Citrus Sinensis ID: 031262

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160--
MRKRVMVVVDQTSHSKHAMMWALTHVTNKGDLLTLLHVVPPPKPNTSHHDSSACCPYLANSLGSLCKACKPEVEVEALVIQGPKLGTVMSQVRKLEVSVLVLGQKKHSAFINCFCGTSSSEEFVDQCIKKADCLTVGVRKQSKGMGGYIISTRWQKNFWLLA
cccEEEEEEcccHHHHHHHHHHHHHHHccccEEEEEEEEcccccccccccccccHHHHHHHHHHHHHHccccccEEEEEEEccHHHHHHHHHHHccccEEEEccccccccEEEEEccccccHHHHHHHHcccEEEEEEEcccccccEEEEEccccccEEEEc
cccEEEEEEcccHHHHHHHHHHHHHHcccccEEEEEEEEcccccccccccHHHHHHHHHHHHHHHHHHcccccEEEEEEEEcccHHHHHHHHHHccccEEEEEcccccHHHHHEccccccccHHHHHHHcccccEEEEEcccccccEEEEEEcccccEEEcc
MRKRVMVVVDQTSHSKHAMMWALTHVtnkgdlltllhvvpppkpntshhdssaccpYLANSLgslckackpevEVEALVIQGPKLGTVMSQVRKLEVSVLVLGQKKHSAFIncfcgtssseeFVDQCikkadcltvgvrkqskgmggyIISTRWQKNFWLLA
MRKRVMVVVDQTSHSKHAMMWALTHVTNKGDLLTLLHVVPPPKPNTSHHDSSACCPYLANSLGSLCKACKPEVEVEALVIQGPKLGTVMSQVRKLEVSVLVLGQKKHSAFINCFCGTSSSEEFVDQCIKKAdcltvgvrkqskgmggyiistrwqknfwLLA
MRKRVMVVVDQTSHSKHAMMWALTHVTNKGDLLTLLHVVPPPKPNTSHHDSSACCPYLANSLGSLCKACKPEVEVEALVIQGPKLGTVMSQVRKLEVSVLVLGQKKHSAFINCFCGTSSSEEFVDQCIKKADCLTVGVRKQSKGMGGYIISTRWQKNFWLLA
******VVV*****SKHAMMWALTHVTNKGDLLTLLHVV************SACCPYLANSLGSLCKACKPEVEVEALVIQGPKLGTVMSQVRKLEVSVLVLGQKKHSAFINCFCGTSSSEEFVDQCIKKADCLTVGVRKQSKGMGGYIISTRWQKNFWLL*
MRKRVMVVVDQTSHSKHAMMWALTHVTNKGDLLTLLHVVPPPKPNTSHHDSSACCPYLANSLGSLCKACKPEVEVEALVIQGPKLGTVMSQVRKLEVSVLVLGQKKHSAFINCFCGTSSSEEFVDQCIKKADCLTVGVRKQS******IISTRWQKNFWLLA
*************HSKHAMMWALTHVTNKGDLLTLLHVVPPP*********SACCPYLANSLGSLCKACKPEVEVEALVIQGPKLGTVMSQVRKLEVSVLVLGQKKHSAFINCFCGTSSSEEFVDQCIKKADCLTVGVRKQSKGMGGYIISTRWQKNFWLLA
*RKRVMVVVDQTSHSKHAMMWALTHVTNKGDLLTLLHVVPPPKPNTSHHDSSACCPYLANSLGSLCKACKPEVEVEALVIQGPKLGTVMSQVRKLEVSVLVLGQKKHSAFINCFCGTSSSEEFVDQCIKKADCLTVGVRKQSKGMGGYIISTRWQKNFWLLA
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRKRVMVVVDQTSHSKHAMMWALTHVTNKGDLLTLLHVVPPPKPNTSHHDSSACCPYLANSLGSLCKACKPEVEVEALVIQGPKLGTVMSQVRKLEVSVLVLGQKKHSAFINCFCGTSSSEEFVDQCIKKADCLTVGVRKQSKGMGGYIISTRWQKNFWLLA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query162
224082284162 predicted protein [Populus trichocarpa] 1.0 1.0 0.765 7e-68
147794988219 hypothetical protein VITISV_006651 [Viti 0.944 0.698 0.758 2e-63
225459542219 PREDICTED: uncharacterized protein LOC10 0.944 0.698 0.758 3e-63
356552666227 PREDICTED: uncharacterized protein LOC10 0.962 0.687 0.737 1e-61
297852222217 universal stress protein family protein 0.932 0.695 0.743 1e-61
356515886217 PREDICTED: uncharacterized protein LOC10 0.962 0.718 0.737 2e-61
255646082217 unknown [Glycine max] 0.962 0.718 0.737 2e-61
15219439213 adenine nucleotide alpha hydrolase-like 0.932 0.708 0.731 3e-61
157849662215 universal stress protein family protein 0.938 0.706 0.720 1e-60
255545478220 conserved hypothetical protein [Ricinus 0.919 0.677 0.751 4e-60
>gi|224082284|ref|XP_002306632.1| predicted protein [Populus trichocarpa] gi|222856081|gb|EEE93628.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  261 bits (667), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 124/162 (76%), Positives = 139/162 (85%)

Query: 1   MRKRVMVVVDQTSHSKHAMMWALTHVTNKGDLLTLLHVVPPPKPNTSHHDSSACCPYLAN 60
           MRKRV+VVVDQTSHSKHAMMWALTHV NKGDLLTLLH++PP    +    S A  PYLA+
Sbjct: 1   MRKRVVVVVDQTSHSKHAMMWALTHVANKGDLLTLLHIIPPSDIGSGERTSDAYSPYLAS 60

Query: 61  SLGSLCKACKPEVEVEALVIQGPKLGTVMSQVRKLEVSVLVLGQKKHSAFINCFCGTSSS 120
           SLGSLCKA +PEVEVEALVIQGPKLGTVMSQV+KLE SVLVLGQK+ S  I+C CGTSSS
Sbjct: 61  SLGSLCKASRPEVEVEALVIQGPKLGTVMSQVKKLEASVLVLGQKRPSTLISCLCGTSSS 120

Query: 121 EEFVDQCIKKADCLTVGVRKQSKGMGGYIISTRWQKNFWLLA 162
           E+FV QCI  A+CLTVGVRKQS+GM GY+I+TR QK+FWLLA
Sbjct: 121 EDFVQQCISNAECLTVGVRKQSQGMSGYLITTRRQKDFWLLA 162

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|147794988|emb|CAN67424.1| hypothetical protein VITISV_006651 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225459542|ref|XP_002285849.1| PREDICTED: uncharacterized protein LOC100248801 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356552666|ref|XP_003544684.1| PREDICTED: uncharacterized protein LOC100816511 [Glycine max] Back     alignment and taxonomy information
>gi|297852222|ref|XP_002893992.1| universal stress protein family protein [Arabidopsis lyrata subsp. lyrata] gi|297339834|gb|EFH70251.1| universal stress protein family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|356515886|ref|XP_003526628.1| PREDICTED: uncharacterized protein LOC100777817 [Glycine max] Back     alignment and taxonomy information
>gi|255646082|gb|ACU23528.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|15219439|ref|NP_175097.1| adenine nucleotide alpha hydrolase-like protein [Arabidopsis thaliana] gi|8655986|gb|AAF78259.1|AC020576_3 Contains similarity to hypothetical protein F19B11.17 gi|4406763 from Arabidopsis thaliana BAC F19B11 gb|AC006836 [Arabidopsis thaliana] gi|17380776|gb|AAL36218.1| unknown protein [Arabidopsis thaliana] gi|29824171|gb|AAP04046.1| unknown protein [Arabidopsis thaliana] gi|332193926|gb|AEE32047.1| adenine nucleotide alpha hydrolase-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|157849662|gb|ABV89614.1| universal stress protein family protein [Brassica rapa] Back     alignment and taxonomy information
>gi|255545478|ref|XP_002513799.1| conserved hypothetical protein [Ricinus communis] gi|223546885|gb|EEF48382.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query162
TAIR|locus:2194824213 AT1G44760 "AT1G44760" [Arabido 0.932 0.708 0.737 6.6e-58
TAIR|locus:2044274165 MRH6 "AT2G03720" [Arabidopsis 0.962 0.945 0.355 8e-21
TAIR|locus:2178920285 AT5G17390 "AT5G17390" [Arabido 0.981 0.557 0.327 6.5e-19
TAIR|locus:2097735274 AT3G03290 "AT3G03290" [Arabido 0.981 0.580 0.333 2.2e-18
TAIR|locus:2033245223 AT1G69080 "AT1G69080" [Arabido 0.703 0.511 0.354 1.4e-16
TAIR|locus:2142130219 AT4G13450 "AT4G13450" [Arabido 0.598 0.442 0.327 1.4e-15
TAIR|locus:2028516219 AT1G48960 "AT1G48960" [Arabido 0.648 0.479 0.3 1.6e-06
TAIR|locus:2096089162 AT3G62550 "AT3G62550" [Arabido 0.413 0.413 0.291 2.4e-05
TAIR|locus:2194824 AT1G44760 "AT1G44760" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 595 (214.5 bits), Expect = 6.6e-58, P = 6.6e-58
 Identities = 118/160 (73%), Positives = 133/160 (83%)

