTVRRIILGSVSNYVMTHAPCPVTIVK 157
           I  GD ++ + + ++ ++ D LV+GSRGLG  +++ +G+VS + + HA CPV  +K
Sbjct: 107 IKTGDPKDVICQEVKRVRPDFLVVGSRGLGRFQKVFVGTVSAFCVKHAECPVXTIK 162
>pdb|1WJG|A Chain A, Crystal Structure Of A Probable Atp Binding Protein From Thermus Themophilus Hb8 Length = 137 Back     alignment and structure
>pdb|3S3T|A Chain A, Universal Stress Protein Uspa From Lactobacillus Plantarum Length = 146 Back     alignment and structure
>pdb|1MJH|A Chain A, Structure-Based Assignment Of The Biochemical Function Of Hypothetical Protein Mj0577: A Test Case Of Structural Genomics Length = 162 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query164
2gm3_A175 Unknown protein; AT3G01520, putative ethylene-resp 2e-43
1tq8_A163 Hypothetical protein RV1636; MTCY01B2.28, structur 6e-29
3idf_A138 USP-like protein; universal, stress, PSI, MCSG, st 6e-29
1mjh_A162 Protein (ATP-binding domain of protein MJ0577); hy 1e-27
3s3t_A146 Nucleotide-binding protein, universal stress PROT 6e-26
2z08_A137 Universal stress protein family; uncharacterized c 2e-25
3hgm_A147 Universal stress protein TEAD; rossman fold, signa 3e-25
2dum_A170 Hypothetical protein PH0823; conserved hypothetica 5e-25
3dlo_A155 Universal stress protein; unknown function, struct 9e-23
3loq_A294 Universal stress protein; structural genomics, PSI 1e-21
3loq_A 294 Universal stress protein; structural genomics, PSI 6e-20
3tnj_A150 Universal stress protein (USP); structural genomic 4e-21
3fg9_A156 Protein of universal stress protein USPA family; A 7e-21
1jmv_A141 USPA, universal stress protein A; chaperone; 1.85A 5e-20
3cis_A 309 Uncharacterized protein; alpha/beta hydrolase, ATP 2e-18
3cis_A309 Uncharacterized protein; alpha/beta hydrolase, ATP 4e-14
3ab8_A 268 Putative uncharacterized protein TTHA0350; tandem- 5e-17
3ab8_A268 Putative uncharacterized protein TTHA0350; tandem- 2e-16
3fdx_A143 Putative filament protein / universal stress PROT; 8e-17
3olq_A 319 Universal stress protein E; structural genomics, P 7e-15
3olq_A319 Universal stress protein E; structural genomics, P 3e-14
3mt0_A290 Uncharacterized protein PA1789; structural genomic 7e-12
3mt0_A 290 Uncharacterized protein PA1789; structural genomic 1e-11
1q77_A138 Hypothetical protein AQ_178; structural genomics, 2e-06
>2gm3_A Unknown protein; AT3G01520, putative ethylene-responsive protein, USP domain, nucleotide binding domain, AMP; HET: MSE AMP; 2.46A {Arabidopsis thaliana} SCOP: c.26.2.4 Length = 175 Back     alignment and structure
 Score =  140 bits (355), Expect = 2e-43
 Identities = 36/168 (21%), Positives = 75/168 (44%), Gaps = 20/168 (11%)

Query: 5   RKIGVALDFS---------PSSKFALSWAVNNLLDKGDT---LYIIHINPNSLDESRNLM 52
            K+ VA++ S          S K A  W +  ++    +   + ++H+     ++  + +
Sbjct: 6   TKVMVAVNASTIKDYPNPSISCKRAFEWTLEKIVRSNTSDFKILLLHVQVVD-EDGFDDV 64

Query: 53  WAKSGSPLIPLTEFREPETMEKYNVKTDIDALDLLDTASRQKEANIVAKIYWGDARERLL 112
            +   SP        +   M + N    +  L+       +      A I  GD ++ + 
Sbjct: 65  DSIYASP-------EDFRDMRQSNKAKGLHLLEFFVNKCHEIGVGCEAWIKTGDPKDVIC 117

Query: 113 EAIEDLKLDSLVMGSRGLGTVRRIILGSVSNYVMTHAPCPVTIVKDPS 160
           + ++ ++ D LV+GSRGLG  +++ +G+VS + + HA CPV  +K  +
Sbjct: 118 QEVKRVRPDFLVVGSRGLGRFQKVFVGTVSAFCVKHAECPVMTIKRNA 165
>1tq8_A Hypothetical protein RV1636; MTCY01B2.28, structural target, NYSGXRC, PSI, protein structure initiative; 2.40A {Mycobacterium tuberculosis} SCOP: c.26.2.4 Length = 163 Back     alignment and structure
>3idf_A USP-like protein; universal, stress, PSI, MCSG, structural genomics, midwest center for structural genomics structure initiative; 2.00A {Wolinella succinogenes} Length = 138 Back     alignment and structure
>1mjh_A Protein (ATP-binding domain of protein MJ0577); hypothetical protein, structural genomics, functional assignment; HET: ATP; 1.70A {Methanocaldococcus jannaschii} SCOP: c.26.2.4 Length = 162 Back     alignment and structure
>3s3t_A Nucleotide-binding protein, universal stress PROT family; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: ATP; 1.90A {Lactobacillus plantarum} Length = 146 Back     alignment and structure
>2z08_A Universal stress protein family; uncharacterized conserved protein, structural genomics, unknown function, NPPSFA; HET: ATP; 1.55A {Thermus thermophilus} SCOP: c.26.2.4 PDB: 1wjg_A* 2z09_A* 2z3v_A Length = 137 Back     alignment and structure
>3hgm_A Universal stress protein TEAD; rossman fold, signaling protein; HET: ATP; 1.90A {Halomonas elongata} Length = 147 Back     alignment and structure
>2dum_A Hypothetical protein PH0823; conserved hypothetical protein, putative universal protein A structural genomics, NPPSFA; 2.75A {Pyrococcus horikoshii} Length = 170 Back     alignment and structure
>3dlo_A Universal stress protein; unknown function, structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics; HET: MSE; 1.97A {Archaeoglobus fulgidus} PDB: 3qtb_A* Length = 155 Back     alignment and structure
>3loq_A Universal stress protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: AMP; 2.32A {Archaeoglobus fulgidus} Length = 294 Back     alignment and structure
>3loq_A Universal stress protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: AMP; 2.32A {Archaeoglobus fulgidus} Length = 294 Back     alignment and structure
>3tnj_A Universal stress protein (USP); structural genomics, PSI-biology, midwest center for structu genomics, MCSG, chaperone; HET: AMP; 2.00A {Nitrosomonas europaea} PDB: 2pfs_A* Length = 150 Back     alignment and structure
>3fg9_A Protein of universal stress protein USPA family; APC60691, nucleotide- binding, lactobacillus plantarum WCFS1, structural genomics PSI-2; 1.47A {Lactobacillus plantarum} Length = 156 Back     alignment and structure
>1jmv_A USPA, universal stress protein A; chaperone; 1.85A {Haemophilus influenzae} SCOP: c.26.2.4 Length = 141 Back     alignment and structure
>3cis_A Uncharacterized protein; alpha/beta hydrolase, ATP, universal stress protein, unknown function; HET: ATP; 2.90A {Mycobacterium tuberculosis} PDB: 2jax_A* Length = 309 Back     alignment and structure
>3cis_A Uncharacterized protein; alpha/beta hydrolase, ATP, universal stress protein, unknown function; HET: ATP; 2.90A {Mycobacterium tuberculosis} PDB: 2jax_A* Length = 309 Back     alignment and structure