Query:     3 KRVMVVVDQTSHSKHAMMWALTHVTNKGDLLTLLHVVPPPKPNTSHHDSSACCPYLANSL 62
             KRVMVVVD++S SKHAMMWALTH+TNKGDL+TLLHVV P        D  A  P LA SL
Sbjct:    63 KRVMVVVDESSRSKHAMMWALTHLTNKGDLVTLLHVVSP--------DDEAT-PSLAQSL 113

Query:    63 GSLCKACKPEVEVEALVIQGPKLGTVMSQVRKLEVSVLVLGQKKHSAFINCFCGTSSSEE 122
             GSLCKACKPEV+VEALVIQGPKL TV+SQV+KLEVSVLVLGQKK +  I+C CG S SEE
Sbjct:   114 GSLCKACKPEVDVEALVIQGPKLATVLSQVKKLEVSVLVLGQKKSAPLISCLCGPSRSEE 173

Query:   123 FVDQCIKKADCLTVGVRKQSKGMGGYIISTRWQKNFWLLA 162
              V++CI  ADCLT+GVRKQ KG+GGY+I+TRWQKNFWLLA
Sbjct:   174 LVNRCINGADCLTIGVRKQCKGVGGYLINTRWQKNFWLLA 213
GO:0003674 "molecular_function" evidence=ND
GO:0002238 "response to molecule of fungal origin" evidence=RCA
TAIR|locus:2044274 MRH6 "AT2G03720" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2178920 AT5G17390 "AT5G17390" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2097735 AT3G03290 "AT3G03290" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2033245 AT1G69080 "AT1G69080" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2142130 AT4G13450 "AT4G13450" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2028516 AT1G48960 "AT1G48960" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2096089 AT3G62550 "AT3G62550" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query162
cd00293130 cd00293, USP_Like, Usp: Universal stress protein f 6e-13
pfam00582139 pfam00582, Usp, Universal stress protein family 2e-10
cd01989146 cd01989, STK_N, The N-terminal domain of Eukaryoti 2e-04
>gnl|CDD|238182 cd00293, USP_Like, Usp: Universal stress protein family Back     alignment and domain information 
 Score = 61.6 bits (150), Expect = 6e-13
 Identities = 32/131 (24%), Positives = 57/131 (43%), Gaps = 7/131 (5%)

Query: 4   RVMVVVDQTSHSKHAMMWALTHVTNKGDLLTLLHVVPPPKPNTSHHDSSACCPYLANSLG 63
           R++V VD +  S+ A+ WA       G  L LLHVV PP  + +              L 
Sbjct: 1   RILVAVDGSEESERALRWAARLARRLGAELVLLHVVDPPPSSAAELAELL-EEEARALLE 59

Query: 64  SLCKACK-PEVEVEALVIQGPKLGTVMSQVRKLEVSVLVLGQKKHSAFINCFCGTSSSEE 122
           +L +A     V+VE +V++G     ++    +L   ++V+G +  S       G+     
Sbjct: 60  ALREALAEAGVKVETVVLEGDPAEAILEAAEELGADLIVMGSRGRSGLRRLLLGS----- 114

Query: 123 FVDQCIKKADC 133
             ++ ++ A C
Sbjct: 115 VAERVLRHAPC 125

The universal stress protein Usp is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents. Usp enhances the rate of cell survival during prolonged exposure to such conditions, and may provide a general "stress endurance" activity. The crystal structure of Haemophilus influenzae Usp reveals an alpha/beta fold similar to that of the Methanococcus jannaschii MJ0577 protein, which binds ATP, athough Usp lacks ATP-binding activity. Length = 130
>gnl|CDD|216006 pfam00582, Usp, Universal stress protein family Back     alignment and domain information
>gnl|CDD|238947 cd01989, STK_N, The N-terminal domain of Eukaryotic Serine Threonine kinases Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 162
PRK15005144 universal stress protein F; Provisional 99.96
PRK15456142 universal stress protein UspG; Provisional 99.96
cd01989146 STK_N The N-terminal domain of Eukaryotic Serine T 99.94
PRK09982142 universal stress protein UspD; Provisional 99.94
PRK15118144 universal stress global response regulator UspA; P 99.93
PF00582140 Usp: Universal stress protein family; InterPro: IP 99.92
PRK10116142 universal stress protein UspC; Provisional 99.91
cd01988132 Na_H_Antiporter_C The C-terminal domain of a subfa 99.91
PRK11175 305 universal stress protein UspE; Provisional 99.9
cd01987124 USP_OKCHK USP domain is located between the N-term 99.9
PRK11175305 universal stress protein UspE; Provisional 99.87
COG0589154 UspA Universal stress protein UspA and related nuc 99.84
cd00293130 USP_Like Usp: Universal stress protein family. The 99.84
PRK12652 357 putative monovalent cation/H+ antiporter subunit E 99.7
PRK10490 895 sensor protein KdpD; Provisional 99.22
COG2205 890 KdpD Osmosensitive K+ channel histidine kinase [Si 99.03
cd0198486 AANH_like Adenine nucleotide alpha hydrolases supe 98.79
PLN03159 832 cation/H(+) antiporter 15; Provisional 97.5
TIGR02432189 lysidine_TilS_N tRNA(Ile)-lysidine synthetase, N-t 97.22
PF01171182 ATP_bind_3: PP-loop family; InterPro: IPR011063 Th 97.16
cd01992185 PP-ATPase N-terminal domain of predicted ATPase of 96.84
PLN03159832 cation/H(+) antiporter 15; Provisional 96.72
COG0037 298 MesJ tRNA(Ile)-lysidine synthase MesJ [Cell cycle 96.33
cd01993185 Alpha_ANH_like_II This is a subfamily of Adenine n 95.6
PRK10696258 tRNA 2-thiocytidine biosynthesis protein TtcA; Pro 95.19
PF01012164 ETF: Electron transfer flavoprotein domain; InterP 93.77
PRK03359256 putative electron transfer flavoprotein FixA; Revi 93.39
PRK10660 436 tilS tRNA(Ile)-lysidine synthetase; Provisional 93.15
PRK07313182 phosphopantothenoylcysteine decarboxylase; Validat 93.09
PRK12342254 hypothetical protein; Provisional 92.85
PRK13820 394 argininosuccinate synthase; Provisional 92.78
PRK05253 301 sulfate adenylyltransferase subunit 2; Provisional 92.72
TIGR00591 454 phr2 photolyase PhrII. All proteins in this family 92.19
TIGR00268252 conserved hypothetical protein TIGR00268. The N-te 91.38
PRK05579 399 bifunctional phosphopantothenoylcysteine decarboxy 90.87
PF00875165 DNA_photolyase: DNA photolyase from Prosite.; Inte 90.63
PRK13982 475 bifunctional SbtC-like/phosphopantothenoylcysteine 90.56
COG2086260 FixA Electron transfer flavoprotein, beta subunit 90.41
cd01713173 PAPS_reductase This domain is found in phosphoaden 89.72
TIGR01162156 purE phosphoribosylaminoimidazole carboxylase, Pur 89.25
TIGR02039 294 CysD sulfate adenylyltransferase, small subunit. I 88.84
cd01995169 ExsB ExsB is a transcription regulator related pro 88.79
PLN00200 404 argininosuccinate synthase; Provisional 88.31
TIGR02113177 coaC_strep phosphopantothenoylcysteine decarboxyla 88.28
PF02601 319 Exonuc_VII_L: Exonuclease VII, large subunit; Inte 87.81
TIGR00521 390 coaBC_dfp phosphopantothenoylcysteine decarboxylas 87.7
cd01990202 Alpha_ANH_like_I This is a subfamily of Adenine nu 87.4
COG0041162 PurE Phosphoribosylcarboxyaminoimidazole (NCAIR) m 86.66
TIGR02765 429 crypto_DASH cryptochrome, DASH family. Photolyases 86.34
KOG1650769 consensus Predicted K+/H+-antiporter [Inorganic io 85.95
TIGR00342371 thiazole biosynthesis/tRNA modification protein Th 85.32
PF00731150 AIRC: AIR carboxylase; InterPro: IPR000031 Phospho 84.62
TIGR00884 311 guaA_Cterm GMP synthase (glutamine-hydrolyzing), C 83.33
TIGR03556 471 photolyase_8HDF deoxyribodipyrimidine photo-lyase, 83.13
PRK12563 312 sulfate adenylyltransferase subunit 2; Provisional 82.43
PRK10867 433 signal recognition particle protein; Provisional 82.25
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 81.97
), forming GARS-AIRS-GART. This entry represents the N-domain, which is related to the N-terminal domain of biotin carboxylase/carbamoyl phosphate synthetase (IPR005481 from INTERPRO).; GO: 0004637 phosphoribosylamine-glycine ligase activity, 0009113 purine base biosynthetic process; PDB: 3MJF_A 2XD4_A 2XCL_A 2IP4_A 2YW2_B 2YYA_A 3LP8_A 1VKZ_A 2YS6_A 2YRX_A ...." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF02844">PF02844100 GARS_N: Phosphoribosylglycinamide synthetase, N do 81.9
PRK00286 438 xseA exodeoxyribonuclease VII large subunit; Revie 81.56
cd01986103 Alpha_ANH_like Adenine nucleotide alpha hydrolases 81.54
PRK09423 366 gldA glycerol dehydrogenase; Provisional 80.76
>PRK15005 universal stress protein F; Provisional Back     alignment and domain information 
Probab=99.96  E-value=6e-28  Score=168.73  Aligned_cols=133  Identities=15%  Similarity=0.292  Sum_probs=106.1