>3ab8_A Putative uncharacterized protein TTHA0350; tandem-type universal stress protein, unknown function; HET: ATP; 1.70A {Thermus thermophilus} PDB: 3ab7_A* Length = 268 Back     alignment and structure
>3ab8_A Putative uncharacterized protein TTHA0350; tandem-type universal stress protein, unknown function; HET: ATP; 1.70A {Thermus thermophilus} PDB: 3ab7_A* Length = 268 Back     alignment and structure
>3fdx_A Putative filament protein / universal stress PROT; structural genomics, APC60640.1, universal protein F, PSI-2; HET: MSE ATP; 1.58A {Klebsiella pneumoniae subsp} PDB: 3fh0_A* Length = 143 Back     alignment and structure
>3olq_A Universal stress protein E; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: UNL; 1.82A {Proteus mirabilis} Length = 319 Back     alignment and structure
>3olq_A Universal stress protein E; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: UNL; 1.82A {Proteus mirabilis} Length = 319 Back     alignment and structure
>3mt0_A Uncharacterized protein PA1789; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 1.58A {Pseudomonas aeruginosa} Length = 290 Back     alignment and structure
>3mt0_A Uncharacterized protein PA1789; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 1.58A {Pseudomonas aeruginosa} Length = 290 Back     alignment and structure
>1q77_A Hypothetical protein AQ_178; structural genomics, universal stress protein, PSI, protein structure initiative; 2.70A {Aquifex aeolicus} SCOP: c.26.2.4 Length = 138 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query164
3s3t_A146 Nucleotide-binding protein, universal stress PROT 99.97
3tnj_A150 Universal stress protein (USP); structural genomic 99.97
2dum_A170 Hypothetical protein PH0823; conserved hypothetica 99.96
1mjh_A162 Protein (ATP-binding domain of protein MJ0577); hy 99.96
3fg9_A156 Protein of universal stress protein USPA family; A 99.96
3hgm_A147 Universal stress protein TEAD; rossman fold, signa 99.96
1tq8_A163 Hypothetical protein RV1636; MTCY01B2.28, structur 99.96
3idf_A138 USP-like protein; universal, stress, PSI, MCSG, st 99.96
3dlo_A155 Universal stress protein; unknown function, struct 99.95
2z08_A137 Universal stress protein family; uncharacterized c 99.95
2gm3_A175 Unknown protein; AT3G01520, putative ethylene-resp 99.94
3fdx_A143 Putative filament protein / universal stress PROT; 99.94
3olq_A 319 Universal stress protein E; structural genomics, P 99.94
1jmv_A141 USPA, universal stress protein A; chaperone; 1.85A 99.94
3loq_A 294 Universal stress protein; structural genomics, PSI 99.93
3mt0_A 290 Uncharacterized protein PA1789; structural genomic 99.92
3cis_A 309 Uncharacterized protein; alpha/beta hydrolase, ATP 99.91
1q77_A138 Hypothetical protein AQ_178; structural genomics, 99.91
3mt0_A290 Uncharacterized protein PA1789; structural genomic 99.91
3ab8_A 268 Putative uncharacterized protein TTHA0350; tandem- 99.91
3olq_A319 Universal stress protein E; structural genomics, P 99.9
3loq_A294 Universal stress protein; structural genomics, PSI 99.9
3cis_A309 Uncharacterized protein; alpha/beta hydrolase, ATP 99.88
3ab8_A268 Putative uncharacterized protein TTHA0350; tandem- 99.84
2iel_A138 Hypothetical protein TT0030; TT0030,thermus thermo 97.37
1wy5_A 317 TILS, hypothetical UPF0072 protein AQ_1887; N-type 96.35
3a2k_A 464 TRNA(Ile)-lysidine synthase; ligase, pseudo-knot, 96.25
3g40_A294 Na-K-CL cotransporter; alpha/beta fold 10-stranded 95.25
2xry_A 482 Deoxyribodipyrimidine photolyase; DNA damage, DNA 95.04
3kcq_A215 Phosphoribosylglycinamide formyltransferase; struc 94.53
4b4k_A181 N5-carboxyaminoimidazole ribonucleotide mutase; is 94.49
1zun_A 325 Sulfate adenylyltransferase subunit 2; beta barrel 94.43
1efp_B252 ETF, protein (electron transfer flavoprotein); ele 94.16
1o97_C264 Electron transferring flavoprotein beta-subunit; F 93.78
3qjg_A175 Epidermin biosynthesis protein EPID; structural ge 93.77
3umv_A 506 Deoxyribodipyrimidine photo-lyase; CPD cyclobutane 93.63
1efv_B255 Electron transfer flavoprotein; electron transport 93.63
2wq7_A 543 RE11660P; lyase-DNA complex, DNA repair, DNA lesio 93.55
3p9x_A211 Phosphoribosylglycinamide formyltransferase; struc 93.46
3ih5_A217 Electron transfer flavoprotein alpha-subunit; alph 93.34
1xmp_A170 PURE, phosphoribosylaminoimidazole carboxylase; pu 93.22
2nz2_A 413 Argininosuccinate synthase; amino-acid biosynthesi 93.03
1k92_A 455 Argininosuccinate synthase, argininosuccinate SY; 92.91
2ywx_A157 Phosphoribosylaminoimidazole carboxylase catalyti; 92.91
4grd_A173 N5-CAIR mutase, phosphoribosylaminoimidazole carbo 92.73
3trh_A169 Phosphoribosylaminoimidazole carboxylase carboxylt 92.45
3kuu_A174 Phosphoribosylaminoimidazole carboxylase catalyti 92.26
1u11_A182 PURE (N5-carboxyaminoimidazole ribonucleotide MUT; 92.05
1np7_A 489 DNA photolyase; protein with FAD cofactor; HET: DN 91.73
1ni5_A 433 Putative cell cycle protein MESJ; structural genom 91.65
3k32_A203 Uncharacterized protein MJ0690; predicted subunit 91.65
3zqu_A209 Probable aromatic acid decarboxylase; lyase; HET: 91.54
1o4v_A183 Phosphoribosylaminoimidazole mutase PURE; structur 91.31
3oow_A166 Phosphoribosylaminoimidazole carboxylase,catalyic; 91.18
3lp6_A174 Phosphoribosylaminoimidazole carboxylase catalyti; 91.14
3ors_A163 N5-carboxyaminoimidazole ribonucleotide mutase; is 91.07
1sur_A215 PAPS reductase; assimilatory sulfate reduction, 3- 90.95
3rg8_A159 Phosphoribosylaminoimidazole carboxylase, PURE PR; 90.49
1iv0_A98 Hypothetical protein; rnaseh-like, YQGF, structura 90.46
4ds3_A209 Phosphoribosylglycinamide formyltransferase; struc 90.43
1owl_A 484 Photolyase, deoxyribodipyrimidine photolyase; DNA 90.27
3bl5_A219 Queuosine biosynthesis protein QUEC; PREQ1 biosynt 89.87
2oq2_A261 Phosphoadenosine phosphosulfate reductase; sulfate 89.31
3tvs_A 538 Cryptochrome-1; circadian clock light entrainment, 89.28
2hma_A 376 Probable tRNA (5-methylaminomethyl-2-thiouridylat 89.15
3da8_A215 Probable 5'-phosphoribosylglycinamide formyltransf 89.07
3tqr_A215 Phosphoribosylglycinamide formyltransferase; purin 88.58
3o1l_A302 Formyltetrahydrofolate deformylase; structural gen 88.52