Q ss_pred             CCcEEEEEeCCChh--hHHHHHHHHHhccCCCCEEEEEEEeCCCCCCCCCC----Cc----cccchHHHHHHHHhHHHhC
Q 031262            1 MRKRVMVVVDQTSH--SKHAMMWALTHVTNKGDLLTLLHVVPPPKPNTSHH----DS----SACCPYLANSLGSLCKACK   70 (162)
Q Consensus         1 m~~~Ilv~vD~S~~--s~~al~~A~~~a~~~~~~l~l~hv~~~~~~~~~~~----~~----~~~~~~~~~~~~~~~~~~~   70 (162)
                      |+++||+|+|+|+.  +..|++||.++|+..+++++++||+++........    ..    ....++..+.++++++.+.
T Consensus         1 m~~~ILv~~D~s~~~~~~~a~~~a~~la~~~~~~l~ll~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~   80 (144)
T PRK15005          1 MNRTILVPIDISDSELTQRVISHVEAEAKIDDAEVHFLTVIPSLPYYASLGLAYSAELPAMDDLKAEAKSQLEEIIKKFK   80 (144)
T ss_pred             CCccEEEecCCCchhHHHHHHHHHHHHHhccCCeEEEEEEEccCcccccccccccccchHHHHHHHHHHHHHHHHHHHhC
Confidence            89999999999997  57999999999999999999999997543221110    00    1122333345555555543


Q ss_pred             -CCCeEEEEEEecCchhHHHHHHHhcCCCEEEEccCCCCcccccccccCCcchhHHHhhhhCCceEEEEe
Q 031262           71 -PEVEVEALVIQGPKLGTVMSQVRKLEVSVLVLGQKKHSAFINCFCGTSSSEEFVDQCIKKADCLTVGVR  139 (162)
Q Consensus        71 -~~v~~~~~v~~g~~~~~I~~~a~~~~~dliVmG~~~~~~~~~~~~Gs~~~~~~~~~v~~~~~~pVlvv~  139 (162)
                       ++++++..+..|++.+.|+++++++++||||||+++ +.+.+.++||++     ++|+++++||||+||
T Consensus        81 ~~~~~~~~~v~~G~p~~~I~~~a~~~~~DLIV~Gs~~-~~~~~~llGS~a-----~~vl~~a~cpVlvVr  144 (144)
T PRK15005         81 LPTDRVHVHVEEGSPKDRILELAKKIPADMIIIASHR-PDITTYLLGSNA-----AAVVRHAECSVLVVR  144 (144)
T ss_pred             CCCCceEEEEeCCCHHHHHHHHHHHcCCCEEEEeCCC-CCchheeecchH-----HHHHHhCCCCEEEeC
Confidence             567788889999999999999999999999999985 568899999999     999999999999986