3fy4_A 537 6-4 photolyase; DNA repair, clock cryptochrome; HE 87.96
3g40_A 294 Na-K-CL cotransporter; alpha/beta fold 10-stranded 87.88
2wsi_A 306 FAD synthetase; transferase, nucleotidyltransferas 87.85
2l69_A134 Rossmann 2X3 fold protein; structural genomics, no 87.3
2l69_A134 Rossmann 2X3 fold protein; structural genomics, no 86.79
3lou_A292 Formyltetrahydrofolate deformylase; structural gen 86.55
3nbm_A108 PTS system, lactose-specific IIBC components; PTS_ 86.21
2ywb_A 503 GMP synthase [glutamine-hydrolyzing]; GMP syntheta 85.11
3n0v_A286 Formyltetrahydrofolate deformylase; formyl transfe 85.0
2j07_A 420 Deoxyribodipyrimidine photo-lyase; flavoprotein, n 84.75
2der_A 380 TRNA-specific 2-thiouridylase MNMA; protein-RNA co 84.5
1g63_A181 Epidermin modifying enzyme EPID; alpha, beta prote 84.45
3ecs_A315 Translation initiation factor EIF-2B subunit alpha 84.42
1kor_A 400 Argininosuccinate synthetase; ligase, riken struct 83.9
3tqi_A 527 GMP synthase [glutamine-hydrolyzing]; ligase; 2.84 83.87
2c5s_A413 THII, probable thiamine biosynthesis protein THII; 83.77
1u3d_A 509 Cryptochrome 1 apoprotein; photolyase, AMPPNP, sig 83.67
3en0_A 291 Cyanophycinase; serine protease, beta peptide spec 83.31
1ccw_A137 Protein (glutamate mutase); coenzyme B12, radical 82.99
2ywr_A216 Phosphoribosylglycinamide formyltransferase; rossm 82.95
1nu0_A138 Hypothetical protein YQGF; structural genomics, st 82.8
3auf_A229 Glycinamide ribonucleotide transformylase 1; struc 82.62
2qv7_A 337 Diacylglycerol kinase DGKB; alpha-beta domain 1, b 82.6
3rjz_A 237 N-type ATP pyrophosphatase superfamily; structural 82.56
3hly_A161 Flavodoxin-like domain; Q5MZP6_SYNP6, flavoprotein 82.36
1vl2_A 421 Argininosuccinate synthase; TM1780, structural gen 82.07
2ejb_A189 Probable aromatic acid decarboxylase; phenylacryli 81.79
2e0i_A 440 432AA long hypothetical deoxyribodipyrimidine PHO; 81.64
1meo_A209 Phosophoribosylglycinamide formyltransferase; puri 81.47
2yxb_A161 Coenzyme B12-dependent mutase; alpha/beta, structu 81.07
1vhx_A150 Putative holliday junction resolvase; structural g 80.9
2j4d_A 525 Cryptochrome 3, cryptochrome DASH; DNA-binding pro 80.9
3fni_A159 Putative diflavin flavoprotein A 3; alpha-beta pro 80.84
3obi_A288 Formyltetrahydrofolate deformylase; structural gen 80.52
>3s3t_A Nucleotide-binding protein, universal stress PROT family; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: ATP; 1.90A {Lactobacillus plantarum} SCOP: c.26.2.0 Back     alignment and structure
Probab=99.97  E-value=1.2e-29  Score=165.93  Aligned_cols=142  Identities=23%  Similarity=0.317  Sum_probs=119.2

Q ss_pred             CCCceEEEEeCCCccHHHHHHHHHHhcCCCCCeEEEEEEecCCCchhhhhhccCCCCCCCCcccCcchhhhHhhcccchH
Q 031195            2 AGDRKIGVALDFSPSSKFALSWAVNNLLDKGDTLYIIHINPNSLDESRNLMWAKSGSPLIPLTEFREPETMEKYNVKTDI   81 (164)
Q Consensus         2 ~~~~~iLv~vd~s~~~~~al~~a~~la~~~~~~l~ll~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   81 (164)
                      +++++||||+|+++.+..++++|+.+|+..+++|+++||.+........             ... ......+...+..+
T Consensus         3 ~~~~~ILv~~D~s~~s~~al~~A~~la~~~~a~l~ll~v~~~~~~~~~~-------------~~~-~~~~~~~~~~~~~~   68 (146)
T 3s3t_A            3 ARYTNILVPVDSSDAAQAAFTEAVNIAQRHQANLTALYVVDDSAYHTPA-------------LDP-VLSELLDAEAAHAK   68 (146)
T ss_dssp             CCCCEEEEECCSSHHHHHHHHHHHHHHHHHTCEEEEEEEEECCCCCCGG-------------GHH-HHHHHHHHHHHHHH
T ss_pred             CccceEEEEcCCCHHHHHHHHHHHHHHHhcCCEEEEEEEecCccccccc-------------ccc-ccHHHHHHHHHHHH
Confidence            3589999999999999999999999999999999999999886532100             000 11122223344556


Q ss_pred             HHHHHHHHHhhhcCC-ceEEEEecCChhHHHHH-HHhhCCCCEEEEeccCCcccchhcccchhHHHhhcCCccEEEEe
Q 031195           82 DALDLLDTASRQKEA-NIVAKIYWGDARERLLE-AIEDLKLDSLVMGSRGLGTVRRIILGSVSNYVMTHAPCPVTIVK  157 (164)
Q Consensus        82 ~~l~~~~~~~~~~~~-~~~~~~~~g~~~~~I~~-~a~~~~~dlivlg~~~~~~~~~~~~~s~~~~i~~~~~~pVliv~  157 (164)
                      +.++.+.+.+...|+ .+++.+..|++.++|++ ++++.++||||||+++++.+.++++||++++++++++|||||||
T Consensus        69 ~~l~~~~~~~~~~g~~~~~~~~~~g~~~~~I~~~~a~~~~~dliV~G~~~~~~~~~~~~Gs~~~~vl~~~~~pVlvV~  146 (146)
T 3s3t_A           69 DAMRQRQQFVATTSAPNLKTEISYGIPKHTIEDYAKQHPEIDLIVLGATGTNSPHRVAVGSTTSYVVDHAPCNVIVIR  146 (146)
T ss_dssp             HHHHHHHHHHTTSSCCCCEEEEEEECHHHHHHHHHHHSTTCCEEEEESCCSSCTTTCSSCHHHHHHHHHCSSEEEEEC
T ss_pred             HHHHHHHHHHHhcCCcceEEEEecCChHHHHHHHHHhhcCCCEEEECCCCCCCcceEEEcchHHHHhccCCCCEEEeC
Confidence            778888888888899 99999999999999999 99999999999999999999999999999999999999999997
>3tnj_A Universal stress protein (USP); structural genomics, PSI-biology, midwest center for structu genomics, MCSG, chaperone; HET: AMP; 2.00A {Nitrosomonas europaea} PDB: 2pfs_A* Back     alignment and structure
>2dum_A Hypothetical protein PH0823; conserved hypothetical protein, putative universal protein A structural genomics, NPPSFA; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>1mjh_A Protein (ATP-binding domain of protein MJ0577); hypothetical protein, structural genomics, functional assignment; HET: ATP; 1.70A {Methanocaldococcus jannaschii} SCOP: c.26.2.4 Back     alignment and structure
>3fg9_A Protein of universal stress protein USPA family; APC60691, nucleotide- binding, lactobacillus plantarum WCFS1, structural genomics PSI-2; 1.47A {Lactobacillus plantarum} Back     alignment and structure
>3hgm_A Universal stress protein TEAD; rossman fold, signaling protein; HET: ATP; 1.90A {Halomonas elongata} SCOP: c.26.2.0 Back     alignment and structure
>1tq8_A Hypothetical protein RV1636; MTCY01B2.28, structural target, NYSGXRC, PSI, protein structure initiative; 2.40A {Mycobacterium tuberculosis} SCOP: c.26.2.4 Back     alignment and structure
>3idf_A USP-like protein; universal, stress, PSI, MCSG, structural genomics, midwest center for structural genomics structure initiative; 2.00A {Wolinella succinogenes} Back     alignment and structure
>3dlo_A Universal stress protein; unknown function, structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics; HET: MSE; 1.97A {Archaeoglobus fulgidus} PDB: 3qtb_A* Back     alignment and structure
>2z08_A Universal stress protein family; uncharacterized conserved protein, structural genomics, unknown function, NPPSFA; HET: ATP; 1.55A {Thermus thermophilus} SCOP: c.26.2.4 PDB: 1wjg_A* 2z09_A* 2z3v_A Back     alignment and structure
>2gm3_A Unknown protein; AT3G01520, putative ethylene-responsive protein, USP domain, nucleotide binding domain, AMP; HET: MSE AMP; 2.46A {Arabidopsis thaliana} SCOP: c.26.2.4 Back     alignment and structure
>3fdx_A Putative filament protein / universal stress PROT; structural genomics, APC60640.1, universal protein F, PSI-2; HET: MSE ATP; 1.58A {Klebsiella pneumoniae subsp} PDB: 3fh0_A* Back     alignment and structure
>3olq_A Universal stress protein E; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: UNL; 1.82A {Proteus mirabilis} Back     alignment and structure
>1jmv_A USPA, universal stress protein A; chaperone; 1.85A {Haemophilus influenzae} SCOP: c.26.2.4 Back     alignment and structure
>3loq_A Universal stress protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: AMP; 2.32A {Archaeoglobus fulgidus} Back     alignment and structure
>3mt0_A Uncharacterized protein PA1789; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 1.58A {Pseudomonas aeruginosa} Back     alignment and structure
>3cis_A Uncharacterized protein; alpha/beta hydrolase, ATP, universal stress protein, unknown function; HET: ATP; 2.90A {Mycobacterium tuberculosis} PDB: 2jax_A* Back     alignment and structure
>1q77_A Hypothetical protein AQ_178; structural genomics, universal stress protein, PSI, protein structure initiative; 2.70A {Aquifex aeolicus} SCOP: c.26.2.4 Back     alignment and structure
>3mt0_A Uncharacterized protein PA1789; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 1.58A {Pseudomonas aeruginosa} Back     alignment and structure
>3ab8_A Putative uncharacterized protein TTHA0350; tandem-type universal stress protein, unknown function; HET: ATP; 1.70A {Thermus thermophilus} PDB: 3ab7_A* Back     alignment and structure
>3olq_A Universal stress protein E; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: UNL; 1.82A {Proteus mirabilis} Back     alignment and structure
>3loq_A Universal stress protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: AMP; 2.32A {Archaeoglobus fulgidus} Back     alignment and structure
>3cis_A Uncharacterized protein; alpha/beta hydrolase, ATP, universal stress protein, unknown function; HET: ATP; 2.90A {Mycobacterium tuberculosis} PDB: 2jax_A* Back     alignment and structure
>3ab8_A Putative uncharacterized protein TTHA0350; tandem-type universal stress protein, unknown function; HET: ATP; 1.70A {Thermus thermophilus} PDB: 3ab7_A* Back     alignment and structure
>2iel_A Hypothetical protein TT0030; TT0030,thermus thermophilus, structural genomics, PSI, protein structure initiative; 1.60A {Thermus thermophilus} SCOP: c.26.2.4 Back     alignment and structure
>1wy5_A TILS, hypothetical UPF0072 protein AQ_1887; N-type ATP-ppase, structural genomics, translation, NPPSFA; 2.42A {Aquifex aeolicus} SCOP: c.26.2.5 d.229.1.1 PDB: 2e21_A* 2e89_A* Back     alignment and structure
>3a2k_A TRNA(Ile)-lysidine synthase; ligase, pseudo-knot, ligase/RNA complex; 3.65A {Geobacillus kaustophilus} Back     alignment and structure
>3g40_A Na-K-CL cotransporter; alpha/beta fold 10-stranded twisted beta sheet, transport protein; 1.90A {Methanosarcina acetivorans} Back     alignment and structure
>2xry_A Deoxyribodipyrimidine photolyase; DNA damage, DNA repair; HET: FAD; 1.50A {Methanosarcina mazei} PDB: 2xrz_A* Back     alignment and structure
>3kcq_A Phosphoribosylglycinamide formyltransferase; structural genomics, niaid, seattle structural center for infectious disease, ssgcid; 2.20A {Anaplasma phagocytophilum} SCOP: c.65.1.0 Back     alignment and structure
>4b4k_A N5-carboxyaminoimidazole ribonucleotide mutase; isomerase; 2.50A {Bacillus anthracis} Back     alignment and structure
>1zun_A Sulfate adenylyltransferase subunit 2; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae} SCOP: c.26.2.2 Back     alignment and structure
>1efp_B ETF, protein (electron transfer flavoprotein); electron transport, glutaric acidemia type II; HET: FAD AMP; 2.60A {Paracoccus denitrificans} SCOP: c.26.2.3 Back     alignment and structure
>1o97_C Electron transferring flavoprotein beta-subunit; FAD binding; HET: AMP FAD; 1.6A {Methylophilus methylotrophus} SCOP: c.26.2.3 PDB: 1o95_C* 1o96_A* 1o94_C* 3clr_C* 3cls_C* 3clt_C* 3clu_C* Back     alignment and structure
>3qjg_A Epidermin biosynthesis protein EPID; structural genomics, center for structural genomics of infec diseases, csgid, oxidoreductase; HET: FMN; 2.04A {Staphylococcus aureus} SCOP: c.34.1.0 Back     alignment and structure
>3umv_A Deoxyribodipyrimidine photo-lyase; CPD cyclobutane pyrimidine dimers, UV damaged DNA, DNA repai flavoprotein; HET: FAD; 1.71A {Oryza sativa japonica group} Back     alignment and structure
>1efv_B Electron transfer flavoprotein; electron transport, glutaric acidemia type II; HET: FAD AMP; 2.10A {Homo sapiens} SCOP: c.26.2.3 PDB: 1t9g_S* 2a1u_B* 2a1t_S* Back     alignment and structure
>2wq7_A RE11660P; lyase-DNA complex, DNA repair, DNA lesion, lyase; HET: TDY Z FAD; 2.00A {Drosophila melanogaster} PDB: 2wb2_A* 2wq6_A* 3cvu_A* 3cvv_A* 3cvy_A* 3cvw_A* 3cvx_A* Back     alignment and structure
>3p9x_A Phosphoribosylglycinamide formyltransferase; structural genomics, PSI-biology, protein STRU initiative; 1.90A {Bacillus halodurans} Back     alignment and structure
>3ih5_A Electron transfer flavoprotein alpha-subunit; alpha-beta-alpha sandwich, structural genomics, PSI-2, protein structure initiative; 2.60A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1xmp_A PURE, phosphoribosylaminoimidazole carboxylase; purine biosynthesis, spine, lyase; 1.80A {Bacillus anthracis} SCOP: c.23.8.1 Back     alignment and structure
>2nz2_A Argininosuccinate synthase; amino-acid biosynthesis, aspartate, citrulline, ST genomics, structural genomics consortium, SGC, ligase; HET: CIR; 2.40A {Homo sapiens} Back     alignment and structure
>1k92_A Argininosuccinate synthase, argininosuccinate SY; N-type ATP pyrophosphatase, ligase; 1.60A {Escherichia coli} SCOP: c.26.2.1 d.210.1.1 PDB: 1k97_A* 1kp2_A* 1kp3_A* Back     alignment and structure