>PRK15456 universal stress protein UspG; Provisional Back     alignment and domain information
>cd01989 STK_N The N-terminal domain of Eukaryotic Serine Threonine kinases Back     alignment and domain information
>PRK09982 universal stress protein UspD; Provisional Back     alignment and domain information
>PRK15118 universal stress global response regulator UspA; Provisional Back     alignment and domain information
>PF00582 Usp: Universal stress protein family; InterPro: IPR006016 The universal stress protein UspA P28242 from SWISSPROT [] is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents Back     alignment and domain information
>PRK10116 universal stress protein UspC; Provisional Back     alignment and domain information
>cd01988 Na_H_Antiporter_C The C-terminal domain of a subfamily of Na+ /H+ antiporter existed in bacteria and archea Back     alignment and domain information
>PRK11175 universal stress protein UspE; Provisional Back     alignment and domain information
>cd01987 USP_OKCHK USP domain is located between the N-terminal sensor domain and C-terminal catalytic domain of this Osmosensitive K+ channel histidine kinase family Back     alignment and domain information
>PRK11175 universal stress protein UspE; Provisional Back     alignment and domain information
>COG0589 UspA Universal stress protein UspA and related nucleotide-binding proteins [Signal transduction mechanisms] Back     alignment and domain information
>cd00293 USP_Like Usp: Universal stress protein family Back     alignment and domain information
>PRK12652 putative monovalent cation/H+ antiporter subunit E; Reviewed Back     alignment and domain information
>PRK10490 sensor protein KdpD; Provisional Back     alignment and domain information
>COG2205 KdpD Osmosensitive K+ channel histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd01984 AANH_like Adenine nucleotide alpha hydrolases superfamily including N type ATP PPases, ATP sulphurylases Universal Stress Response protein and electron transfer flavoprotein (ETF) Back     alignment and domain information
>PLN03159 cation/H(+) antiporter 15; Provisional Back     alignment and domain information
>TIGR02432 lysidine_TilS_N tRNA(Ile)-lysidine synthetase, N-terminal domain Back     alignment and domain information
>PF01171 ATP_bind_3: PP-loop family; InterPro: IPR011063 This entry represents the PP-loop motif superfamily [,] Back     alignment and domain information
>cd01992 PP-ATPase N-terminal domain of predicted ATPase of the PP-loop faimly implicated in cell cycle control [Cell division and chromosome partitioning] Back     alignment and domain information
>PLN03159 cation/H(+) antiporter 15; Provisional Back     alignment and domain information
>COG0037 MesJ tRNA(Ile)-lysidine synthase MesJ [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd01993 Alpha_ANH_like_II This is a subfamily of Adenine nucleotide alpha hydrolases superfamily Back     alignment and domain information
>PRK10696 tRNA 2-thiocytidine biosynthesis protein TtcA; Provisional Back     alignment and domain information
>PF01012 ETF: Electron transfer flavoprotein domain; InterPro: IPR014730 Electron transfer flavoproteins (ETFs) serve as specific electron acceptors for primary dehydrogenases, transferring the electrons to terminal respiratory systems Back     alignment and domain information
>PRK03359 putative electron transfer flavoprotein FixA; Reviewed Back     alignment and domain information
>PRK10660 tilS tRNA(Ile)-lysidine synthetase; Provisional Back     alignment and domain information
>PRK07313 phosphopantothenoylcysteine decarboxylase; Validated Back     alignment and domain information
>PRK12342 hypothetical protein; Provisional Back     alignment and domain information
>PRK13820 argininosuccinate synthase; Provisional Back     alignment and domain information
>PRK05253 sulfate adenylyltransferase subunit 2; Provisional Back     alignment and domain information
>TIGR00591 phr2 photolyase PhrII Back     alignment and domain information
>TIGR00268 conserved hypothetical protein TIGR00268 Back     alignment and domain information
>PRK05579 bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Validated Back     alignment and domain information
>PF00875 DNA_photolyase: DNA photolyase from Prosite Back     alignment and domain information
>PRK13982 bifunctional SbtC-like/phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Provisional Back     alignment and domain information
>COG2086 FixA Electron transfer flavoprotein, beta subunit [Energy production and conversion] Back     alignment and domain information
>cd01713 PAPS_reductase This domain is found in phosphoadenosine phosphosulphate (PAPS) reductase enzymes or PAPS sulphotransferase Back     alignment and domain information
>TIGR01162 purE phosphoribosylaminoimidazole carboxylase, PurE protein Back     alignment and domain information
>TIGR02039 CysD sulfate adenylyltransferase, small subunit Back     alignment and domain information
>cd01995 ExsB ExsB is a transcription regulator related protein Back     alignment and domain information
>PLN00200 argininosuccinate synthase; Provisional Back     alignment and domain information
>TIGR02113 coaC_strep phosphopantothenoylcysteine decarboxylase, streptococcal Back     alignment and domain information
>PF02601 Exonuc_VII_L: Exonuclease VII, large subunit; InterPro: IPR020579 Exonuclease VII 3 Back     alignment and domain information
>TIGR00521 coaBC_dfp phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase, prokaryotic Back     alignment and domain information
>cd01990 Alpha_ANH_like_I This is a subfamily of Adenine nucleotide alpha hydrolases superfamily Back     alignment and domain information
>COG0041 PurE Phosphoribosylcarboxyaminoimidazole (NCAIR) mutase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR02765 crypto_DASH cryptochrome, DASH family Back     alignment and domain information
>KOG1650 consensus Predicted K+/H+-antiporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00342 thiazole biosynthesis/tRNA modification protein ThiI Back     alignment and domain information
>PF00731 AIRC: AIR carboxylase; InterPro: IPR000031 Phosphoribosylaminoimidazole carboxylase is a fusion protein in plants and fungi, but consists of two non-interacting proteins in bacteria, PurK and PurE Back     alignment and domain information
>TIGR00884 guaA_Cterm GMP synthase (glutamine-hydrolyzing), C-terminal domain or B subunit Back     alignment and domain information
>TIGR03556 photolyase_8HDF deoxyribodipyrimidine photo-lyase, 8-HDF type Back     alignment and domain information
>PRK12563 sulfate adenylyltransferase subunit 2; Provisional Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PF02844 GARS_N: Phosphoribosylglycinamide synthetase, N domain; InterPro: IPR020562 Phosphoribosylglycinamide synthetase (6 Back     alignment and domain information
>PRK00286 xseA exodeoxyribonuclease VII large subunit; Reviewed Back     alignment and domain information
>cd01986 Alpha_ANH_like Adenine nucleotide alpha hydrolases superfamily including N type ATP PPases and ATP sulphurylases Back     alignment and domain information
>PRK09423 gldA glycerol dehydrogenase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query162
2gm3_A175 Unknown protein; AT3G01520, putative ethylene-resp 9e-10
3olq_A 319 Universal stress protein E; structural genomics, P 7e-07
3dlo_A155 Universal stress protein; unknown function, struct 4e-06
3idf_A138 USP-like protein; universal, stress, PSI, MCSG, st 2e-04
3loq_A 294 Universal stress protein; structural genomics, PSI 2e-04
3mt0_A 290 Uncharacterized protein PA1789; structural genomic 9e-04
>2gm3_A Unknown protein; AT3G01520, putative ethylene-responsive protein, USP domain, nucleotide binding domain, AMP; HET: MSE AMP; 2.46A {Arabidopsis thaliana} SCOP: c.26.2.4 Length = 175 Back     alignment and structure
 Score = 53.7 bits (129), Expect = 9e-10
 Identities = 34/156 (21%), Positives = 50/156 (32%), Gaps = 30/156 (19%)

Query: 3   KRVMVVVD---------QTSHSKHAMMWALTHVTNKGDL---LTLLHVVPPPKPNTSHHD 50
            +VMV V+          +   K A  W L  +         + LLHV    +      D
Sbjct: 6   TKVMVAVNASTIKDYPNPSISCKRAFEWTLEKIVRSNTSDFKILLLHVQVVDEDGFDDVD 65

Query: 51  SSACCPYLANS------------LGSLCKACKPE-VEVEALVIQGPKLGTVMSQVRKLEV 97
           S    P                 L      C    V  EA +  G     +  +V+++  
Sbjct: 66  SIYASPEDFRDMRQSNKAKGLHLLEFFVNKCHEIGVGCEAWIKTGDPKDVICQEVKRVRP 125