>2ywx_A Phosphoribosylaminoimidazole carboxylase catalyti; rossmann fold, structural genomics, NPPSFA; 2.31A {Methanocaldococcus jannaschii} Back     alignment and structure
>4grd_A N5-CAIR mutase, phosphoribosylaminoimidazole carboxylase catalyti; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures; 1.85A {Burkholderia cenocepacia} Back     alignment and structure
>3trh_A Phosphoribosylaminoimidazole carboxylase carboxyltransferase subunit; purines, pyrimidines, nucleosides, nucleotides, lyase; 2.20A {Coxiella burnetii} Back     alignment and structure
>3kuu_A Phosphoribosylaminoimidazole carboxylase catalyti PURE; 3-layer (ABA) sandwich, rossmann fold, csgid, lyase, structu genomics; 1.41A {Yersinia pestis} SCOP: c.23.8.1 PDB: 1d7a_A* 1qcz_A 2ate_A* 2nsl_A* 2nsh_A* 2nsj_A* Back     alignment and structure
>1u11_A PURE (N5-carboxyaminoimidazole ribonucleotide MUT; acidophIle, protein stability, lyase; HET: CIT; 1.55A {Acetobacter aceti} SCOP: c.23.8.1 PDB: 2fwj_A* 2fw1_A* 2fwb_A 2fwa_A 2fw9_A 2fw7_A 2fw6_A 2fwp_A* 2fwi_A* 2fw8_A Back     alignment and structure
>1np7_A DNA photolyase; protein with FAD cofactor; HET: DNA FAD; 1.90A {Synechocystis SP} SCOP: a.99.1.1 c.28.1.1 Back     alignment and structure
>1ni5_A Putative cell cycle protein MESJ; structural genomics, ATPase, PP-type, putative cell cycle PR PSI, protein structure initiative; 2.65A {Escherichia coli} SCOP: b.153.1.2 c.26.2.5 d.229.1.1 Back     alignment and structure
>3k32_A Uncharacterized protein MJ0690; predicted subunit of tRNA methyltransferase, methanocaldococcus jannaschii DSM , PSI- 2; 2.50A {Methanocaldococcus jannaschii} Back     alignment and structure
>3zqu_A Probable aromatic acid decarboxylase; lyase; HET: FNR; 1.50A {Pseudomonas aeruginosa} SCOP: c.34.1.0 Back     alignment and structure
>1o4v_A Phosphoribosylaminoimidazole mutase PURE; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; 1.77A {Thermotoga maritima} SCOP: c.23.8.1 Back     alignment and structure
>3oow_A Phosphoribosylaminoimidazole carboxylase,catalyic; structural genomics, center for structural genomics of infec diseases, csgid; HET: MSE; 1.75A {Francisella tularensis subsp} SCOP: c.23.8.1 PDB: 3opq_A* Back     alignment and structure
>3lp6_A Phosphoribosylaminoimidazole carboxylase catalyti; alpha and beta protein, structural genomics, PSI-2, protein initiative; 1.70A {Mycobacterium tuberculosis} SCOP: c.23.8.0 Back     alignment and structure
>3ors_A N5-carboxyaminoimidazole ribonucleotide mutase; isomerase, isomerase,biosynthetic protein; 1.45A {Staphylococcus aureus subsp} Back     alignment and structure
>1sur_A PAPS reductase; assimilatory sulfate reduction, 3-phospho-adenylyl-sulfate reductase, oxidoreductase; 2.00A {Escherichia coli} SCOP: c.26.2.2 Back     alignment and structure
>3rg8_A Phosphoribosylaminoimidazole carboxylase, PURE PR; purine biosynthesis, lyase; 1.74A {Treponema denticola} SCOP: c.23.8.0 PDB: 3rgg_A* Back     alignment and structure
>1iv0_A Hypothetical protein; rnaseh-like, YQGF, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Thermus thermophilus} SCOP: c.55.3.8 Back     alignment and structure
>4ds3_A Phosphoribosylglycinamide formyltransferase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.85A {Brucella melitensis BV} Back     alignment and structure
>1owl_A Photolyase, deoxyribodipyrimidine photolyase; DNA repair, flavin enzyme, photoreactivating enzyme; HET: FAD; 1.80A {Synechococcus elongatus} SCOP: a.99.1.1 c.28.1.1 PDB: 1owm_A* 1own_A* 1owo_A* 1owp_A* 1qnf_A* 1tez_A* Back     alignment and structure
>3bl5_A Queuosine biosynthesis protein QUEC; PREQ1 biosynthesis, RNA modification, tRNA, hydrolase; 2.95A {Bacillus subtilis} Back     alignment and structure
>2oq2_A Phosphoadenosine phosphosulfate reductase; sulfate reduction, PAPS reductase, oxidoreductase; HET: A3P; 2.10A {Saccharomyces cerevisiae} Back     alignment and structure
>2hma_A Probable tRNA (5-methylaminomethyl-2-thiouridylat methyltransferase; alpha-beta, beta barrel, structural genomics, PSI-2; HET: MSE SAM; 2.41A {Streptococcus pneumoniae} Back     alignment and structure
>3da8_A Probable 5'-phosphoribosylglycinamide formyltransferase PURN; glycinamide ribonucleotide transformylase, structure; 1.30A {Mycobacterium tuberculosis} PDB: 3dcj_A* Back     alignment and structure
>3tqr_A Phosphoribosylglycinamide formyltransferase; purines, pyrimidines, nucleosides, nucleotides; HET: NHE; 1.97A {Coxiella burnetii} SCOP: c.65.1.0 Back     alignment and structure
>3o1l_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 2.20A {Pseudomonas syringae PV} Back     alignment and structure
>3fy4_A 6-4 photolyase; DNA repair, clock cryptochrome; HET: MES FAD; 2.70A {Arabidopsis thaliana} Back     alignment and structure
>3g40_A Na-K-CL cotransporter; alpha/beta fold 10-stranded twisted beta sheet, transport protein; 1.90A {Methanosarcina acetivorans} Back     alignment and structure
>2wsi_A FAD synthetase; transferase, nucleotidyltransferase, nucleotide-binding; HET: FAD; 1.90A {Saccharomyces cerevisiae} Back     alignment and structure
>2l69_A Rossmann 2X3 fold protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Artificial gene} Back     alignment and structure
>2l69_A Rossmann 2X3 fold protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Artificial gene} Back     alignment and structure
>3lou_A Formyltetrahydrofolate deformylase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative hydrolase; HET: MSE; 1.90A {Burkholderia mallei} Back     alignment and structure
>3nbm_A PTS system, lactose-specific IIBC components; PTS_IIB_LACTOSE, phosphoenolpyruvate:carbohydrate system, P- phosphorylation; HET: MSE; 1.30A {Streptococcus pneumoniae} Back     alignment and structure
>2ywb_A GMP synthase [glutamine-hydrolyzing]; GMP synthetase, XMP binding, ATP binding, purine nucleotide biosynthetic pathway, structural genomics; 2.10A {Thermus thermophilus} PDB: 2ywc_A* Back     alignment and structure
>3n0v_A Formyltetrahydrofolate deformylase; formyl transferase, ACT domain, structural genomics, joint C structural genomics, JCSG; HET: MSE; 2.25A {Pseudomonas putida} Back     alignment and structure
>2j07_A Deoxyribodipyrimidine photo-lyase; flavoprotein, nucleotide-binding, DNA repair; HET: FAD HDF; 1.95A {Thermus thermophilus} SCOP: a.99.1.1 c.28.1.1 PDB: 1iqu_A* 1iqr_A* 2j08_A* 2j09_A* Back     alignment and structure
>2der_A TRNA-specific 2-thiouridylase MNMA; protein-RNA complex, transferase/RNA complex; 3.10A {Escherichia coli} PDB: 2det_A 2deu_A* Back     alignment and structure
>1g63_A Epidermin modifying enzyme EPID; alpha, beta protein, rossmann like fold, oxidoreductase; HET: FMN; 2.50A {Staphylococcus epidermidis} SCOP: c.34.1.1 PDB: 1g5q_A* Back     alignment and structure
>3ecs_A Translation initiation factor EIF-2B subunit alpha; eukaryotic translation initiation factor 2balpha (EIF2balpha); 2.65A {Homo sapiens} Back     alignment and structure
>1kor_A Argininosuccinate synthetase; ligase, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: ANP ARG; 1.95A {Thermus thermophilus} SCOP: c.26.2.1 d.210.1.1 PDB: 1j1z_A* 1j21_A* 1kh1_A 1kh2_A* 1kh3_A* 1j20_A* Back     alignment and structure
>3tqi_A GMP synthase [glutamine-hydrolyzing]; ligase; 2.84A {Coxiella burnetii} Back     alignment and structure
>2c5s_A THII, probable thiamine biosynthesis protein THII; RNA-binding protein, RNA binding protein, tRNA modification, 4-thiouridine synthase; HET: AMP; 2.5A {Bacillus anthracis} SCOP: c.26.2.6 d.308.1.1 Back     alignment and structure
>1u3d_A Cryptochrome 1 apoprotein; photolyase, AMPPNP, signaling protein; HET: FAD ANP NDS; 2.45A {Arabidopsis thaliana} SCOP: a.99.1.1 c.28.1.1 PDB: 1u3c_A* Back     alignment and structure
>3en0_A Cyanophycinase; serine protease, beta peptide specific, hydrolase, protease; 1.50A {Synechocystis SP} Back     alignment and structure
>1ccw_A Protein (glutamate mutase); coenzyme B12, radical reaction, TIM-barrel rossman-fold, isomerase; HET: CNC TAR; 1.60A {Clostridium cochlearium} SCOP: c.23.6.1 PDB: 1cb7_A* 1b1a_A 1i9c_A* 1be1_A 1fmf_A 1id8_A* Back     alignment and structure
>2ywr_A Phosphoribosylglycinamide formyltransferase; rossmann fold, structural genomics, NPPSFA; 1.77A {Aquifex aeolicus} Back     alignment and structure
>1nu0_A Hypothetical protein YQGF; structural genomics, structure 2 function project, S2F, unknown function; 1.60A {Escherichia coli} SCOP: c.55.3.8 PDB: 1nmn_A 1ovq_A Back     alignment and structure
>3auf_A Glycinamide ribonucleotide transformylase 1; structural genomics, riken structural genomics/proteomics in RSGI, rossmann fold; 2.07A {Symbiobacterium toebii} Back     alignment and structure
>2qv7_A Diacylglycerol kinase DGKB; alpha-beta domain 1, beta sandwich domain 2, protein-ADP COM transferase; HET: ADP; 2.30A {Staphylococcus aureus} SCOP: e.52.1.2 PDB: 2qvl_A Back     alignment and structure
>3rjz_A N-type ATP pyrophosphatase superfamily; structural genomics, PSI-biology, northeast structural genom consortium, NESG, alpha-beta protein; 2.30A {Pyrococcus furiosus} SCOP: c.26.2.1 PDB: 3h7e_A 3rk0_A* 3rk1_A* 1ru8_A 2d13_A Back     alignment and structure
>3hly_A Flavodoxin-like domain; Q5MZP6_SYNP6, flavoprotein, DFA1, SNR135D, NESG, structural genomics, PSI-2; 2.40A {Synechococcus elongatus pcc 6301} Back     alignment and structure
>1vl2_A Argininosuccinate synthase; TM1780, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics, ligase; 1.65A {Thermotoga maritima} SCOP: c.26.2.1 d.210.1.1 Back     alignment and structure
>2ejb_A Probable aromatic acid decarboxylase; phenylacrylic acid decarboxylase, X-RAY diffraction, structural genomics, NPPSFA; 2.15A {Aquifex aeolicus} Back     alignment and structure
>2e0i_A 432AA long hypothetical deoxyribodipyrimidine PHO; photolyase, FAD, DNA repair, lyase; HET: FAD; 2.80A {Sulfolobus tokodaii} Back     alignment and structure
>1meo_A Phosophoribosylglycinamide formyltransferase; purine biosynthesis; 1.72A {Homo sapiens} SCOP: c.65.1.1 PDB: 1njs_A* 1rbm_A* 1rbq_A* 1rby_A* 1rbz_A* 1rc0_A* 1rc1_A* 1zly_A* 1zlx_A* 1mej_B 1men_A* Back     alignment and structure
>2yxb_A Coenzyme B12-dependent mutase; alpha/beta, structural genomics, NPPSFA, national project on structural and functional analyses; 1.80A {Aeropyrum pernix} Back     alignment and structure
>1vhx_A Putative holliday junction resolvase; structural genomics, hydrolase; 1.96A {Bacillus subtilis} SCOP: c.55.3.8 Back     alignment and structure
>2j4d_A Cryptochrome 3, cryptochrome DASH; DNA-binding protein, flavoprotein, FAD, mitochondrion, plastid, chromophore, chloroplast; HET: FAD MHF; 1.9A {Arabidopsis thaliana} PDB: 2vtb_A* 2ijg_X* 2vtb_B* Back     alignment and structure
>3fni_A Putative diflavin flavoprotein A 3; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; 2.30A {Nostoc SP} PDB: 2klb_A Back     alignment and structure
>3obi_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 1.95A {Rhodopseudomonas palustris} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 164
d2gm3a1171 c.26.2.4 (A:5-175) Putative ethylene-responsive pr 2e-26
d1mjha_160 c.26.2.4 (A:) "Hypothetical" protein MJ0577 {Archa 1e-24
d2z3va1135 c.26.2.4 (A:2-136) Hypothetical protein TTHA0895 { 2e-20
d1tq8a_147 c.26.2.4 (A:) Hypothetical protein Rv1636 {Mycobac 1e-19
d1jmva_140 c.26.2.4 (A:) Universal stress protein A, UspA {Ha 7e-17
d1q77a_138 c.26.2.4 (A:) Hypothetical protein Aq_178 {Aquifex 2e-10
>d2gm3a1 c.26.2.4 (A:5-175) Putative ethylene-responsive protein AT3g01520/F4P13_7 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 171 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Adenine nucleotide alpha hydrolase-like
superfamily: Adenine nucleotide alpha hydrolases-like
family: Universal stress protein-like
domain: Putative ethylene-responsive protein AT3g01520/F4P13 7
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

 Score = 96.1 bits (238), Expect = 2e-26
 Identities = 38/168 (22%), Positives = 74/168 (44%), Gaps = 20/168 (11%)

Query: 5   RKIGVALDFS---------PSSKFALSWAVNNLLDKGDT---LYIIHINPNSLDESRNLM 52
            K+ VA++ S          S K A  W +  ++    +   + ++H+     D      
Sbjct: 2   TKVMVAVNASTIKDYPNPSISCKRAFEWTLEKIVRSNTSDFKILLLHVQVVDED-----G 56

Query: 53  WAKSGSPLIPLTEFREPETMEKYNVKTDIDALDLLDTASRQKEANIVAKIYWGDARERLL 112