Query: 98  SVLVLGQKKHSAFINCFCGTSSSEEFVDQCIKKADC 133
             LV+G +    F   F GT S       C+K A+C
Sbjct: 126 DFLVVGSRGLGRFQKVFVGTVS-----AFCVKHAEC 156
>3olq_A Universal stress protein E; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: UNL; 1.82A {Proteus mirabilis} Length = 319 Back     alignment and structure
>3dlo_A Universal stress protein; unknown function, structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics; HET: MSE; 1.97A {Archaeoglobus fulgidus} PDB: 3qtb_A* Length = 155 Back     alignment and structure
>3idf_A USP-like protein; universal, stress, PSI, MCSG, structural genomics, midwest center for structural genomics structure initiative; 2.00A {Wolinella succinogenes} Length = 138 Back     alignment and structure
>3loq_A Universal stress protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: AMP; 2.32A {Archaeoglobus fulgidus} Length = 294 Back     alignment and structure
>3mt0_A Uncharacterized protein PA1789; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 1.58A {Pseudomonas aeruginosa} Length = 290 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query162
1mjh_A162 Protein (ATP-binding domain of protein MJ0577); hy 99.96
3s3t_A146 Nucleotide-binding protein, universal stress PROT 99.95
3hgm_A147 Universal stress protein TEAD; rossman fold, signa 99.95
2z08_A137 Universal stress protein family; uncharacterized c 99.95
1tq8_A163 Hypothetical protein RV1636; MTCY01B2.28, structur 99.95
3tnj_A150 Universal stress protein (USP); structural genomic 99.95
2dum_A170 Hypothetical protein PH0823; conserved hypothetica 99.95
3dlo_A155 Universal stress protein; unknown function, struct 99.95
3idf_A138 USP-like protein; universal, stress, PSI, MCSG, st 99.94
3fg9_A156 Protein of universal stress protein USPA family; A 99.94
3fdx_A143 Putative filament protein / universal stress PROT; 99.94
2gm3_A175 Unknown protein; AT3G01520, putative ethylene-resp 99.93
1jmv_A141 USPA, universal stress protein A; chaperone; 1.85A 99.93
3olq_A 319 Universal stress protein E; structural genomics, P 99.91
3mt0_A 290 Uncharacterized protein PA1789; structural genomic 99.9
3loq_A 294 Universal stress protein; structural genomics, PSI 99.9
1q77_A138 Hypothetical protein AQ_178; structural genomics, 99.9
3cis_A 309 Uncharacterized protein; alpha/beta hydrolase, ATP 99.9
3mt0_A290 Uncharacterized protein PA1789; structural genomic 99.89
3ab8_A268 Putative uncharacterized protein TTHA0350; tandem- 99.89
3loq_A294 Universal stress protein; structural genomics, PSI 99.89
3cis_A309 Uncharacterized protein; alpha/beta hydrolase, ATP 99.87
3olq_A319 Universal stress protein E; structural genomics, P 99.87
3ab8_A268 Putative uncharacterized protein TTHA0350; tandem- 99.81
2iel_A138 Hypothetical protein TT0030; TT0030,thermus thermo 95.82
3a2k_A 464 TRNA(Ile)-lysidine synthase; ligase, pseudo-knot, 95.25
1wy5_A 317 TILS, hypothetical UPF0072 protein AQ_1887; N-type 95.04
1zun_A 325 Sulfate adenylyltransferase subunit 2; beta barrel 91.79
2xry_A 482 Deoxyribodipyrimidine photolyase; DNA damage, DNA 91.39
4b4k_A181 N5-carboxyaminoimidazole ribonucleotide mutase; is 90.85
4grd_A173 N5-CAIR mutase, phosphoribosylaminoimidazole carbo 90.71
3trh_A169 Phosphoribosylaminoimidazole carboxylase carboxylt 89.83
3oow_A166 Phosphoribosylaminoimidazole carboxylase,catalyic; 89.62
3kuu_A174 Phosphoribosylaminoimidazole carboxylase catalyti 89.25
2ywx_A157 Phosphoribosylaminoimidazole carboxylase catalyti; 89.14
3umv_A 506 Deoxyribodipyrimidine photo-lyase; CPD cyclobutane 89.02
3ors_A163 N5-carboxyaminoimidazole ribonucleotide mutase; is 88.9
1xmp_A170 PURE, phosphoribosylaminoimidazole carboxylase; pu 88.72
3lp6_A174 Phosphoribosylaminoimidazole carboxylase catalyti; 88.63
1o4v_A183 Phosphoribosylaminoimidazole mutase PURE; structur 88.37
1sur_A215 PAPS reductase; assimilatory sulfate reduction, 3- 88.14
3rg8_A159 Phosphoribosylaminoimidazole carboxylase, PURE PR; 87.61
1k92_A 455 Argininosuccinate synthase, argininosuccinate SY; 87.57
1u11_A182 PURE (N5-carboxyaminoimidazole ribonucleotide MUT; 87.53
2pg3_A232 Queuosine biosynthesis protein QUEC; YP_049261.1, 87.32
3da8_A215 Probable 5'-phosphoribosylglycinamide formyltransf 86.18
3kcq_A215 Phosphoribosylglycinamide formyltransferase; struc 85.95
3ih5_A217 Electron transfer flavoprotein alpha-subunit; alph 85.66
2nz2_A 413 Argininosuccinate synthase; amino-acid biosynthesi 85.57
3g40_A294 Na-K-CL cotransporter; alpha/beta fold 10-stranded 85.41
1g63_A181 Epidermin modifying enzyme EPID; alpha, beta prote 85.39
1ni5_A 433 Putative cell cycle protein MESJ; structural genom 85.0
3g40_A 294 Na-K-CL cotransporter; alpha/beta fold 10-stranded 84.95
2oq2_A261 Phosphoadenosine phosphosulfate reductase; sulfate 84.36
3bl5_A219 Queuosine biosynthesis protein QUEC; PREQ1 biosynt 84.08
3p9x_A211 Phosphoribosylglycinamide formyltransferase; struc 82.93
2ywb_A 503 GMP synthase [glutamine-hydrolyzing]; GMP syntheta 82.91
1o97_C264 Electron transferring flavoprotein beta-subunit; F 82.33
2c5s_A413 THII, probable thiamine biosynthesis protein THII; 81.68
1efp_B252 ETF, protein (electron transfer flavoprotein); ele 80.86
1iv0_A98 Hypothetical protein; rnaseh-like, YQGF, structura 80.42
1kor_A 400 Argininosuccinate synthetase; ligase, riken struct 80.22
1efv_B255 Electron transfer flavoprotein; electron transport 80.18
>1mjh_A Protein (ATP-binding domain of protein MJ0577); hypothetical protein, structural genomics, functional assignment; HET: ATP; 1.70A {Methanocaldococcus jannaschii} SCOP: c.26.2.4 Back     alignment and structure
Probab=99.96  E-value=6.3e-28  Score=170.22  Aligned_cols=134  Identities=15%  Similarity=0.227  Sum_probs=106.4

Q ss_pred             CCcEEEEEeCCChhhHHHHHHHHHhccCCCCEEEEEEEeCCC-----C--CCCCCC----Cc------------cccchH
Q 031262            1 MRKRVMVVVDQTSHSKHAMMWALTHVTNKGDLLTLLHVVPPP-----K--PNTSHH----DS------------SACCPY   57 (162)
Q Consensus         1 m~~~Ilv~vD~S~~s~~al~~A~~~a~~~~~~l~l~hv~~~~-----~--~~~~~~----~~------------~~~~~~   57 (162)
                      |+++||||+|+|+.+..|++||+.+|+..+++|+++||+++.     .  ......    +.            .+..++
T Consensus         4 ~~~~ILv~vD~s~~s~~al~~a~~la~~~~a~l~ll~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   83 (162)
T 1mjh_A            4 MYKKILYPTDFSETAEIALKHVKAFKTLKAEEVILLHVIDEREIKKRDIFSLLLGVAGLNKSVEEFENELKNKLTEEAKN   83 (162)
T ss_dssp             CCCEEEEECCSCHHHHHHHHHHHHTCCSSCCEEEEEEEEEGGGTC-----------------CHHHHHHHHHHHHHHHHH
T ss_pred             ccceEEEEeCCCHHHHHHHHHHHHHHhhcCCeEEEEEEecCccccccccccccccccccccchhhhHHHHHHHHHHHHHH
Confidence            689999999999999999999999999999999999999753     1  111000    11            011122


Q ss_pred             HHHHHHHhHHHhCCCCeEEEEEEecCchhHHHHHHHhcCCCEEEEccCCCCcccccccccCCcchhHHHhhhhCCceEEE
Q 031262           58 LANSLGSLCKACKPEVEVEALVIQGPKLGTVMSQVRKLEVSVLVLGQKKHSAFINCFCGTSSSEEFVDQCIKKADCLTVG  137 (162)
Q Consensus        58 ~~~~~~~~~~~~~~~v~~~~~v~~g~~~~~I~~~a~~~~~dliVmG~~~~~~~~~~~~Gs~~~~~~~~~v~~~~~~pVlv  137 (162)
                      .++.+.+.+..  .++++++.+..|++.+.|++++++.++|+||||++|++.+.++++||++     ++|+++++|||++
T Consensus        84 ~l~~~~~~~~~--~g~~~~~~v~~G~~~~~I~~~a~~~~~dlIV~G~~g~~~~~~~~~GSv~-----~~vl~~~~~pVlv  156 (162)
T 1mjh_A           84 KMENIKKELED--VGFKVKDIIVVGIPHEEIVKIAEDEGVDIIIMGSHGKTNLKEILLGSVT-----ENVIKKSNKPVLV  156 (162)
T ss_dssp             HHHHHHHHHHH--TTCEEEEEEEEECHHHHHHHHHHHTTCSEEEEESCCSSCCTTCSSCHHH-----HHHHHHCCSCEEE
T ss_pred             HHHHHHHHHHH--cCCceEEEEcCCCHHHHHHHHHHHcCCCEEEEcCCCCCCccceEecchH-----HHHHHhCCCCEEE
Confidence            22222333333  6788888888999999999999999999999999999999999999999     9999999999999


Q ss_pred             EecC
Q 031262          138 VRKQ  141 (162)
Q Consensus       138 v~~~  141 (162)
                      ||+.
T Consensus       157 v~~~  160 (162)
T 1mjh_A          157 VKRK  160 (162)
T ss_dssp             ECCC
T ss_pred             EeCC
Confidence            9864
>3s3t_A Nucleotide-binding protein, universal stress PROT family; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: ATP; 1.90A {Lactobacillus plantarum} SCOP: c.26.2.0 Back     alignment and structure
>3hgm_A Universal stress protein TEAD; rossman fold, signaling protein; HET: ATP; 1.90A {Halomonas elongata} SCOP: c.26.2.0 Back     alignment and structure
>2z08_A Universal stress protein family; uncharacterized conserved protein, structural genomics, unknown function, NPPSFA; HET: ATP; 1.55A {Thermus thermophilus} SCOP: c.26.2.4 PDB: 1wjg_A* 2z09_A* 2z3v_A Back     alignment and structure
>1tq8_A Hypothetical protein RV1636; MTCY01B2.28, structural target, NYSGXRC, PSI, protein structure initiative; 2.40A {Mycobacterium tuberculosis} SCOP: c.26.2.4 Back     alignment and structure
>3tnj_A Universal stress protein (USP); structural genomics, PSI-biology, midwest center for structu genomics, MCSG, chaperone; HET: AMP; 2.00A {Nitrosomonas europaea} PDB: 2pfs_A* Back     alignment and structure
>2dum_A Hypothetical protein PH0823; conserved hypothetical protein, putative universal protein A structural genomics, NPPSFA; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>3dlo_A Universal stress protein; unknown function, structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics; HET: MSE; 1.97A {Archaeoglobus fulgidus} PDB: 3qtb_A* Back     alignment and structure
>3idf_A USP-like protein; universal, stress, PSI, MCSG, structural genomics, midwest center for structural genomics structure initiative; 2.00A {Wolinella succinogenes} Back     alignment and structure
>3fg9_A Protein of universal stress protein USPA family; APC60691, nucleotide- binding, lactobacillus plantarum WCFS1, structural genomics PSI-2; 1.47A {Lactobacillus plantarum} Back     alignment and structure
>3fdx_A Putative filament protein / universal stress PROT; structural genomics, APC60640.1, universal protein F, PSI-2; HET: MSE ATP; 1.58A {Klebsiella pneumoniae subsp} PDB: 3fh0_A* Back     alignment and structure
>2gm3_A Unknown protein; AT3G01520, putative ethylene-responsive protein, USP domain, nucleotide binding domain, AMP; HET: MSE AMP; 2.46A {Arabidopsis thaliana} SCOP: c.26.2.4 Back     alignment and structure
>1jmv_A USPA, universal stress protein A; chaperone; 1.85A {Haemophilus influenzae} SCOP: c.26.2.4 Back     alignment and structure
>3olq_A Universal stress protein E; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: UNL; 1.82A {Proteus mirabilis} Back     alignment and structure
>3mt0_A Uncharacterized protein PA1789; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 1.58A {Pseudomonas aeruginosa} Back     alignment and structure
>3loq_A Universal stress protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: AMP; 2.32A {Archaeoglobus fulgidus} Back     alignment and structure
>1q77_A Hypothetical protein AQ_178; structural genomics, universal stress protein, PSI, protein structure initiative; 2.70A {Aquifex aeolicus} SCOP: c.26.2.4 Back     alignment and structure
>3cis_A Uncharacterized protein; alpha/beta hydrolase, ATP, universal stress protein, unknown function; HET: ATP; 2.90A {Mycobacterium tuberculosis} PDB: 2jax_A* Back     alignment and structure
>3mt0_A Uncharacterized protein PA1789; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 1.58A {Pseudomonas aeruginosa} Back     alignment and structure
>3ab8_A Putative uncharacterized protein TTHA0350; tandem-type universal stress protein, unknown function; HET: ATP; 1.70A {Thermus thermophilus} PDB: 3ab7_A* Back     alignment and structure
>3loq_A Universal stress protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: AMP; 2.32A {Archaeoglobus fulgidus} Back     alignment and structure
>3cis_A Uncharacterized protein; alpha/beta hydrolase, ATP, universal stress protein, unknown function; HET: ATP; 2.90A {Mycobacterium tuberculosis} PDB: 2jax_A* Back     alignment and structure
>3olq_A Universal stress protein E; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: UNL; 1.82A {Proteus mirabilis} Back     alignment and structure
>3ab8_A Putative uncharacterized protein TTHA0350; tandem-type universal stress protein, unknown function; HET: ATP; 1.70A {Thermus thermophilus} PDB: 3ab7_A* Back     alignment and structure
>2iel_A Hypothetical protein TT0030; TT0030,thermus thermophilus, structural genomics, PSI, protein structure initiative; 1.60A {Thermus thermophilus} SCOP: c.26.2.4 Back     alignment and structure
>3a2k_A TRNA(Ile)-lysidine synthase; ligase, pseudo-knot, ligase/RNA complex; 3.65A {Geobacillus kaustophilus} Back     alignment and structure
>1wy5_A TILS, hypothetical UPF0072 protein AQ_1887; N-type ATP-ppase, structural genomics, translation, NPPSFA; 2.42A {Aquifex aeolicus} SCOP: c.26.2.5 d.229.1.1 PDB: 2e21_A* 2e89_A* Back     alignment and structure
>1zun_A Sulfate adenylyltransferase subunit 2; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae} SCOP: c.26.2.2 Back     alignment and structure
>2xry_A Deoxyribodipyrimidine photolyase; DNA damage, DNA repair; HET: FAD; 1.50A {Methanosarcina mazei} PDB: 2xrz_A* Back     alignment and structure
>4b4k_A N5-carboxyaminoimidazole ribonucleotide mutase; isomerase; 2.50A {Bacillus anthracis} Back     alignment and structure
>4grd_A N5-CAIR mutase, phosphoribosylaminoimidazole carboxylase catalyti; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures; 1.85A {Burkholderia cenocepacia} Back     alignment and structure
>3trh_A Phosphoribosylaminoimidazole carboxylase carboxyltransferase subunit; purines, pyrimidines, nucleosides, nucleotides, lyase; 2.20A {Coxiella burnetii} Back     alignment and structure
>3oow_A Phosphoribosylaminoimidazole carboxylase,catalyic; structural genomics, center for structural genomics of infec diseases, csgid; HET: MSE; 1.75A {Francisella tularensis subsp} SCOP: c.23.8.1 PDB: 3opq_A* Back     alignment and structure
>3kuu_A Phosphoribosylaminoimidazole carboxylase catalyti PURE; 3-layer (ABA) sandwich, rossmann fold, csgid, lyase, structu genomics; 1.41A {Yersinia pestis} SCOP: c.23.8.1 PDB: 1d7a_A* 1qcz_A 2ate_A* 2nsl_A* 2nsh_A* 2nsj_A* Back     alignment and structure
>2ywx_A Phosphoribosylaminoimidazole carboxylase catalyti; rossmann fold, structural genomics, NPPSFA; 2.31A {Methanocaldococcus jannaschii} Back     alignment and structure
>3umv_A Deoxyribodipyrimidine photo-lyase; CPD cyclobutane pyrimidine dimers, UV damaged DNA, DNA repai flavoprotein; HET: FAD; 1.71A {Oryza sativa japonica group} Back     alignment and structure
>3ors_A N5-carboxyaminoimidazole ribonucleotide mutase; isomerase, isomerase,biosynthetic protein; 1.45A {Staphylococcus aureus subsp} Back     alignment and structure
>1xmp_A PURE, phosphoribosylaminoimidazole carboxylase; purine biosynthesis, spine, lyase; 1.80A {Bacillus anthracis} SCOP: c.23.8.1 Back     alignment and structure
>3lp6_A Phosphoribosylaminoimidazole carboxylase catalyti; alpha and beta protein, structural genomics, PSI-2, protein initiative; 1.70A {Mycobacterium tuberculosis} SCOP: c.23.8.0 Back     alignment and structure
>1o4v_A Phosphoribosylaminoimidazole mutase PURE; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; 1.77A {Thermotoga maritima} SCOP: c.23.8.1 Back     alignment and structure
>1sur_A PAPS reductase; assimilatory sulfate reduction, 3-phospho-adenylyl-sulfate reductase, oxidoreductase; 2.00A {Escherichia coli} SCOP: c.26.2.2 Back     alignment and structure
>3rg8_A Phosphoribosylaminoimidazole carboxylase, PURE PR; purine biosynthesis, lyase; 1.74A {Treponema denticola} SCOP: c.23.8.0 PDB: 3rgg_A* Back     alignment and structure
>1k92_A Argininosuccinate synthase, argininosuccinate SY; N-type ATP pyrophosphatase, ligase; 1.60A {Escherichia coli} SCOP: c.26.2.1 d.210.1.1 PDB: 1k97_A* 1kp2_A* 1kp3_A* Back     alignment and structure
>1u11_A PURE (N5-carboxyaminoimidazole ribonucleotide MUT; acidophIle, protein stability, lyase; HET: CIT; 1.55A {Acetobacter aceti} SCOP: c.23.8.1 PDB: 2fwj_A* 2fw1_A* 2fwb_A 2fwa_A 2fw9_A 2fw7_A 2fw6_A 2fwp_A* 2fwi_A* 2fw8_A Back     alignment and structure
>2pg3_A Queuosine biosynthesis protein QUEC; YP_049261.1, hypothetical protein, structural genomics, JOIN for structural genomics; 2.40A {Pectobacterium atrosepticum SCRI1043} SCOP: c.26.2.1 Back     alignment and structure
>3da8_A Probable 5'-phosphoribosylglycinamide formyltransferase PURN; glycinamide ribonucleotide transformylase, structure; 1.30A {Mycobacterium tuberculosis} PDB: 3dcj_A* Back     alignment and structure
>3kcq_A Phosphoribosylglycinamide formyltransferase; structural genomics, niaid, seattle structural center for infectious disease, ssgcid; 2.20A {Anaplasma phagocytophilum} SCOP: c.65.1.0 Back     alignment and structure
>3ih5_A Electron transfer flavoprotein alpha-subunit; alpha-beta-alpha sandwich, structural genomics, PSI-2, protein structure initiative; 2.60A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2nz2_A Argininosuccinate synthase; amino-acid biosynthesis, aspartate, citrulline, ST genomics, structural genomics consortium, SGC, ligase; HET: CIR; 2.40A {Homo sapiens} Back     alignment and structure
>3g40_A Na-K-CL cotransporter; alpha/beta fold 10-stranded twisted beta sheet, transport protein; 1.90A {Methanosarcina acetivorans} Back     alignment and structure
>1g63_A Epidermin modifying enzyme EPID; alpha, beta protein, rossmann like fold, oxidoreductase; HET: FMN; 2.50A {Staphylococcus epidermidis} SCOP: c.34.1.1 PDB: 1g5q_A* Back     alignment and structure
>1ni5_A Putative cell cycle protein MESJ; structural genomics, ATPase, PP-type, putative cell cycle PR PSI, protein structure initiative; 2.65A {Escherichia coli} SCOP: b.153.1.2 c.26.2.5 d.229.1.1 Back     alignment and structure
>3g40_A Na-K-CL cotransporter; alpha/beta fold 10-stranded twisted beta sheet, transport protein; 1.90A {Methanosarcina acetivorans} Back     alignment and structure
>2oq2_A Phosphoadenosine phosphosulfate reductase; sulfate reduction, PAPS reductase, oxidoreductase; HET: A3P; 2.10A {Saccharomyces cerevisiae} Back     alignment and structure
>3bl5_A Queuosine biosynthesis protein QUEC; PREQ1 biosynthesis, RNA modification, tRNA, hydrolase; 2.95A {Bacillus subtilis} Back     alignment and structure
>3p9x_A Phosphoribosylglycinamide formyltransferase; structural genomics, PSI-biology, protein STRU initiative; 1.90A {Bacillus halodurans} Back     alignment and structure
>2ywb_A GMP synthase [glutamine-hydrolyzing]; GMP synthetase, XMP binding, ATP binding, purine nucleotide biosynthetic pathway, structural genomics; 2.10A {Thermus thermophilus} PDB: 2ywc_A* Back     alignment and structure
>1o97_C Electron transferring flavoprotein beta-subunit; FAD binding; HET: AMP FAD; 1.6A {Methylophilus methylotrophus} SCOP: c.26.2.3 PDB: 1o95_C* 1o96_A* 1o94_C* 3clr_C* 3cls_C* 3clt_C* 3clu_C* Back     alignment and structure
>2c5s_A THII, probable thiamine biosynthesis protein THII; RNA-binding protein, RNA binding protein, tRNA modification, 4-thiouridine synthase; HET: AMP; 2.5A {Bacillus anthracis} SCOP: c.26.2.6 d.308.1.1 Back     alignment and structure
>1efp_B ETF, protein (electron transfer flavoprotein); electron transport, glutaric acidemia type II; HET: FAD AMP; 2.60A {Paracoccus denitrificans} SCOP: c.26.2.3 Back     alignment and structure
>1iv0_A Hypothetical protein; rnaseh-like, YQGF, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Thermus thermophilus} SCOP: c.55.3.8 Back     alignment and structure
>1kor_A Argininosuccinate synthetase; ligase, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: ANP ARG; 1.95A {Thermus thermophilus} SCOP: c.26.2.1 d.210.1.1 PDB: 1j1z_A* 1j21_A* 1kh1_A 1kh2_A* 1kh3_A* 1j20_A* Back     alignment and structure
>1efv_B Electron transfer flavoprotein; electron transport, glutaric acidemia type II; HET: FAD AMP; 2.10A {Homo sapiens} SCOP: c.26.2.3 PDB: 1t9g_S* 2a1u_B* 2a1t_S* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 162
d2gm3a1171 c.26.2.4 (A:5-175) Putative ethylene-responsive pr 4e-09
d2z3va1135 c.26.2.4 (A:2-136) Hypothetical protein TTHA0895 { 4e-06
d1mjha_160 c.26.2.4 (A:) "Hypothetical" protein MJ0577 {Archa 3e-04
d1tq8a_147 c.26.2.4 (A:) Hypothetical protein Rv1636 {Mycobac 4e-04
d1jmva_140 c.26.2.4 (A:) Universal stress protein A, UspA {Ha 0.002
>d2gm3a1 c.26.2.4 (A:5-175) Putative ethylene-responsive protein AT3g01520/F4P13_7 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 171 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Adenine nucleotide alpha hydrolase-like
superfamily: Adenine nucleotide alpha hydrolases-like
family: Universal stress protein-like
domain: Putative ethylene-responsive protein AT3g01520/F4P13 7
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

 Score = 50.6 bits (120), Expect = 4e-09
 Identities = 34/166 (20%), Positives = 56/166 (33%), Gaps = 30/166 (18%)

Query: 3   KRVMVVVDQTS---------HSKHAMMWALTHVTNKGD---LLTLLHVVPPPKPNTSHHD 50
            +VMV V+ ++           K A  W L  +         + LLHV    +      D
Sbjct: 2   TKVMVAVNASTIKDYPNPSISCKRAFEWTLEKIVRSNTSDFKILLLHVQVVDEDGFDDVD 61

Query: 51  SSACCPYLANS------------LGSLCKACK-PEVEVEALVIQGPKLGTVMSQVRKLEV 97
           S    P                 L      C    V  EA +  G     +  +V+++  
Sbjct: 62  SIYASPEDFRDMRQSNKAKGLHLLEFFVNKCHEIGVGCEAWIKTGDPKDVICQEVKRVRP 121

Query: 98  SVLVLGQKKHSAFINCFCGTSSSEEFVDQCIKKADCLTVGVRKQSK 143
             LV+G +    F   F GT S       C+K A+C  + +++ + 
Sbjct: 122 DFLVVGSRGLGRFQKVFVGTVS-----AFCVKHAECPVMTIKRNAD 162
>d2z3va1 c.26.2.4 (A:2-136) Hypothetical protein TTHA0895 {Thermus thermophilus [TaxId: 274]} Length = 135 Back     information, alignment and structure
>d1mjha_ c.26.2.4 (A:) "Hypothetical" protein MJ0577 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 160 Back     information, alignment and structure
>d1tq8a_ c.26.2.4 (A:) Hypothetical protein Rv1636 {Mycobacterium tuberculosis [TaxId: 1773]} Length = 147 Back     information, alignment and structure
>d1jmva_ c.26.2.4 (A:) Universal stress protein A, UspA {Haemophilus influenzae [TaxId: 727]} Length = 140 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query162
d1mjha_160 "Hypothetical" protein MJ0577 {Archaeon Methanococ 99.97
d2z3va1135 Hypothetical protein TTHA0895 {Thermus thermophilu 99.95
d2gm3a1171 Putative ethylene-responsive protein AT3g01520/F4P 99.95
d1tq8a_147 Hypothetical protein Rv1636 {Mycobacterium tubercu 99.94
d1jmva_140 Universal stress protein A, UspA {Haemophilus infl 99.94
d1q77a_138 Hypothetical protein Aq_178 {Aquifex aeolicus [Tax 99.91
d1wy5a1216 TilS-like protein Aq_1887 {Aquifex aeolicus [TaxId 96.33
d1ni5a1227 tRNA-Ile-lysidine synthetase, TilS, N-terminal dom 94.2
d1vbka1132 Hypothetical protein PH1313, C-terminal domain {Ar 92.76
d1efpb_246 Small, beta subunit of electron transfer flavoprot 92.72
d1np7a2204 Cryptochrome {Synechocystis sp., pcc 6803 [TaxId: 92.49
d1u11a_159 N5-CAIR mutase (phosphoribosylaminoimidazole carbo 92.33
d1o4va_169 N5-CAIR mutase (phosphoribosylaminoimidazole carbo 92.23
d1xmpa_155 N5-CAIR mutase (phosphoribosylaminoimidazole carbo 92.09
d3clsc1262 Small, beta subunit of electron transfer flavoprot 90.91
d1qcza_163 N5-CAIR mutase (phosphoribosylaminoimidazole carbo 90.45
d1efvb_252 Small, beta subunit of electron transfer flavoprot 89.8
d2c5sa1218 Thiamine biosynthesis protein ThiI, C-terminal dom 89.6
d1owla2202 DNA photolyase {Synechococcus elongatus [TaxId: 32 86.69
d2j07a2170 DNA photolyase {Thermus thermophilus [TaxId: 274]} 82.83
d2d13a1226 Hypothetical protein PH1257 {Archaeon Pyrococcus h 82.8
d1p3y1_183 MrsD {Bacillus sp. hil-y85/54728 [TaxId: 69002]} 81.12
>d1mjha_ c.26.2.4 (A:) "Hypothetical" protein MJ0577 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Adenine nucleotide alpha hydrolase-like
superfamily: Adenine nucleotide alpha hydrolases-like
family: Universal stress protein-like
domain: "Hypothetical" protein MJ0577
species: Archaeon Methanococcus jannaschii [TaxId: 2190]

Probab=99.97  E-value=5.8e-31  Score=184.21  Aligned_cols=135  Identities=15%  Similarity=0.238  Sum_probs=109.0

Q ss_pred             CCcEEEEEeCCChhhHHHHHHHHHhccCCCCEEEEEEEeCCCCCCC------CC-----CCc-c-----------ccchH
Q 031262            1 MRKRVMVVVDQTSHSKHAMMWALTHVTNKGDLLTLLHVVPPPKPNT------SH-----HDS-S-----------ACCPY   57 (162)
Q Consensus         1 m~~~Ilv~vD~S~~s~~al~~A~~~a~~~~~~l~l~hv~~~~~~~~------~~-----~~~-~-----------~~~~~   57 (162)
                      |+||||||+|+|+.|.++++||..+|+..+++|+++||+++.....      ..     ... .           +..++
T Consensus         2 m~~~ILvavD~s~~s~~al~~a~~la~~~~a~l~llhV~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   81 (160)
T d1mjha_           2 MYKKILYPTDFSETAEIALKHVKAFKTLKAEEVILLHVIDEREIKKRDIFSLLLGVAGLNKSVEEFENELKNKLTEEAKN   81 (160)
T ss_dssp             CCCEEEEECCSCHHHHHHHHHHHHTCCSSCCEEEEEEEEEGGGTC-----------------CHHHHHHHHHHHHHHHHH
T ss_pred             CcCeEEEEECCCHHHHHHHHHHHHHHHhcCCEEEEEEecccccccccccccccccccccchhHHHHHHHHHHHHHHHHHH
Confidence            8999999999999999999999999999999999999986543210      00     000 0           01111


Q ss_pred             HHHHHHHhHHHhCCCCeEEEEEEecCchhHHHHHHHhcCCCEEEEccCCCCcccccccccCCcchhHHHhhhhCCceEEE
Q 031262           58 LANSLGSLCKACKPEVEVEALVIQGPKLGTVMSQVRKLEVSVLVLGQKKHSAFINCFCGTSSSEEFVDQCIKKADCLTVG  137 (162)
Q Consensus        58 ~~~~~~~~~~~~~~~v~~~~~v~~g~~~~~I~~~a~~~~~dliVmG~~~~~~~~~~~~Gs~~~~~~~~~v~~~~~~pVlv  137 (162)
                      ..+.+.+.+..  .++++++.+..|++.+.|++++++.++||||||+++++.+.++|+||++     ++|+++++|||++
T Consensus        82 ~l~~~~~~~~~--~gv~~~~~~~~G~~~~~I~~~a~~~~~dliV~G~~~~~~~~~~~~GS~a-----~~vl~~s~~pVlv  154 (160)
T d1mjha_          82 KMENIKKELED--VGFKVKDIIVVGIPHEEIVKIAEDEGVDIIIMGSHGKTNLKEILLGSVT-----ENVIKKSNKPVLV  154 (160)
T ss_dssp             HHHHHHHHHHH--TTCEEEEEEEEECHHHHHHHHHHHTTCSEEEEESCCSSCCTTCSSCHHH-----HHHHHHCCSCEEE
T ss_pred             HHHHHHHHHHh--cCCeEEEEEEeccHHHHHhhhhhccccceEEeccCCCCcccccccCcHH-----HHHHhcCCCCEEE
Confidence            12222233333  7899999999999999999999999999999999999999999999999     9999999999999


Q ss_pred             EecCC
Q 031262          138 VRKQS  142 (162)
Q Consensus       138 v~~~~  142 (162)
                      ||+++
T Consensus       155 V~~~~  159 (160)
T d1mjha_         155 VKRKN  159 (160)
T ss_dssp             ECCCC
T ss_pred             EcCCC
Confidence            99874
>d2z3va1 c.26.2.4 (A:2-136) Hypothetical protein TTHA0895 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2gm3a1 c.26.2.4 (A:5-175) Putative ethylene-responsive protein AT3g01520/F4P13_7 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1tq8a_ c.26.2.4 (A:) Hypothetical protein Rv1636 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1jmva_ c.26.2.4 (A:) Universal stress protein A, UspA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1q77a_ c.26.2.4 (A:) Hypothetical protein Aq_178 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1wy5a1 c.26.2.5 (A:1-216) TilS-like protein Aq_1887 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ni5a1 c.26.2.5 (A:0-226) tRNA-Ile-lysidine synthetase, TilS, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vbka1 c.26.2.6 (A:176-307) Hypothetical protein PH1313, C-terminal domain {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1efpb_ c.26.2.3 (B:) Small, beta subunit of electron transfer flavoprotein ETFP {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1np7a2 c.28.1.1 (A:1-204) Cryptochrome {Synechocystis sp., pcc 6803 [TaxId: 1143]} Back     information, alignment and structure
>d1u11a_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Acetobacter aceti [TaxId: 435]} Back     information, alignment and structure
>d1o4va_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xmpa_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Bacillus anthracis [TaxId: 1392]} Back     information, alignment and structure
>d3clsc1 c.26.2.3 (C:1-262) Small, beta subunit of electron transfer flavoprotein ETFP {Methylophilus methylotrophus [TaxId: 17]} Back     information, alignment and structure
>d1qcza_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1efvb_ c.26.2.3 (B:) Small, beta subunit of electron transfer flavoprotein ETFP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c5sa1 c.26.2.6 (A:174-391) Thiamine biosynthesis protein ThiI, C-terminal domain {Bacillus anthracis [TaxId: 1392]} Back     information, alignment and structure
>d1owla2 c.28.1.1 (A:3-204) DNA photolyase {Synechococcus elongatus [TaxId: 32046]} Back     information, alignment and structure
>d2j07a2 c.28.1.1 (A:2-171) DNA photolyase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2d13a1 c.26.2.1 (A:2-227) Hypothetical protein PH1257 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1p3y1_ c.34.1.1 (1:) MrsD {Bacillus sp. hil-y85/54728 [TaxId: 69002]} Back     information, alignment and structure