           +    S      +FR+   M + N    +  L+       +      A I  GD ++ + 
Sbjct: 57  FDDVDSIYASPEDFRD---MRQSNKAKGLHLLEFFVNKCHEIGVGCEAWIKTGDPKDVIC 113

Query: 113 EAIEDLKLDSLVMGSRGLGTVRRIILGSVSNYVMTHAPCPVTIVKDPS 160
           + ++ ++ D LV+GSRGLG  +++ +G+VS + + HA CPV  +K  +
Sbjct: 114 QEVKRVRPDFLVVGSRGLGRFQKVFVGTVSAFCVKHAECPVMTIKRNA 161
>d1mjha_ c.26.2.4 (A:) "Hypothetical" protein MJ0577 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 160 Back     information, alignment and structure
>d2z3va1 c.26.2.4 (A:2-136) Hypothetical protein TTHA0895 {Thermus thermophilus [TaxId: 274]} Length = 135 Back     information, alignment and structure
>d1tq8a_ c.26.2.4 (A:) Hypothetical protein Rv1636 {Mycobacterium tuberculosis [TaxId: 1773]} Length = 147 Back     information, alignment and structure
>d1jmva_ c.26.2.4 (A:) Universal stress protein A, UspA {Haemophilus influenzae [TaxId: 727]} Length = 140 Back     information, alignment and structure
>d1q77a_ c.26.2.4 (A:) Hypothetical protein Aq_178 {Aquifex aeolicus [TaxId: 63363]} Length = 138 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query164
d1mjha_160 "Hypothetical" protein MJ0577 {Archaeon Methanococ 100.0
d1tq8a_147 Hypothetical protein Rv1636 {Mycobacterium tubercu 99.97
d2z3va1135 Hypothetical protein TTHA0895 {Thermus thermophilu 99.96
d2gm3a1171 Putative ethylene-responsive protein AT3g01520/F4P 99.95
d1jmva_140 Universal stress protein A, UspA {Haemophilus infl 99.95
d1q77a_138 Hypothetical protein Aq_178 {Aquifex aeolicus [Tax 99.93
d1wy5a1216 TilS-like protein Aq_1887 {Aquifex aeolicus [TaxId 97.0
d3clsc1 262 Small, beta subunit of electron transfer flavoprot 96.58
d1efpb_246 Small, beta subunit of electron transfer flavoprot 96.48
d1ni5a1227 tRNA-Ile-lysidine synthetase, TilS, N-terminal dom 96.23
d1u11a_159 N5-CAIR mutase (phosphoribosylaminoimidazole carbo 95.23
d1np7a2204 Cryptochrome {Synechocystis sp., pcc 6803 [TaxId: 95.21
d1xmpa_155 N5-CAIR mutase (phosphoribosylaminoimidazole carbo 95.08
d1qcza_163 N5-CAIR mutase (phosphoribosylaminoimidazole carbo 94.94
d1efvb_252 Small, beta subunit of electron transfer flavoprot 94.88
d1o4va_169 N5-CAIR mutase (phosphoribosylaminoimidazole carbo 94.07
d1ls1a2207 GTPase domain of the signal sequence recognition p 93.64
d1owla2202 DNA photolyase {Synechococcus elongatus [TaxId: 32 93.23
d2j07a2170 DNA photolyase {Thermus thermophilus [TaxId: 274]} 93.14
d3clsd1192 Large, alpha subunit of electron transfer flavopro 93.0
d1g5qa_174 Epidermin modifying enzyme (peptidyl-cysteine deca 92.79
d1p3y1_183 MrsD {Bacillus sp. hil-y85/54728 [TaxId: 69002]} 92.71
d2qy9a2211 GTPase domain of the signal recognition particle r 92.6
d2pjua1 186 Propionate catabolism operon regulatory protein Pr 92.26
d2a9pa1117 DNA-binding response regulator MicA, N-terminal do 90.81
d1u3da2185 Cryptochrome {Thale cress (Arabidopsis thaliana) [ 90.74
d1vmaa2213 GTPase domain of the signal recognition particle r 90.56
d1ccwa_137 Glutamate mutase, small subunit {Clostridium cochl 88.91
d1okkd2207 GTPase domain of the signal recognition particle r 87.68
d1qzua_181 4'-phosphopantothenoylcysteine decarboxylase (PPC 86.24
d1s8na_ 190 Probable two-component system transcriptional regu 86.18
d1ycga1149 Nitric oxide reductase C-terminal domain {Moorella 86.15
d1xhfa1121 Aerobic respiration control protein ArcA, N-termin 86.13
d1zh2a1119 Transcriptional regulatory protein KdpE, N-termina 85.05
d1e5da1152 Rubredoxin oxygen:oxidoreductase (ROO), C-terminal 84.2
d7reqa2168 Methylmalonyl-CoA mutase alpha subunit, C-terminal 84.2
d2bona1 295 Lipid kinase YegS {Escherichia coli [TaxId: 562]} 83.9
d1gsoa2105 Glycinamide ribonucleotide synthetase (GAR-syn), N 83.18
d1xkya1 292 Dihydrodipicolinate synthase {Bacillus anthracis [ 82.47
d1nu0a_138 Hypothetical protein YqgF (RuvX) {Escherichia coli 81.85
d1w25a1139 Response regulator PleD, receiver domain {Caulobac 81.81
d1iv0a_98 Hypothetical protein, YqgF homologue {Thermus ther 81.67
d2qv7a1 312 Diacylglycerol kinase DgkB {Staphylococcus aureus 81.04
d3bzka5149 Transcriptional accessory factor Tex {Pseudomonas 80.77
d1dnpa2200 DNA photolyase {Escherichia coli [TaxId: 562]} 80.69
d1j8yf2211 GTPase domain of the signal sequence recognition p 80.58
d1krwa_123 NTRC receiver domain {Salmonella typhimurium [TaxI 80.55
>d1mjha_ c.26.2.4 (A:) "Hypothetical" protein MJ0577 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Adenine nucleotide alpha hydrolase-like
superfamily: Adenine nucleotide alpha hydrolases-like
family: Universal stress protein-like
domain: "Hypothetical" protein MJ0577
species: Archaeon Methanococcus jannaschii [TaxId: 2190]

Probab=100.00  E-value=7.2e-34  Score=187.51  Aligned_cols=159  Identities=19%  Similarity=0.246  Sum_probs=122.7

Q ss_pred             CCCceEEEEeCCCccHHHHHHHHHHhcCCCCCeEEEEEEecCCCchhhhhhccCCCCCCCCcccCcchhhhHhhcccchH
Q 031195            2 AGDRKIGVALDFSPSSKFALSWAVNNLLDKGDTLYIIHINPNSLDESRNLMWAKSGSPLIPLTEFREPETMEKYNVKTDI   81 (164)
Q Consensus         2 ~~~~~iLv~vd~s~~~~~al~~a~~la~~~~~~l~ll~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   81 (164)
                      +||||||||+|+|+.+.+++++|+.+|+..+++|+++||.++.............+....................+..+
T Consensus         1 ~m~~~ILvavD~s~~s~~al~~a~~la~~~~a~l~llhV~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   80 (160)
T d1mjha_           1 VMYKKILYPTDFSETAEIALKHVKAFKTLKAEEVILLHVIDEREIKKRDIFSLLLGVAGLNKSVEEFENELKNKLTEEAK   80 (160)
T ss_dssp             CCCCEEEEECCSCHHHHHHHHHHHHTCCSSCCEEEEEEEEEGGGTC-----------------CHHHHHHHHHHHHHHHH
T ss_pred             CCcCeEEEEECCCHHHHHHHHHHHHHHHhcCCEEEEEEecccccccccccccccccccccchhHHHHHHHHHHHHHHHHH
Confidence            45999999999999999999999999999999999999988765433221111111111111111111222233344556


Q ss_pred             HHHHHHHHHhhhcCCceEEEEecCChhHHHHHHHhhCCCCEEEEeccCCcccchhcccchhHHHhhcCCccEEEEeCCC
Q 031195           82 DALDLLDTASRQKEANIVAKIYWGDARERLLEAIEDLKLDSLVMGSRGLGTVRRIILGSVSNYVMTHAPCPVTIVKDPS  160 (164)
Q Consensus        82 ~~l~~~~~~~~~~~~~~~~~~~~g~~~~~I~~~a~~~~~dlivlg~~~~~~~~~~~~~s~~~~i~~~~~~pVliv~~~~  160 (164)
                      +.++.+.+.+...|+++++.+..|++.+.|++++++.++||||||+++++++.++++||++++|+++++|||+|||++.
T Consensus        81 ~~l~~~~~~~~~~gv~~~~~~~~G~~~~~I~~~a~~~~~dliV~G~~~~~~~~~~~~GS~a~~vl~~s~~pVlvV~~~~  159 (160)
T d1mjha_          81 NKMENIKKELEDVGFKVKDIIVVGIPHEEIVKIAEDEGVDIIIMGSHGKTNLKEILLGSVTENVIKKSNKPVLVVKRKN  159 (160)
T ss_dssp             HHHHHHHHHHHHTTCEEEEEEEEECHHHHHHHHHHHTTCSEEEEESCCSSCCTTCSSCHHHHHHHHHCCSCEEEECCCC
T ss_pred             HHHHHHHHHHHhcCCeEEEEEEeccHHHHHhhhhhccccceEEeccCCCCcccccccCcHHHHHHhcCCCCEEEEcCCC
Confidence            7777888888889999999999999999999999999999999999999999999999999999999999999999875
>d1tq8a_ c.26.2.4 (A:) Hypothetical protein Rv1636 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2z3va1 c.26.2.4 (A:2-136) Hypothetical protein TTHA0895 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2gm3a1 c.26.2.4 (A:5-175) Putative ethylene-responsive protein AT3g01520/F4P13_7 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1jmva_ c.26.2.4 (A:) Universal stress protein A, UspA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1q77a_ c.26.2.4 (A:) Hypothetical protein Aq_178 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1wy5a1 c.26.2.5 (A:1-216) TilS-like protein Aq_1887 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d3clsc1 c.26.2.3 (C:1-262) Small, beta subunit of electron transfer flavoprotein ETFP {Methylophilus methylotrophus [TaxId: 17]} Back     information, alignment and structure
>d1efpb_ c.26.2.3 (B:) Small, beta subunit of electron transfer flavoprotein ETFP {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1ni5a1 c.26.2.5 (A:0-226) tRNA-Ile-lysidine synthetase, TilS, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u11a_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Acetobacter aceti [TaxId: 435]} Back     information, alignment and structure
>d1np7a2 c.28.1.1 (A:1-204) Cryptochrome {Synechocystis sp., pcc 6803 [TaxId: 1143]} Back     information, alignment and structure
>d1xmpa_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Bacillus anthracis [TaxId: 1392]} Back     information, alignment and structure
>d1qcza_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1efvb_ c.26.2.3 (B:) Small, beta subunit of electron transfer flavoprotein ETFP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o4va_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1owla2 c.28.1.1 (A:3-204) DNA photolyase {Synechococcus elongatus [TaxId: 32046]} Back     information, alignment and structure
>d2j07a2 c.28.1.1 (A:2-171) DNA photolyase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d3clsd1 c.26.2.3 (D:1-192) Large, alpha subunit of electron transfer flavoprotein ETFP, N-terminal domain {Methylophilus methylotrophus [TaxId: 17]} Back     information, alignment and structure
>d1g5qa_ c.34.1.1 (A:) Epidermin modifying enzyme (peptidyl-cysteine decarboxylase) EpiD {Staphylococcus epidermidis [TaxId: 1282]} Back     information, alignment and structure
>d1p3y1_ c.34.1.1 (1:) MrsD {Bacillus sp. hil-y85/54728 [TaxId: 69002]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pjua1 c.92.3.1 (A:11-196) Propionate catabolism operon regulatory protein PrpR {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a9pa1 c.23.1.1 (A:2-118) DNA-binding response regulator MicA, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1u3da2 c.28.1.1 (A:13-197) Cryptochrome {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ccwa_ c.23.6.1 (A:) Glutamate mutase, small subunit {Clostridium cochlearium [TaxId: 1494]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1qzua_ c.34.1.1 (A:) 4'-phosphopantothenoylcysteine decarboxylase (PPC decarboxylase, halotolerance protein Hal3a) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s8na_ c.23.1.1 (A:) Probable two-component system transcriptional regulator Rv1626 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ycga1 c.23.5.1 (A:251-399) Nitric oxide reductase C-terminal domain {Moorella thermoacetica [TaxId: 1525]} Back     information, alignment and structure
>d1xhfa1 c.23.1.1 (A:2-122) Aerobic respiration control protein ArcA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zh2a1 c.23.1.1 (A:2-120) Transcriptional regulatory protein KdpE, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e5da1 c.23.5.1 (A:251-402) Rubredoxin oxygen:oxidoreductase (ROO), C-terminal domain {Desulfovibrio gigas [TaxId: 879]} Back     information, alignment and structure
>d7reqa2 c.23.6.1 (A:561-728) Methylmalonyl-CoA mutase alpha subunit, C-terminal domain {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} Back     information, alignment and structure
>d2bona1 e.52.1.2 (A:5-299) Lipid kinase YegS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xkya1 c.1.10.1 (A:1-292) Dihydrodipicolinate synthase {Bacillus anthracis [TaxId: 1392]} Back     information, alignment and structure
>d1nu0a_ c.55.3.8 (A:) Hypothetical protein YqgF (RuvX) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w25a1 c.23.1.1 (A:2-140) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]} Back     information, alignment and structure
>d1iv0a_ c.55.3.8 (A:) Hypothetical protein, YqgF homologue {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2qv7a1 e.52.1.2 (A:1-312) Diacylglycerol kinase DgkB {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d3bzka5 c.55.3.13 (A:325-473) Transcriptional accessory factor Tex {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1dnpa2 c.28.1.1 (A:1-200) DNA photolyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1krwa_ c.23.1.1 (A:) NTRC receiver domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure