Citrus Sinensis ID: 031378


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160
MSCLFIVAANFLSIYISYKLASYFRDKFVCFFLVVLYIKRRLNCLLEIVQQEKFYNAPTQNMTRTAVVKEIVKFAAEGIGNSYSSALESGFSDRSTDLLTRVSFKFSATRGVYATPTFFVNGFSLAGAGSPLDYNGWRKVIDPLLSEKGKKREVPLHLFL
ccEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHcccHHHHHHccccccccccHHEEEEEEcccccccccccEEEccEEcccccccccHHHHHHHHcHHHccccccccccccccc
ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHcccccccccHHHHHHHHHHHHHHHHcccHHHHHHHccccccccHHHEEEEHHccccccccccEEEEccEEcccccccccHHHHHHHHcHHHcccccccccccHccc
MSCLFIVAANFLSIYISYKLASYFRDKFVCFFLVVLYIKRRLNCLLEIVQQEkfynaptqnmtRTAVVKEIVKFAAEGIGnsyssalesgfsdrstdlltrvsfkfsatrgvyatptffvngfslagagspldyngwrkvidpllsekgkkrevplhlfl
MSCLFIVAANFLSIYISYKLASYFRDKFVCFFLVVLYIKRRLNCLLEIVQQekfynaptqnmtrTAVVKEIVKFAAEGIGNSYSSALESGFSDRSTDLLTRVSFKFSATRGVYATPTFFVNGFSLAGAGSPLDYNGWRKVIDpllsekgkkrevplhlfl
MSCLFIVAANFLSIYISYKLASYFRDKFVCFFLVVLYIKRRLNCLLEIVQQEKFYNAPTQNMTRTAVVKEIVKFAAEGIGNSYSSALESGFSDRSTDLLTRVSFKFSATRGVYATPTFFVNGFSLAGAGSPLDYNGWRKVIDPLLSEKGKKREVPLHLFL
**CLFIVAANFLSIYISYKLASYFRDKFVCFFLVVLYIKRRLNCLLEIVQQEKFYNAPTQNMTRTAVVKEIVKFAAEGIGNSYSSALESGFSDRSTDLLTRVSFKFSATRGVYATPTFFVNGFSLAGAGSPLDYNGWRKVIDPLL***************
*SCLFIVAANFLSIYISYKLASYFRDKFVCFFLVVLYIKRRLNCLLEIVQQEKFYNAPTQNMTRTAVVKEIVKFAAEGIGNSYSSALESGFSDRSTDLLTRVSFKFSATRGVYATPTFFVNGFSLAGAGSPLDYNGWRKVIDPLLS*********LHLFL
MSCLFIVAANFLSIYISYKLASYFRDKFVCFFLVVLYIKRRLNCLLEIVQQEKFYNAPTQNMTRTAVVKEIVKFAAEGIGNSYSSALESGFSDRSTDLLTRVSFKFSATRGVYATPTFFVNGFSLAGAGSPLDYNGWRKVIDPLLSEKGKKREVPLHLFL
*SCLFIVAANFLSIYISYKLASYFRDKFVCFFLVVLYIKRRLNCLLEIVQQEKFYNAPTQNMTRTAVVKEIVKFAAEGIGNSYSSALESGFSDRSTDLLTRVSFKFSATRGVYATPTFFVNGFSLAGAGSPLDYNGWRKVIDPLLSEKG*****P*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSCLFIVAANFLSIYISYKLASYFRDKFVCFFLVVLYIKRRLNCLLEIVQQEKFYNAPTQNMTRTAVVKEIVKFAAEGIGNSYSSALESGFSDRSTDLLTRVSFKFSATRGVYATPTFFVNGFSLAGAGSPLDYNGWRKVIDPLLSEKGKKREVPLHLFL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query160
224085938212 predicted protein [Populus trichocarpa] 0.725 0.547 0.609 2e-34
255539052 362 conserved hypothetical protein [Ricinus 0.65 0.287 0.657 2e-34
224061957223 predicted protein [Populus trichocarpa] 0.706 0.506 0.591 2e-30
8778978 538 Contains similarity to pigpen protein fr 0.593 0.176 0.621 2e-28
22329686233 TRX domain-containing protein [Arabidops 0.706 0.484 0.55 5e-28
359492074234 PREDICTED: uncharacterized protein LOC10 0.768 0.525 0.515 7e-28
297850426 529 hypothetical protein ARALYDRAFT_312946 [ 0.656 0.198 0.575 9e-28
81076617224 unknown [Solanum tuberosum] 0.781 0.558 0.492 3e-27
351726088236 uncharacterized protein LOC100500267 pre 0.687 0.466 0.513 4e-27
449450508236 PREDICTED: uncharacterized protein LOC10 0.681 0.461 0.549 5e-27
>gi|224085938|ref|XP_002307747.1| predicted protein [Populus trichocarpa] gi|222857196|gb|EEE94743.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  150 bits (379), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 75/123 (60%), Positives = 90/123 (73%), Gaps = 7/123 (5%)

Query: 36  LYIKRRLNC-----LLE--IVQQEKFYNAPTQNMTRTAVVKEIVKFAAEGIGNSYSSALE 88
           L+I   LN      LLE     QEKFYNA T N+++T++V+EIVKFA   +GNSYSSA E
Sbjct: 82  LHIANTLNSSFTFPLLEEFFKHQEKFYNAKTSNLSKTSIVEEIVKFATVAVGNSYSSAFE 141

Query: 89  SGFSDRSTDLLTRVSFKFSATRGVYATPTFFVNGFSLAGAGSPLDYNGWRKVIDPLLSEK 148
           SGF+DR TDL TRVSFK+S +RGV+ TP FFVNGF L  AGSPLDYNGWR +IDPL+  K
Sbjct: 142 SGFNDRQTDLKTRVSFKYSTSRGVFGTPFFFVNGFVLPDAGSPLDYNGWRSIIDPLVGAK 201

Query: 149 GKK 151
             +
Sbjct: 202 SSQ 204




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255539052|ref|XP_002510591.1| conserved hypothetical protein [Ricinus communis] gi|223551292|gb|EEF52778.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|224061957|ref|XP_002300683.1| predicted protein [Populus trichocarpa] gi|222842409|gb|EEE79956.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|8778978|gb|AAF79893.1|AC022472_2 Contains similarity to pigpen protein from Mus musculus gb|AF224264 and contains protein of unknown function DUF78 PF|01918 domain. ESTs gb|N38077, gb|BE037702, gb|AV442191, gb|AV441368, gb|Z17998, gb|AV527266, gb|AV520794, gb|AI997847, gb|AV543000 come from this gene [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|22329686|ref|NP_683315.1| TRX domain-containing protein [Arabidopsis thaliana] gi|17065544|gb|AAL32926.1| Unknown protein [Arabidopsis thaliana] gi|24899723|gb|AAN65076.1| Unknown protein [Arabidopsis thaliana] gi|332191831|gb|AEE29952.1| TRX domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|359492074|ref|XP_003634361.1| PREDICTED: uncharacterized protein LOC100854733 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297850426|ref|XP_002893094.1| hypothetical protein ARALYDRAFT_312946 [Arabidopsis lyrata subsp. lyrata] gi|297338936|gb|EFH69353.1| hypothetical protein ARALYDRAFT_312946 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|81076617|gb|ABB55396.1| unknown [Solanum tuberosum] Back     alignment and taxonomy information
>gi|351726088|ref|NP_001235579.1| uncharacterized protein LOC100500267 precursor [Glycine max] gi|255629877|gb|ACU15289.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|449450508|ref|XP_004143004.1| PREDICTED: uncharacterized protein LOC101216804 isoform 1 [Cucumis sativus] gi|449450510|ref|XP_004143005.1| PREDICTED: uncharacterized protein LOC101216804 isoform 2 [Cucumis sativus] gi|449521601|ref|XP_004167818.1| PREDICTED: uncharacterized protein LOC101231840 isoform 1 [Cucumis sativus] gi|449521603|ref|XP_004167819.1| PREDICTED: uncharacterized protein LOC101231840 isoform 2 [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query160
TAIR|locus:504956159233 AT1G20225 "AT1G20225" [Arabido 0.631 0.433 0.601 8.2e-28
TAIR|locus:2204415225 AT1G76020 "AT1G76020" [Arabido 0.593 0.422 0.589 3.5e-27
TAIR|locus:504956159 AT1G20225 "AT1G20225" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 311 (114.5 bits), Expect = 8.2e-28, P = 8.2e-28
 Identities = 62/103 (60%), Positives = 76/103 (73%)

Query:    45 LLEIV--QQEKFYNAPTQNMTRTAVVKEIVKFAAEGIGNSYSSALESGFSDRSTDLLTRV 102
             LLE +   Q  FYN+ TQ M+R AVV+E++K     +GNSY S L+SGFS+  +DL TRV
Sbjct:   111 LLEGIFKHQTLFYNSQTQLMSRPAVVEELIKLGTVTLGNSYHSPLKSGFSNSKSDLATRV 170

Query:   103 SFKFSATRGVYATPTFFVNGFSLAGAGSPLDYNGWRKVIDPLL 145
             SFK+S +RGV ATPTF+VNGF L GAGSP DY GWR  IDPL+
Sbjct:   171 SFKYSVSRGVSATPTFYVNGFELPGAGSPKDYEGWRDTIDPLV 213




GO:0003674 "molecular_function" evidence=ND
GO:0008150 "biological_process" evidence=ND
GO:0005773 "vacuole" evidence=IDA
GO:0005829 "cytosol" evidence=IDA
TAIR|locus:2204415 AT1G76020 "AT1G76020" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
estExt_Genewise1_v1.C_LG_V1891
hypothetical protein (212 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 160
COG2761225 FrnE Predicted dithiol-disulfide isomerase involve 99.4
cd03024201 DsbA_FrnE DsbA family, FrnE subfamily; FrnE is a D 99.37
cd03022192 DsbA_HCCA_Iso DsbA family, 2-hydroxychromene-2-car 99.3
COG3531212 Predicted protein-disulfide isomerase [Posttransla 99.29
cd03023154 DsbA_Com1_like DsbA family, Com1-like subfamily; c 99.28
PF01323193 DSBA: DSBA-like thioredoxin domain; InterPro: IPR0 99.26
PRK10954207 periplasmic protein disulfide isomerase I; Provisi 99.22
cd03019178 DsbA_DsbA DsbA family, DsbA subfamily; DsbA is a m 99.17
PF13743176 Thioredoxin_5: Thioredoxin; PDB: 3KZQ_C. 99.17
PF13462162 Thioredoxin_4: Thioredoxin; PDB: 3FEU_A 3HZ8_A 3DV 99.11
cd03025193 DsbA_FrnE_like DsbA family, FrnE-like subfamily; c 99.05
COG1651244 DsbG Protein-disulfide isomerase [Posttranslationa 98.83
COG3917203 NahD 2-hydroxychromene-2-carboxylate isomerase [Se 98.31
cd03021209 DsbA_GSTK DsbA family, Glutathione (GSH) S-transfe 98.23
PRK10877232 protein disulfide isomerase II DsbC; Provisional 97.98
PRK11657251 dsbG disulfide isomerase/thiol-disulfide oxidase; 97.63
cd03020197 DsbA_DsbC_DsbG DsbA family, DsbC and DsbG subfamil 97.33
TIGR0041182 redox_disulf_1 small redox-active disulfide protei 97.18
PF13098112 Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_ 96.89
cd0297298 DsbA_family DsbA family; consists of DsbA and DsbA 96.58
PF1319276 Thioredoxin_3: Thioredoxin domain; PDB: 1ZYP_B 1ZY 96.37
PRK11509132 hydrogenase-1 operon protein HyaE; Provisional 96.29
cd03065120 PDI_b_Calsequestrin_N PDIb family, Calsequestrin s 96.26
cd02963111 TRX_DnaJ TRX domain, DnaJ domain containing protei 95.92
cd02951125 SoxW SoxW family; SoxW is a bacterial periplasmic 95.85
PRK10996139 thioredoxin 2; Provisional 95.71
PF00085103 Thioredoxin: Thioredoxin; InterPro: IPR013766 Thio 95.55
TIGR0041276 redox_disulf_2 small redox-active disulfide protei 95.51
PRK09381109 trxA thioredoxin; Provisional 95.45
cd0295696 ybbN ybbN protein family; ybbN is a hypothetical p 95.4
TIGR0219674 GlrX_YruB Glutaredoxin-like protein, YruB-family. 95.27
cd02950142 TxlA TRX-like protein A (TxlA) family; TxlA was or 95.17
cd02948102 TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fus 95.05
PRK15412185 thiol:disulfide interchange protein DsbE; Provisio 94.8
PRK1120085 grxA glutaredoxin 1; Provisional 94.77
cd0294793 TRX_family TRX family; composed of two groups: Gro 94.52
TIGR01068101 thioredoxin thioredoxin. Several proteins, such as 94.48
cd0294997 TRX_NTR TRX domain, novel NADPH thioredoxin reduct 94.28
TIGR00385173 dsbE periplasmic protein thiol:disulfide oxidoredu 94.23
cd0302689 AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxid 94.01
COG2143182 Thioredoxin-related protein [Posttranslational mod 94.01
cd0297367 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)- 94.0
KOG0910150 consensus Thioredoxin-like protein [Posttranslatio 93.94
PTZ00443224 Thioredoxin domain-containing protein; Provisional 93.81
TIGR01126102 pdi_dom protein disulfide-isomerase domain. This m 93.79
TIGR01295122 PedC_BrcD bacteriocin transport accessory protein, 93.68
cd02997104 PDI_a_PDIR PDIa family, PDIR subfamily; composed o 93.5
PHA02278103 thioredoxin-like protein 93.29
cd02994101 PDI_a_TMX PDIa family, TMX subfamily; composed of 93.19
cd0298497 TRX_PICOT TRX domain, PICOT (for PKC-interacting c 93.17
cd02975113 PfPDO_like_N Pyrococcus furiosus protein disulfide 92.9
cd02961101 PDI_a_family Protein Disulfide Isomerase (PDIa) fa 92.6
cd03003101 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfam 92.59
cd02985103 TRX_CDSP32 TRX family, chloroplastic drought-induc 92.55
cd03005102 PDI_a_ERp46 PDIa family, endoplasmic reticulum pro 92.3
cd03002109 PDI_a_MPD1_like PDI family, MPD1-like subfamily; c 92.25
cd02996108 PDI_a_ERp44 PDIa family, endoplasmic reticulum pro 92.22
cd02965111 HyaE HyaE family; HyaE is also called HupG and Hox 92.14
TIGR02187215 GlrX_arch Glutaredoxin-like domain protein. This f 91.84
cd03000104 PDI_a_TMX3 PDIa family, TMX3 subfamily; composed o 91.67
cd02953104 DsbDgamma DsbD gamma family; DsbD gamma is the C-t 91.59
cd02958114 UAS UAS family; UAS is a domain of unknown functio 91.38
cd02998105 PDI_a_ERp38 PDIa family, endoplasmic reticulum pro 91.21
cd03004104 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfam 91.14
cd03001103 PDI_a_P5 PDIa family, P5 subfamily; composed of eu 90.89
TIGR0218084 GRX_euk Glutaredoxin. This model represents eukary 90.54
cd0302972 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hyb 90.48
cd02999100 PDI_a_ERp44_like PDIa family, endoplasmic reticulu 90.29
PHA0212575 thioredoxin-like protein 90.18
TIGR02187215 GlrX_arch Glutaredoxin-like domain protein. This f 89.93
TIGR0218386 GRXA Glutaredoxin, GrxA family. This model include 89.73
cd03007116 PDI_a_ERp29_N PDIa family, endoplasmic reticulum p 89.01
KOG0908 288 consensus Thioredoxin-like protein [Posttranslatio 88.85
PF06764202 DUF1223: Protein of unknown function (DUF1223); In 88.52
TIGR0218179 GRX_bact Glutaredoxin, GrxC family. This family of 88.52
COG3118 304 Thioredoxin domain-containing protein [Posttransla 88.36
cd02982103 PDI_b'_family Protein Disulfide Isomerase (PDIb') 88.35
PTZ0005198 thioredoxin; Provisional 87.83
PF0046260 Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Gl 87.83
KOG0907106 consensus Thioredoxin [Posttranslational modificat 87.45
TIGR03143555 AhpF_homolog putative alkyl hydroperoxide reductas 87.23
TIGR0219079 GlrX-dom Glutaredoxin-family domain. This C-termin 87.01
PRK03147173 thiol-disulfide oxidoreductase; Provisional 86.66
TIGR01130 462 ER_PDI_fam protein disulfide isomerases, eukaryoti 86.26
PTZ00102 477 disulphide isomerase; Provisional 86.11
cd0297673 NrdH NrdH-redoxin (NrdH) family; NrdH is a small m 84.64
cd0341982 GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX h 84.47
cd02957113 Phd_like Phosducin (Phd)-like family; composed of 84.47
cd02989113 Phd_like_TxnDC9 Phosducin (Phd)-like family, Thior 83.21
cd0302773 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Eg 83.15
COG069580 GrxC Glutaredoxin and related proteins [Posttransl 82.31
cd02955124 SSP411 TRX domain, SSP411 protein family; members 82.3
TIGR02740271 TraF-like TraF-like protein. This protein is relat 82.02
TIGR02738153 TrbB type-F conjugative transfer system pilin asse 82.0
cd03011123 TlpA_like_ScsD_MtbDsbE TlpA-like family, suppresso 82.0
cd02954114 DIM1 Dim1 family; Dim1 is also referred to as U5 s 81.65
cd02995104 PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain 81.57
PRK14018 521 trifunctional thioredoxin/methionine sulfoxide red 81.51
PLN00410142 U5 snRNP protein, DIM1 family; Provisional 81.16
cd0206672 GRX_family Glutaredoxin (GRX) family; composed of 81.13
TIGR0218999 GlrX-like_plant Glutaredoxin-like family. This fam 80.97
PTZ00056199 glutathione peroxidase; Provisional 80.82
>COG2761 FrnE Predicted dithiol-disulfide isomerase involved in polyketide biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
Probab=99.40  E-value=7.3e-12  Score=101.13  Aligned_cols=117  Identities=15%  Similarity=0.253  Sum_probs=99.8

Q ss_pred             hhHHHHHHHHHhhhh-HHHHh--chhhhhcCCCCCCChHHHHHHHHHHHHhhcCCChhHHHHcccCChhHHHHHHHHHHH
Q 031378           30 CFFLVVLYIKRRLNC-LLEIV--QQEKFYNAPTQNMTRTAVVKEIVKFAAEGIGNSYSSALESGFSDRSTDLLTRVSFKF  106 (160)
Q Consensus        30 ~~a~ra~~aar~~~~-~l~~~--~Q~~f~~~~~~~~t~~~i~~~la~~A~~~~Gld~~~~f~~~l~~~~~~~~i~~~~k~  106 (160)
                      ..|||+.+.|+..|+ ...++  -|++|+.. +.|.+..+++-.|+..+    ||| .+.|++.+.+.+....++.+.+.
T Consensus       103 ~~Ah~l~~~A~~~G~~~~~~~~~lf~AyF~e-g~nI~D~dVL~diA~~~----GLD-~~~~~~~L~s~~~~~avr~d~~~  176 (225)
T COG2761         103 LDAHRLIKAAELQGKAQDRFLEALFEAYFEE-GRNIGDEDVLADIAEEV----GLD-REEFKADLASDAAKDAVRQDEAA  176 (225)
T ss_pred             HHHHHHHHHHHHhCchHHHHHHHHHHHHhcc-CCCCCcHHHHHHHHHHh----CCC-HHHHHHHHhChHHHHHHHHHHHH
Confidence            399999999999997 44555  68888776 67888887766666554    999 69999999999999999999999


Q ss_pred             hhcCCccccceEEE-CCEEecCCCCCCCHHHHHHHHHHHhhhcCCCCCcc
Q 031378          107 SATRGVYATPTFFV-NGFSLAGAGSPLDYNGWRKVIDPLLSEKGKKREVP  155 (160)
Q Consensus       107 a~~~GV~GTPTffI-NG~~~~ga~s~~~~e~~~~~Id~~l~~~~~~~~~~  155 (160)
                      +++.||+|.|||++ +|..++|+.+   ++.+...|+.+++.+.+.+..|
T Consensus       177 A~e~gI~gVP~fv~d~~~~V~Gaq~---~~v~~~al~~~~~~~~~~~~~~  223 (225)
T COG2761         177 AQEMGIRGVPTFVFDGKYAVSGAQP---YDVLEDALRQLLAEKAEEHKPP  223 (225)
T ss_pred             HHHCCCccCceEEEcCcEeecCCCC---HHHHHHHHHHHHhcccccCCCC
Confidence            99999999999999 7888999888   9999999999998885544443



>cd03024 DsbA_FrnE DsbA family, FrnE subfamily; FrnE is a DsbA-like protein containing a CXXC motif Back     alignment and domain information
>cd03022 DsbA_HCCA_Iso DsbA family, 2-hydroxychromene-2-carboxylate (HCCA) isomerase subfamily; HCCA isomerase is a glutathione (GSH) dependent enzyme involved in the naphthalene catabolic pathway Back     alignment and domain information
>COG3531 Predicted protein-disulfide isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03023 DsbA_Com1_like DsbA family, Com1-like subfamily; composed of proteins similar to Com1, a 27-kDa outer membrane-associated immunoreactive protein originally found in both acute and chronic disease strains of the pathogenic bacteria Coxiella burnetti Back     alignment and domain information
>PF01323 DSBA: DSBA-like thioredoxin domain; InterPro: IPR001853 DSBA is a sub-family of the Thioredoxin family [] Back     alignment and domain information
>PRK10954 periplasmic protein disulfide isomerase I; Provisional Back     alignment and domain information
>cd03019 DsbA_DsbA DsbA family, DsbA subfamily; DsbA is a monomeric thiol disulfide oxidoreductase protein containing a redox active CXXC motif imbedded in a TRX fold Back     alignment and domain information
>PF13743 Thioredoxin_5: Thioredoxin; PDB: 3KZQ_C Back     alignment and domain information
>PF13462 Thioredoxin_4: Thioredoxin; PDB: 3FEU_A 3HZ8_A 3DVW_A 3A3T_E 3GMF_A 1Z6M_A 3GYK_C 3BCK_A 3BD2_A 3BCI_A Back     alignment and domain information
>cd03025 DsbA_FrnE_like DsbA family, FrnE-like subfamily; composed of uncharacterized proteins containing a CXXC motif with similarity to DsbA and FrnE Back     alignment and domain information
>COG1651 DsbG Protein-disulfide isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3917 NahD 2-hydroxychromene-2-carboxylate isomerase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>cd03021 DsbA_GSTK DsbA family, Glutathione (GSH) S-transferase Kappa (GSTK) subfamily; GSTK is a member of the GST family of enzymes which catalyzes the transfer of the thiol of GSH to electrophilic substrates Back     alignment and domain information
>PRK10877 protein disulfide isomerase II DsbC; Provisional Back     alignment and domain information
>PRK11657 dsbG disulfide isomerase/thiol-disulfide oxidase; Provisional Back     alignment and domain information
>cd03020 DsbA_DsbC_DsbG DsbA family, DsbC and DsbG subfamily; V-shaped homodimeric proteins containing a redox active CXXC motif imbedded in a TRX fold Back     alignment and domain information
>TIGR00411 redox_disulf_1 small redox-active disulfide protein 1 Back     alignment and domain information
>PF13098 Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_A 2L57_A 1EEJ_B 1TJD_A 1JZD_B 1JZO_A 1G0T_B 3GV1_A 1V58_A 2H0H_A Back     alignment and domain information
>cd02972 DsbA_family DsbA family; consists of DsbA and DsbA-like proteins, including DsbC, DsbG, glutathione (GSH) S-transferase kappa (GSTK), 2-hydroxychromene-2-carboxylate (HCCA) isomerase, an oxidoreductase (FrnE) presumed to be involved in frenolicin biosynthesis, a 27-kDa outer membrane protein, and similar proteins Back     alignment and domain information
>PF13192 Thioredoxin_3: Thioredoxin domain; PDB: 1ZYP_B 1ZYN_A 1HYU_A 1ILO_A 1J08_F 2YWM_B 2AYT_B 2HLS_B 1A8L_A 2K8S_B Back     alignment and domain information
>PRK11509 hydrogenase-1 operon protein HyaE; Provisional Back     alignment and domain information
>cd03065 PDI_b_Calsequestrin_N PDIb family, Calsequestrin subfamily, N-terminal TRX-fold domain; Calsequestrin is the major calcium storage protein in the sarcoplasmic reticulum (SR) of skeletal and cardiac muscle Back     alignment and domain information
>cd02963 TRX_DnaJ TRX domain, DnaJ domain containing protein family; composed of uncharacterized proteins of about 500-800 amino acids, containing an N-terminal DnaJ domain followed by one redox active TRX domain Back     alignment and domain information
>cd02951 SoxW SoxW family; SoxW is a bacterial periplasmic TRX, containing a redox active CXXC motif, encoded by a genetic locus (sox operon) involved in thiosulfate oxidation Back     alignment and domain information
>PRK10996 thioredoxin 2; Provisional Back     alignment and domain information
>PF00085 Thioredoxin: Thioredoxin; InterPro: IPR013766 Thioredoxins [, , , ] are small disulphide-containing redox proteins that have been found in all the kingdoms of living organisms Back     alignment and domain information
>TIGR00412 redox_disulf_2 small redox-active disulfide protein 2 Back     alignment and domain information
>PRK09381 trxA thioredoxin; Provisional Back     alignment and domain information
>cd02956 ybbN ybbN protein family; ybbN is a hypothetical protein containing a redox-inactive TRX-like domain Back     alignment and domain information
>TIGR02196 GlrX_YruB Glutaredoxin-like protein, YruB-family Back     alignment and domain information
>cd02950 TxlA TRX-like protein A (TxlA) family; TxlA was originally isolated from the cyanobacterium Synechococcus Back     alignment and domain information
>cd02948 TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fusion protein family; most members of this group are fusion proteins which contain one redox active TRX domain containing a CXXC motif and three NDPK domains, and are characterized as intermediate chains (ICs) of axonemal outer arm dynein Back     alignment and domain information
>PRK15412 thiol:disulfide interchange protein DsbE; Provisional Back     alignment and domain information
>PRK11200 grxA glutaredoxin 1; Provisional Back     alignment and domain information
>cd02947 TRX_family TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains Back     alignment and domain information
>TIGR01068 thioredoxin thioredoxin Back     alignment and domain information
>cd02949 TRX_NTR TRX domain, novel NADPH thioredoxin reductase (NTR) family; composed of fusion proteins found only in oxygenic photosynthetic organisms containing both TRX and NTR domains Back     alignment and domain information
>TIGR00385 dsbE periplasmic protein thiol:disulfide oxidoreductases, DsbE subfamily Back     alignment and domain information
>cd03026 AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxide reductase F subunit (AhpF) N-terminal domain (NTD) subfamily, C-terminal TRX-fold subdomain; AhpF is a homodimeric flavoenzyme which catalyzes the NADH-dependent reduction of the peroxiredoxin AhpC, which then reduces hydrogen peroxide and organic hydroperoxides Back     alignment and domain information
>COG2143 Thioredoxin-related protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02973 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)-like family; composed of archaeal and bacterial proteins that show similarity to both TRX and GRX, including the C-terminal TRX-fold subdomain of Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO) Back     alignment and domain information
>KOG0910 consensus Thioredoxin-like protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00443 Thioredoxin domain-containing protein; Provisional Back     alignment and domain information
>TIGR01126 pdi_dom protein disulfide-isomerase domain Back     alignment and domain information
>TIGR01295 PedC_BrcD bacteriocin transport accessory protein, putative Back     alignment and domain information
>cd02997 PDI_a_PDIR PDIa family, PDIR subfamily; composed of proteins similar to human PDIR (for Protein Disulfide Isomerase Related) Back     alignment and domain information
>PHA02278 thioredoxin-like protein Back     alignment and domain information
>cd02994 PDI_a_TMX PDIa family, TMX subfamily; composed of proteins similar to the TRX-related human transmembrane protein, TMX Back     alignment and domain information
>cd02984 TRX_PICOT TRX domain, PICOT (for PKC-interacting cousin of TRX) subfamily; PICOT is a protein that interacts with protein kinase C (PKC) theta, a calcium independent PKC isoform selectively expressed in skeletal muscle and T lymphocytes Back     alignment and domain information
>cd02975 PfPDO_like_N Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO)-like family, N-terminal TRX-fold subdomain; composed of proteins with similarity to PfPDO, a redox active thermostable protein believed to be the archaeal counterpart of bacterial DsbA and eukaryotic protein disulfide isomerase (PDI), which are both involved in oxidative protein folding Back     alignment and domain information
>cd02961 PDI_a_family Protein Disulfide Isomerase (PDIa) family, redox active TRX domains; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants Back     alignment and domain information
>cd03003 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains Back     alignment and domain information
>cd02985 TRX_CDSP32 TRX family, chloroplastic drought-induced stress protein of 32 kD (CDSP32); CDSP32 is composed of two TRX domains, a C-terminal TRX domain which contains a redox active CXXC motif and an N-terminal TRX-like domain which contains an SXXS sequence instead of the redox active motif Back     alignment and domain information
>cd03005 PDI_a_ERp46 PDIa family, endoplasmic reticulum protein 46 (ERp46) subfamily; ERp46 is an ER-resident protein containing three redox active TRX domains Back     alignment and domain information
>cd03002 PDI_a_MPD1_like PDI family, MPD1-like subfamily; composed of eukaryotic proteins similar to Saccharomyces cerevisiae MPD1 protein, which contains a single redox active TRX domain located at the N-terminus, and an ER retention signal at the C-terminus indicative of an ER-resident protein Back     alignment and domain information
>cd02996 PDI_a_ERp44 PDIa family, endoplasmic reticulum protein 44 (ERp44) subfamily; ERp44 is an ER-resident protein, induced during stress, involved in thiol-mediated ER retention Back     alignment and domain information
>cd02965 HyaE HyaE family; HyaE is also called HupG and HoxO Back     alignment and domain information
>TIGR02187 GlrX_arch Glutaredoxin-like domain protein Back     alignment and domain information
>cd03000 PDI_a_TMX3 PDIa family, TMX3 subfamily; composed of eukaryotic proteins similar to human TMX3, a TRX related transmembrane protein containing one redox active TRX domain at the N-terminus and a classical ER retrieval sequence for type I transmembrane proteins at the C-terminus Back     alignment and domain information
>cd02953 DsbDgamma DsbD gamma family; DsbD gamma is the C-terminal periplasmic domain of the bacterial protein DsbD Back     alignment and domain information
>cd02958 UAS UAS family; UAS is a domain of unknown function Back     alignment and domain information
>cd02998 PDI_a_ERp38 PDIa family, endoplasmic reticulum protein 38 (ERp38) subfamily; composed of proteins similar to the P5-like protein first isolated from alfalfa, which contains two redox active TRX (a) domains at the N-terminus, like human P5, and a C-terminal domain with homology to the C-terminal domain of ERp29, unlike human P5 Back     alignment and domain information
>cd03004 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains Back     alignment and domain information
>cd03001 PDI_a_P5 PDIa family, P5 subfamily; composed of eukaryotic proteins similar to human P5, a PDI-related protein with a domain structure of aa'b (where a and a' are redox active TRX domains and b is a redox inactive TRX-like domain) Back     alignment and domain information
>TIGR02180 GRX_euk Glutaredoxin Back     alignment and domain information
>cd03029 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hybrid subfamily; composed of hybrid proteins containing peroxiredoxin (PRX) and GRX domains, which is found in some pathogenic bacteria and cyanobacteria Back     alignment and domain information
>cd02999 PDI_a_ERp44_like PDIa family, endoplasmic reticulum protein 44 (ERp44)-like subfamily; composed of uncharacterized PDI-like eukaryotic proteins containing only one redox active TRX (a) domain with a CXXS motif, similar to ERp44 Back     alignment and domain information
>PHA02125 thioredoxin-like protein Back     alignment and domain information
>TIGR02187 GlrX_arch Glutaredoxin-like domain protein Back     alignment and domain information
>TIGR02183 GRXA Glutaredoxin, GrxA family Back     alignment and domain information
>cd03007 PDI_a_ERp29_N PDIa family, endoplasmic reticulum protein 29 (ERp29) subfamily; ERp29 is a ubiquitous ER-resident protein expressed in high levels in secretory cells Back     alignment and domain information
>KOG0908 consensus Thioredoxin-like protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF06764 DUF1223: Protein of unknown function (DUF1223); InterPro: IPR010634 This family consists of several hypothetical proteins of around 250 residues in length, which are found in both plants and bacteria Back     alignment and domain information
>TIGR02181 GRX_bact Glutaredoxin, GrxC family Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02982 PDI_b'_family Protein Disulfide Isomerase (PDIb') family, redox inactive TRX-like domain b'; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants Back     alignment and domain information
>PTZ00051 thioredoxin; Provisional Back     alignment and domain information
>PF00462 Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors Back     alignment and domain information
>KOG0907 consensus Thioredoxin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>TIGR02190 GlrX-dom Glutaredoxin-family domain Back     alignment and domain information
>PRK03147 thiol-disulfide oxidoreductase; Provisional Back     alignment and domain information
>TIGR01130 ER_PDI_fam protein disulfide isomerases, eukaryotic Back     alignment and domain information
>PTZ00102 disulphide isomerase; Provisional Back     alignment and domain information
>cd02976 NrdH NrdH-redoxin (NrdH) family; NrdH is a small monomeric protein with a conserved redox active CXXC motif within a TRX fold, characterized by a glutaredoxin (GRX)-like sequence and TRX-like activity profile Back     alignment and domain information
>cd03419 GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX human class 1 and 2 (h_1_2)-like subfamily; composed of proteins similar to human GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>cd02957 Phd_like Phosducin (Phd)-like family; composed of Phd and Phd-like proteins (PhLP), characterized as cytosolic regulators of G protein functions Back     alignment and domain information
>cd02989 Phd_like_TxnDC9 Phosducin (Phd)-like family, Thioredoxin (TRX) domain containing protein 9 (TxnDC9) subfamily; composed of predominantly uncharacterized eukaryotic proteins, containing a TRX-like domain without the redox active CXXC motif Back     alignment and domain information
>cd03027 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Egl-10, and Pleckstrin (DEP) subfamily; composed of uncharacterized proteins containing a GRX domain and additional domains DEP and DUF547, both of which have unknown functions Back     alignment and domain information
>COG0695 GrxC Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02955 SSP411 TRX domain, SSP411 protein family; members of this family are highly conserved proteins present in eukaryotes, bacteria and archaea, about 600-800 amino acids in length, which contain a TRX domain with a redox active CXXC motif Back     alignment and domain information
>TIGR02740 TraF-like TraF-like protein Back     alignment and domain information
>TIGR02738 TrbB type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB Back     alignment and domain information
>cd03011 TlpA_like_ScsD_MtbDsbE TlpA-like family, suppressor for copper sensitivity D protein (ScsD) and actinobacterial DsbE homolog subfamily; composed of ScsD, the DsbE homolog of Mycobacterium tuberculosis (MtbDsbE) and similar proteins, all containing a redox-active CXXC motif Back     alignment and domain information
>cd02954 DIM1 Dim1 family; Dim1 is also referred to as U5 small nuclear ribonucleoprotein particle (snRNP)-specific 15kD protein Back     alignment and domain information
>cd02995 PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain (a') subfamily; composed of the C-terminal redox active a' domains of PDI, ERp72, ERp57 (or ERp60) and EFP1 Back     alignment and domain information
>PRK14018 trifunctional thioredoxin/methionine sulfoxide reductase A/B protein; Provisional Back     alignment and domain information
>PLN00410 U5 snRNP protein, DIM1 family; Provisional Back     alignment and domain information
>cd02066 GRX_family Glutaredoxin (GRX) family; composed of GRX, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>TIGR02189 GlrX-like_plant Glutaredoxin-like family Back     alignment and domain information
>PTZ00056 glutathione peroxidase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query160
3gn3_A182 Putative protein-disulfide isomerase; MCSG, PSI, s 6e-14
3bci_A186 Disulfide bond protein A; thiol-disulfide oxidored 6e-07
3gha_A202 Disulfide bond formation protein D; BDBD, DSBA-lik 1e-06
3gmf_A205 Protein-disulfide isomerase; oxidoreductase, PSI-2 3e-06
3f4s_A226 Alpha-DSBA1, putative uncharacterized protein; thi 6e-06
1z6m_A175 Conserved hypothetical protein; structural genomic 6e-04
3gyk_A175 27KDA outer membrane protein; APC61738.2, siliciba 7e-04
>3gn3_A Putative protein-disulfide isomerase; MCSG, PSI, structural GEN protein structure initiative, midwest center for structural genomics; 2.50A {Pseudomonas syringae PV} Length = 182 Back     alignment and structure
 Score = 64.7 bits (157), Expect = 6e-14
 Identities = 18/92 (19%), Positives = 36/92 (39%), Gaps = 8/92 (8%)

Query: 50  QQEKFYNAPTQNMTRTAVVKEIVKFAAEGIGNSYSSALESGFSDRSTDLLTRVSFKFSAT 109
           + E     P  + T   ++  I +++          AL   F++   +   +   K++  
Sbjct: 98  EFEHHAGGPNLDATPNDIIARIERYSGL--------ALAEAFANPELEHAVKWHTKYARQ 149

Query: 110 RGVYATPTFFVNGFSLAGAGSPLDYNGWRKVI 141
            G++ +PTF +NG    G  S    + W   I
Sbjct: 150 NGIHVSPTFMINGLVQPGMSSGDPVSKWVSDI 181


>3bci_A Disulfide bond protein A; thiol-disulfide oxidoreductase, redox protein, protein folding, redox active centre; 1.81A {Staphylococcus aureus} PDB: 3bd2_A 3bck_A Length = 186 Back     alignment and structure
>3gha_A Disulfide bond formation protein D; BDBD, DSBA-like, TRX-like, oxidoreductase, competence, redox-active center; 1.40A {Bacillus subtilis} PDB: 3eu4_A 3gh9_A 3eu3_A Length = 202 Back     alignment and structure
>3gmf_A Protein-disulfide isomerase; oxidoreductase, PSI-2, NYSGXRC, structu genomics, protein structure initiative; 1.76A {Novosphingobium aromaticivorans} Length = 205 Back     alignment and structure
>3f4s_A Alpha-DSBA1, putative uncharacterized protein; thioredoxin-fold, oxidoreductase; HET: PGE; 1.55A {Wolbachia pipientis} PDB: 3f4r_A* 3f4t_A* Length = 226 Back     alignment and structure
>1z6m_A Conserved hypothetical protein; structural genomics, MCSG,, protein structure initiative, midwest center for structural genomics; HET: MSE; 1.30A {Enterococcus faecalis} SCOP: c.47.1.13 Length = 175 Back     alignment and structure
>3gyk_A 27KDA outer membrane protein; APC61738.2, silicibacter pomeroyi DSS-3, thioredoxin-like, oxidoreductase, structural genomics, PSI-2; HET: MSE; 1.76A {Silicibacter pomeroyi} Length = 175 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query160
3gn3_A182 Putative protein-disulfide isomerase; MCSG, PSI, s 99.69
4dvc_A184 Thiol:disulfide interchange protein DSBA; pilus as 99.57
3gmf_A205 Protein-disulfide isomerase; oxidoreductase, PSI-2 99.56
3gha_A202 Disulfide bond formation protein D; BDBD, DSBA-lik 99.51
3bci_A186 Disulfide bond protein A; thiol-disulfide oxidored 99.49
3kzq_A208 Putative uncharacterized protein VP2116; protein w 99.46
3hd5_A195 Thiol:disulfide interchange protein DSBA; protein 99.46
3fz5_A202 Possible 2-hydroxychromene-2-carboxylate isomeras; 99.45
3gl5_A239 Putative DSBA oxidoreductase SCO1869; probable DSB 99.45
2imf_A203 HCCA isomerase, 2-hydroxychromene-2-carboxylate is 99.44
3h93_A192 Thiol:disulfide interchange protein DSBA; disulfid 99.44
3gyk_A175 27KDA outer membrane protein; APC61738.2, siliciba 99.43
2in3_A216 Hypothetical protein; DSBA family, FRNE-like subfa 99.43
3hz8_A193 Thiol:disulfide interchange protein DSBA; thiol-ox 99.4
2rem_A193 Disulfide oxidoreductase; disulfide oxidoreductase 99.39
3l9s_A191 Thiol:disulfide interchange protein; thioredoxin-f 99.36
3l9v_A189 Putative thiol-disulfide isomerase or thioredoxin; 99.36
3f4s_A226 Alpha-DSBA1, putative uncharacterized protein; thi 99.35
2znm_A195 Thiol:disulfide interchange protein DSBA; thioredo 99.32
3c7m_A195 Thiol:disulfide interchange protein DSBA-like; red 99.32
1r4w_A226 Glutathione S-transferase, mitochondrial; glutathi 99.28
3feu_A185 Putative lipoprotein; alpha-beta structure, struct 99.25
3rpp_A234 Glutathione S-transferase kappa 1; glutathione tra 99.13
1z6m_A175 Conserved hypothetical protein; structural genomic 98.8
1un2_A 197 DSBA, thiol-disulfide interchange protein; disulfi 98.74
3gv1_A147 Disulfide interchange protein; neisseria gonorrhoe 98.35
1t3b_A211 Thiol:disulfide interchange protein DSBC; oxidored 97.97
1eej_A216 Thiol:disulfide interchange protein; oxidoreductas 97.88
1v58_A241 Thiol:disulfide interchange protein DSBG; reduced 97.65
1nho_A85 Probable thioredoxin; beta sheet, alpha helix, oxi 97.38
1fo5_A85 Thioredoxin; disulfide oxidoreductase, structural 97.34
3kp8_A106 Vkorc1/thioredoxin domain protein; blood coagulati 97.05
2e0q_A104 Thioredoxin; electron transport; 1.49A {Sulfolobus 96.88
2trx_A108 Thioredoxin; electron transport; 1.68A {Escherichi 96.86
1thx_A115 Thioredoxin, thioredoxin 2; oxido-reductase, elect 96.82
1ilo_A77 Conserved hypothetical protein MTH895; beta-alpha- 96.77
1fb6_A105 Thioredoxin M; electron transport; 2.10A {Spinacia 96.76
1t00_A112 Thioredoxin, TRX; redox regulation, multifunction 96.75
3gnj_A111 Thioredoxin domain protein; APC92103, STR genomics 96.69
1dby_A107 Chloroplast thioredoxin M CH2; thioredoxin CH2, ch 96.65
3tco_A109 Thioredoxin (TRXA-1); disulfide oxidoreductase, ox 96.64
2l57_A126 Uncharacterized protein; structural genomics, unkn 96.61
3p2a_A148 Thioredoxin 2, putative thioredoxin-like protein; 96.61
1w4v_A119 Thioredoxin, mitochondrial; antioxidant enzyme, mi 96.61
2es7_A142 Q8ZP25_salty, putative thiol-disulfide isomerase a 96.61
2i4a_A107 Thioredoxin; acidophIle, disulfide exchange, oxido 96.61
1ep7_A112 Thioredoxin CH1, H-type; electron transport; 2.10A 96.58
1v98_A140 Thioredoxin; oxidoreductase, structural genomics, 96.55
1nsw_A105 Thioredoxin, TRX; thermostability, electron transp 96.55
2yzu_A109 Thioredoxin; redox protein, electron transport, st 96.52
3die_A106 Thioredoxin, TRX; electron transport, SWAP domain, 96.52
3emx_A135 Thioredoxin; structural genomics, oxidoreductase, 96.52
1r26_A125 Thioredoxin; redox-active disulfide, electron tran 96.48
1xwb_A106 Thioredoxin; dimerization, redox regulation, THI X 96.41
3hz4_A140 Thioredoxin; NYSGXRC, PSI-II, reduced form, protei 96.4
3m9j_A105 Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} 96.39
2voc_A112 Thioredoxin; electron transport, homodimer, disulf 96.39
2vlu_A122 Thioredoxin, thioredoxin H isoform 2.; oxidoreduct 96.38
2o8v_B128 Thioredoxin 1; disulfide crosslinked complex, oxid 96.36
2vim_A104 Thioredoxin, TRX; thioredoxin fold, oxidoreductase 96.25
2i1u_A121 Thioredoxin, TRX, MPT46; redox protein, electron t 96.25
2f9s_A151 Thiol-disulfide oxidoreductase RESA; thioredoxin-l 96.25
1syr_A112 Thioredoxin; SGPP, structural genomics, PSI, prote 96.24
2xc2_A117 Thioredoxinn; oxidoreductase, protein disulfide re 96.23
3dml_A116 Putative uncharacterized protein; thioredoxin, oxi 96.2
3zzx_A105 Thioredoxin; oxidoreductase; 1.88A {Litopenaeus va 96.19
2ppt_A155 Thioredoxin-2; thiredoxin, zinc finger, oxidoreduc 96.18
2lja_A152 Putative thiol-disulfide oxidoreductase; structura 96.18
2qgv_A140 Hydrogenase-1 operon protein HYAE; alpha-beta prot 96.14
3uvt_A111 Thioredoxin domain-containing protein 5; thioredox 96.13
1xfl_A124 Thioredoxin H1; AT3G51030, structural genomics, pr 96.13
2l5o_A153 Putative thioredoxin; structural genomics, unknown 96.12
2vm1_A118 Thioredoxin, thioredoxin H isoform 1.; oxidoreduct 96.11
2dj1_A140 Protein disulfide-isomerase A4; protein ERP-72, ER 96.1
4euy_A105 Uncharacterized protein; structural genomics, PSI- 96.09
3d6i_A112 Monothiol glutaredoxin-3; thioredoxin-like, electr 96.09
1x5d_A133 Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC 96.07
3qfa_C116 Thioredoxin; protein-protein complex, rossmann fol 96.07
1oaz_A123 Thioredoxin 1; immune system, antibody/complex, an 96.05
2b5x_A148 YKUV protein, TRXY; thioredoxin-like, oxidoreducta 96.05
2j23_A121 Thioredoxin; immune protein, autoreactivity, cross 96.04
2kuc_A130 Putative disulphide-isomerase; structural genomics 96.03
2l6c_A110 Thioredoxin; oxidoreductase; NMR {Desulfovibrio vu 96.0
2ju5_A154 Thioredoxin disulfide isomerase; protein, oxidored 95.99
1zma_A118 Bacterocin transport accessory protein; alpha-beta 95.97
1ti3_A113 Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Popul 95.94
3eyt_A158 Uncharacterized protein SPOA0173; thioredoxin-like 95.93
2yj7_A106 LPBCA thioredoxin; oxidoreductase; 1.65A {Syntheti 94.92
1mek_A120 Protein disulfide isomerase; electron transport, r 95.91
2hls_A243 Protein disulfide oxidoreductase; thioredoxin fold 95.89
1ego_A85 Glutaredoxin; electron transport; NMR {Escherichia 95.88
3f3q_A109 Thioredoxin-1; His TAG, electron transport, cytopl 95.87
1zzo_A136 RV1677; thioredoxin fold, structural genomics, PSI 95.86
3d22_A139 TRXH4, thioredoxin H-type; electron transport, cyt 95.83
1faa_A124 Thioredoxin F; electron transport; 1.85A {Spinacia 95.82
3ul3_B128 Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; 95.71
3cxg_A133 Putative thioredoxin; malaria, structural GEN oxid 95.71
3hxs_A141 Thioredoxin, TRXP; electron transport; 2.00A {Bact 95.69
3lor_A160 Thiol-disulfide isomerase and thioredoxins; PSI, M 95.67
1x5e_A126 Thioredoxin domain containing protein 1; TMX, TXND 95.62
2pu9_C111 TRX-F, thioredoxin F-type, chloroplast; protein-pr 95.6
3ktb_A106 Arsenical resistance operon trans-acting represso; 95.55
2ywm_A229 Glutaredoxin-like protein; redox protein, structur 95.5
2lst_A130 Thioredoxin; structural genomics, NEW YORK structu 94.49
3kp9_A291 Vkorc1/thioredoxin domain protein; warfarin, disul 95.44
2l5l_A136 Thioredoxin; structural genomics, electron transpo 95.41
3ia1_A154 THIO-disulfide isomerase/thioredoxin; oxidoreducta 95.35
3msz_A89 Glutaredoxin 1; alpha-beta sandwich, center for st 95.35
2qsi_A137 Putative hydrogenase expression/formation protein; 95.34
3gix_A149 Thioredoxin-like protein 4B; PRE-mRNA splicing, TX 95.32
1gh2_A107 Thioredoxin-like protein; redox-active center, ele 95.26
3f9u_A172 Putative exported cytochrome C biogenesis-related; 95.25
2fwh_A134 Thiol:disulfide interchange protein DSBD; thioredo 95.22
2e7p_A116 Glutaredoxin; thioredoxin fold, poplar, electron t 95.2
2wz9_A153 Glutaredoxin-3; protein binding; 1.55A {Homo sapie 95.2
1wmj_A130 Thioredoxin H-type; structural genomics, program f 95.1
3raz_A151 Thioredoxin-related protein; structural genomics, 95.08
2h30_A164 Thioredoxin, peptide methionine sulfoxide reductas 95.07
1kng_A156 Thiol:disulfide interchange protein CYCY; thioredo 95.04
3kgk_A110 Arsenical resistance operon trans-acting represso; 95.04
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 94.99
2lrn_A152 Thiol:disulfide interchange protein; structural ge 94.85
1lu4_A136 Soluble secreted antigen MPT53; thioredoxin-like f 94.84
1r7h_A75 NRDH-redoxin; thioredoxin, glutaredoxin, redox pro 94.84
3or5_A165 Thiol:disulfide interchange protein, thioredoxin p 94.8
2oe3_A114 Thioredoxin-3; electron transport, alpha/beta sand 94.79
4evm_A138 Thioredoxin family protein; structural genomics, n 94.64
1a8l_A226 Protein disulfide oxidoreductase; PDI, thioredoxin 94.62
3idv_A 241 Protein disulfide-isomerase A4; thioredoxin-like f 94.6
3ha9_A165 Uncharacterized thioredoxin-like protein; PSI, MCS 94.55
3idv_A241 Protein disulfide-isomerase A4; thioredoxin-like f 94.51
2dml_A130 Protein disulfide-isomerase A6; thioredoxin domain 94.47
1h75_A81 Glutaredoxin-like protein NRDH; electron transport 94.42
1qgv_A142 Spliceosomal protein U5-15KD; snRNP, thioredoxin, 94.42
3fkf_A148 Thiol-disulfide oxidoreductase; structural genomic 94.34
3hcz_A148 Possible thiol-disulfide isomerase; APC61559.2, cy 94.33
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 94.28
3ic4_A92 Glutaredoxin (GRX-1); structural genomics, PSI, MC 94.24
3ewl_A142 Uncharacterized conserved protein BF1870; alpha-be 94.1
3fk8_A133 Disulphide isomerase; APC61824.1, xylella fastidio 94.05
3erw_A145 Sporulation thiol-disulfide oxidoreductase A; thio 94.05
2b1k_A168 Thiol:disulfide interchange protein DSBE; C-termin 94.0
3h79_A127 Thioredoxin-like protein; thioredoxin fold, cataly 93.83
1fov_A82 Glutaredoxin 3, GRX3; active site disulfide, CIS P 93.75
3aps_A122 DNAJ homolog subfamily C member 10; thioredoxin fo 93.74
3ph9_A151 Anterior gradient protein 3 homolog; thioredoxin f 93.7
3fw2_A150 Thiol-disulfide oxidoreductase; structural genomic 93.47
2dj3_A133 Protein disulfide-isomerase A4; protein ERP-72, ER 93.39
1wjk_A100 C330018D20RIK protein; glutaredoxin, thioredoxin f 93.32
1ttz_A87 Conserved hypothetical protein; structural genomic 93.3
3qou_A 287 Protein YBBN; thioredoxin-like fold, tetratricopep 93.27
3gl3_A152 Putative thiol:disulfide interchange protein DSBE; 93.26
2ywi_A196 Hypothetical conserved protein; uncharacterized co 93.23
3kcm_A154 Thioredoxin family protein; SGX, thioredoxin prote 93.19
2k8s_A80 Thioredoxin; dimer, structural genomics, PSI-2, pr 93.05
3kh7_A176 Thiol:disulfide interchange protein DSBE; TRX-like 93.03
2av4_A160 Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECI 92.91
2klx_A89 Glutaredoxin; thioredoxin type domain, ssgcid, ele 92.84
1kte_A105 Thioltransferase; redox-active center, electron tr 92.57
2ht9_A146 Glutaredoxin-2; thioredoxin fold, iron-sulfur clus 92.5
2dbc_A135 PDCL2, unnamed protein product; phosducin-like pro 92.28
2djj_A121 PDI, protein disulfide-isomerase; thioredoxin fold 92.24
3c1r_A118 Glutaredoxin-1; oxidized form, oxidoreductase, cyt 92.06
2hze_A114 Glutaredoxin-1; thioredoxin fold, arsenic, dimethy 91.95
2dlx_A153 UBX domain-containing protein 7; UAS domain, prote 91.8
2r2j_A 382 Thioredoxin domain-containing protein 4; CRFS moti 91.48
3eur_A142 Uncharacterized protein; PSI2,MCSG, conserved prot 91.48
2djk_A133 PDI, protein disulfide-isomerase; thioredoxin fold 91.47
2ggt_A164 SCO1 protein homolog, mitochondrial; copper chaper 90.91
3f8u_A 481 Protein disulfide-isomerase A3ERP57; endoplasmic r 90.82
2cvb_A188 Probable thiol-disulfide isomerase/thioredoxin; re 90.77
2yan_A105 Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {H 90.73
3qmx_A99 Glutaredoxin A, glutaredoxin 3; electron transport 90.71
3nzn_A103 Glutaredoxin; structural genomics, PSI2, MCSG, pro 90.68
3u5r_E218 Uncharacterized protein; structural genomics, PSI- 90.59
1a8l_A226 Protein disulfide oxidoreductase; PDI, thioredoxin 90.35
2f51_A118 Thioredoxin; electron transport; 1.90A {Trichomona 90.22
3evi_A118 Phosducin-like protein 2; alpha beta, 3-layer(ABA) 90.22
3cmi_A171 Peroxiredoxin HYR1; thioredoxin-like fold, oxidore 90.13
2cq9_A130 GLRX2 protein, glutaredoxin 2; glutathione-S-trans 90.04
1wou_A123 Thioredoxin -related protein, 14 kDa; electron tra 90.03
3rhb_A113 ATGRXC5, glutaredoxin-C5, chloroplastic; thioredox 89.91
2khp_A92 Glutaredoxin; thioredoxin type domain, ssgcid, ele 89.62
2lrt_A152 Uncharacterized protein; structural genomics, thio 89.56
3us3_A 367 Calsequestrin-1; calcium-binding protein; 1.74A {O 89.47
2hyx_A 352 Protein DIPZ; thioredoxin fold, jelly-roll, struct 89.39
2axo_A 270 Hypothetical protein ATU2684; alpha beta protein., 89.32
4fo5_A143 Thioredoxin-like protein; AHPC/TSA family protein, 89.03
2vup_A190 Glutathione peroxidase-like protein; oxidoreductas 88.61
2rli_A171 SCO2 protein homolog, mitochondrial; copper protei 88.51
3lwa_A183 Secreted thiol-disulfide isomerase; thioredoxin, P 88.09
2b5e_A 504 Protein disulfide-isomerase; 2.40A {Saccharomyces 88.04
2ywm_A229 Glutaredoxin-like protein; redox protein, structur 87.61
2lqo_A92 Putative glutaredoxin RV3198.1/MT3292; TRX fold, o 87.12
3ctg_A129 Glutaredoxin-2; reduced form, electron transport, 86.88
3q6o_A 244 Sulfhydryl oxidase 1; protein disulfide isomerase, 86.63
3h8q_A114 Thioredoxin reductase 3; oxidoreductase, structura 85.94
1sji_A 350 Calsequestrin 2, calsequestrin, cardiac muscle iso 85.46
2fgx_A107 Putative thioredoxin; NET3, NESG, GFT-glutaredoxin 85.09
2trc_P217 Phosducin, MEKA, PP33; transducin, beta-gamma, sig 85.04
3ed3_A 298 Protein disulfide-isomerase MPD1; thioredoxin-like 84.44
1hyu_A 521 AHPF, alkyl hydroperoxide reductase subunit F; thi 83.67
2v1m_A169 Glutathione peroxidase; selenium, selenocysteine, 83.51
1sen_A164 Thioredoxin-like protein P19; endoplasmic reticulu 83.12
2qc7_A 240 ERP31, ERP28, endoplasmic reticulum protein ERP29; 82.94
3ira_A173 Conserved protein; methanosarcina mazei,structural 82.77
1t1v_A93 SH3BGRL3, SH3 domain-binding glutamic acid-rich pr 81.89
1wik_A109 Thioredoxin-like protein 2; picot homology 2 domai 81.82
1we0_A187 Alkyl hydroperoxide reductase C; peroxiredoxin, AH 81.74
3tdg_A273 DSBG, putative uncharacterized protein; thioredoxi 81.25
3t58_A 519 Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2. 81.08
3ipz_A109 Monothiol glutaredoxin-S14, chloroplastic; electro 80.42
>3gn3_A Putative protein-disulfide isomerase; MCSG, PSI, structural GEN protein structure initiative, midwest center for structural genomics; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
Probab=99.69  E-value=1.1e-16  Score=123.79  Aligned_cols=115  Identities=18%  Similarity=0.390  Sum_probs=90.8

Q ss_pred             eeeeeccCc---h---hhhHHHHHHHHHhhh--h-----HHHHh--chhhh-hcC----CCCCCChHHHHHHHHHHHHhh
Q 031378           19 KLASYFRDK---F---VCFFLVVLYIKRRLN--C-----LLEIV--QQEKF-YNA----PTQNMTRTAVVKEIVKFAAEG   78 (160)
Q Consensus        19 ~~~~~~~~~---~---~~~a~ra~~aar~~~--~-----~l~~~--~Q~~f-~~~----~~~~~t~~~i~~~la~~A~~~   78 (160)
                      +|.+++|.-   +   +..++|+..++++++  +     +.+.+  +|+.| +..    +..++++.+++..+++.+   
T Consensus        47 ~v~~v~r~~p~~~h~~s~~aaraa~aa~~~~~~~~~f~~~~~aLf~~q~~~~~~~~~~~~~~~~~~~~~l~~~a~~~---  123 (182)
T 3gn3_A           47 NVTVRIRLQSQPWHMFSGVIVRCILAAATLEGGKESAKAVMTAVASHREEFEFEHHAGGPNLDATPNDIIARIERYS---  123 (182)
T ss_dssp             TEEEEEEECCCTTSTTHHHHHHHHHHHTTSTTHHHHHHHHHHHHHHTGGGGSCBTTTBSGGGGCCHHHHHHHHHHHH---
T ss_pred             CEEEEEEEcCCCCCccHHHHHHHHHHHHHhccChHHHHHHHHHHHhcCcccccccccccccCCCCHHHHHHHHHHHh---
Confidence            556655531   1   247889999998873  2     45544  89998 342    345678888777777664   


Q ss_pred             cCCChhHHHHcccCChhHHHHHHHHHHHhhcCCccccceEEECCEEecCCCCCCCHHHHHHHH
Q 031378           79 IGNSYSSALESGFSDRSTDLLTRVSFKFSATRGVYATPTFFVNGFSLAGAGSPLDYNGWRKVI  141 (160)
Q Consensus        79 ~Gld~~~~f~~~l~~~~~~~~i~~~~k~a~~~GV~GTPTffING~~~~ga~s~~~~e~~~~~I  141 (160)
                       |+| .+++   ++++++...++.+.++++++||+|||||+|||+++++.+|++++++|.++|
T Consensus       124 -Gld-~~~~---l~~~~~~~~v~~~~~~a~~~GV~gtPtf~ing~~~~~~s~~~~~e~w~~~l  181 (182)
T 3gn3_A          124 -GLA-LAEA---FANPELEHAVKWHTKYARQNGIHVSPTFMINGLVQPGMSSGDPVSKWVSDI  181 (182)
T ss_dssp             -TCC-CHHH---HHCGGGHHHHHHHHHHHHHHTCCSSSEEEETTEECTTCCTTSCHHHHHHHH
T ss_pred             -CCC-HHHH---hcChHHHHHHHHHHHHHHHCCCCccCEEEECCEEccCCCCCCCHHHHHHHh
Confidence             999 4877   778899999999999999999999999999999998888999999999987



>4dvc_A Thiol:disulfide interchange protein DSBA; pilus assembly, oxidoreductase, thioredoxin fold, D disulfide bond, DSBB; HET: DMS; 1.20A {Vibrio cholerae} PDB: 2ijy_A 1bed_A Back     alignment and structure
>3gmf_A Protein-disulfide isomerase; oxidoreductase, PSI-2, NYSGXRC, structu genomics, protein structure initiative; 1.76A {Novosphingobium aromaticivorans} Back     alignment and structure
>3gha_A Disulfide bond formation protein D; BDBD, DSBA-like, TRX-like, oxidoreductase, competence, redox-active center; 1.40A {Bacillus subtilis} PDB: 3eu4_A 3gh9_A 3eu3_A Back     alignment and structure
>3bci_A Disulfide bond protein A; thiol-disulfide oxidoreductase, redox protein, protein folding, redox active centre; 1.81A {Staphylococcus aureus} PDB: 3bd2_A 3bck_A Back     alignment and structure
>3kzq_A Putative uncharacterized protein VP2116; protein with unknown function, STRU genomics, PSI, MCSG, protein structure initiative; HET: PG6; 2.10A {Vibrio parahaemolyticus} Back     alignment and structure
>3hd5_A Thiol:disulfide interchange protein DSBA; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.35A {Bordetella parapertussis} Back     alignment and structure
>3fz5_A Possible 2-hydroxychromene-2-carboxylate isomeras; 2-hydroxychromene-2-carboxylate ISO structural genomics, PSI-2; HET: MSE GSH PGE; 2.40A {Rhodobacter sphaeroides 2} Back     alignment and structure
>3gl5_A Putative DSBA oxidoreductase SCO1869; probable DSBA oxidoreductase structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.15A {Streptomyces coelicolor A3} Back     alignment and structure
>2imf_A HCCA isomerase, 2-hydroxychromene-2-carboxylate isomerase; glutathione, KGST, kappa GST, transferase; HET: GSH TOM CXS; 1.30A {Pseudomonas putida} PDB: 2ime_A* 2imd_A* Back     alignment and structure
>3h93_A Thiol:disulfide interchange protein DSBA; disulfide bond, redox-active center, transcription regulator; HET: MSE GOL; 1.50A {Pseudomonas aeruginosa PAO1} SCOP: c.47.1.0 Back     alignment and structure
>3gyk_A 27KDA outer membrane protein; APC61738.2, silicibacter pomeroyi DSS-3, thioredoxin-like, oxidoreductase, structural genomics, PSI-2; HET: MSE; 1.76A {Silicibacter pomeroyi} Back     alignment and structure
>2in3_A Hypothetical protein; DSBA family, FRNE-like subfamily, disulfide isomerase, struc genomics, PSI-2, protein structure initiative; 1.85A {Nitrosomonas europaea} Back     alignment and structure
>3hz8_A Thiol:disulfide interchange protein DSBA; thiol-oxidoreductase, disulfide bond; 1.45A {Neisseria meningitidis MC58} PDB: 3dvw_A 3a3t_A Back     alignment and structure
>2rem_A Disulfide oxidoreductase; disulfide oxidoreductase, DSBA, thioredoxin fold, redox- active center; 1.90A {Xylella fastidiosa} Back     alignment and structure
>3l9s_A Thiol:disulfide interchange protein; thioredoxin-fold, DSBA, thiol-disulfide oxidoreductase, DISU bond, redox-active center; 1.58A {Salmonella enterica subsp} SCOP: c.47.1.13 PDB: 1a23_A 1a24_A 1a2j_A 1a2l_A 1a2m_A 1dsb_A 1fvk_A 3dks_A 1bq7_A 1fvj_A 1acv_A 1u3a_A* 1ti1_A* 2hi7_A* 2leg_A* 2zup_A* 3e9j_B* 1ac1_A 2b6m_A 2b3s_A Back     alignment and structure
>3l9v_A Putative thiol-disulfide isomerase or thioredoxin; thioredoxin-fold, SRGA, thiol-disulfide oxidoreductase, ISOM oxidoreductase; HET: PE8 P4C P6G; 2.15A {Salmonella enterica subsp} SCOP: c.47.1.0 Back     alignment and structure
>3f4s_A Alpha-DSBA1, putative uncharacterized protein; thioredoxin-fold, oxidoreductase; HET: PGE; 1.55A {Wolbachia pipientis} PDB: 3f4r_A* 3f4t_A* Back     alignment and structure
>2znm_A Thiol:disulfide interchange protein DSBA; thioredoxin fold, DSBA-like, oxidoreductase; 2.30A {Neisseria meningitidis serogroup B} PDB: 3dvx_A Back     alignment and structure
>3c7m_A Thiol:disulfide interchange protein DSBA-like; redox protein, periplasm, redox-active center, oxidoreductase; HET: PGE; 1.55A {Escherichia coli} PDB: 3l9u_A Back     alignment and structure
>1r4w_A Glutathione S-transferase, mitochondrial; glutathione transferase, kappa GST, RGSTK1-1; HET: GSH; 2.50A {Rattus norvegicus} SCOP: c.47.1.13 Back     alignment and structure
>3feu_A Putative lipoprotein; alpha-beta structure, structural genomics, PSI-2, protein ST initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.76A {Vibrio fischeri} SCOP: c.47.1.0 Back     alignment and structure
>3rpp_A Glutathione S-transferase kappa 1; glutathione transferase, kappa GST, TRX domain, GSH binding, detoxification, APO form; 1.80A {Homo sapiens} PDB: 3rpn_A 1yzx_A* Back     alignment and structure
>1z6m_A Conserved hypothetical protein; structural genomics, MCSG,, protein structure initiative, midwest center for structural genomics; HET: MSE; 1.30A {Enterococcus faecalis} SCOP: c.47.1.13 Back     alignment and structure
>1un2_A DSBA, thiol-disulfide interchange protein; disulfide oxidoreductase, oxidoreductase, protein disulfide isomerase, protein folding, thioredoxin; 2.4A {Escherichia coli} SCOP: c.47.1.13 Back     alignment and structure
>3gv1_A Disulfide interchange protein; neisseria gonorrhoeae (strain 700825 / FA 1090), DSBC, structural genomics, unknown funct 2; 2.00A {Neisseria gonorrhoeae} Back     alignment and structure
>1t3b_A Thiol:disulfide interchange protein DSBC; oxidoreductase, protein disulfide isomerase, protein folding, redox protein; 2.50A {Haemophilus influenzae} SCOP: c.47.1.9 d.17.3.1 Back     alignment and structure
>1eej_A Thiol:disulfide interchange protein; oxidoreductase, protein disulfide isomerase, protein folding, redox protein, redox-active center; HET: MES; 1.90A {Escherichia coli} SCOP: c.47.1.9 d.17.3.1 PDB: 1tjd_A 1jzd_A 1jzo_A 1g0t_A 2iyj_A Back     alignment and structure
>1v58_A Thiol:disulfide interchange protein DSBG; reduced DSBG, redox protein, protein disulfide isomerase, thioredoxin fold; 1.70A {Escherichia coli} SCOP: c.47.1.9 d.17.3.1 PDB: 1v57_A 2h0i_A 2h0h_A 2h0g_A 2iy2_A Back     alignment and structure
>1nho_A Probable thioredoxin; beta sheet, alpha helix, oxidoreductase; NMR {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.47.1.1 Back     alignment and structure
>1fo5_A Thioredoxin; disulfide oxidoreductase, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; NMR {Methanocaldococcus jannaschii} SCOP: c.47.1.1 Back     alignment and structure
>3kp8_A Vkorc1/thioredoxin domain protein; blood coagulation, disulfide formation, redox partner, oxidoreductase; 1.66A {Synechococcus SP} Back     alignment and structure
>2e0q_A Thioredoxin; electron transport; 1.49A {Sulfolobus tokodaii} PDB: 3hhv_A Back     alignment and structure
>2trx_A Thioredoxin; electron transport; 1.68A {Escherichia coli} SCOP: c.47.1.1 PDB: 1skr_B* 1skw_B* 1sl0_B* 1sks_B* 1sl2_B* 1t7p_B* 1t8e_B* 1tk0_B* 1tk5_B* 1tk8_B* 1tkd_B* 1sl1_B* 1x9s_B* 1x9w_B* 1xoa_A 1xob_A 1zyq_B* 2ajq_B* 2bto_T* 2h6x_A ... Back     alignment and structure
>1thx_A Thioredoxin, thioredoxin 2; oxido-reductase, electron transport; 1.60A {Nostoc SP} SCOP: c.47.1.1 Back     alignment and structure
>1ilo_A Conserved hypothetical protein MTH895; beta-alpha-beta-alpha-beta-BETA-alpha motif, structural genomics, PSI; NMR {Methanothermobacterthermautotrophicus str} SCOP: c.47.1.1 Back     alignment and structure
>1fb6_A Thioredoxin M; electron transport; 2.10A {Spinacia oleracea} SCOP: c.47.1.1 PDB: 1fb0_A 1gl8_A 2puk_C Back     alignment and structure
>1t00_A Thioredoxin, TRX; redox regulation, multifunction macromolecule, electron transport; 1.51A {Streptomyces coelicolor} Back     alignment and structure
>3gnj_A Thioredoxin domain protein; APC92103, STR genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.99A {Desulfitobacterium hafniense dcb-2} SCOP: c.47.1.0 Back     alignment and structure
>1dby_A Chloroplast thioredoxin M CH2; thioredoxin CH2, chloroplastic thioredoxin, oxidoreductase; NMR {Chlamydomonas reinhardtii} SCOP: c.47.1.1 Back     alignment and structure
>3tco_A Thioredoxin (TRXA-1); disulfide oxidoreductase, oxidoreductase; 1.90A {Sulfolobus solfataricus} SCOP: c.47.1.0 Back     alignment and structure
>2l57_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, PSI protein structure initiative; NMR {Clostridium perfringens} Back     alignment and structure
>3p2a_A Thioredoxin 2, putative thioredoxin-like protein; structural genomics, center for structural genomics of infec diseases, csgid; 2.19A {Yersinia pestis} Back     alignment and structure
>1w4v_A Thioredoxin, mitochondrial; antioxidant enzyme, mitochondrion, electron TRA oxidoreductase; 1.80A {Homo sapiens} PDB: 1uvz_A 1w89_A Back     alignment and structure
>2es7_A Q8ZP25_salty, putative thiol-disulfide isomerase and thioredoxi; structural genomics, PSI, protein structure initiative; 2.80A {Salmonella typhimurium} SCOP: c.47.1.20 PDB: 2gzp_A 2jzt_A Back     alignment and structure
>2i4a_A Thioredoxin; acidophIle, disulfide exchange, oxidoreductase; 1.00A {Acetobacter aceti} Back     alignment and structure
>1ep7_A Thioredoxin CH1, H-type; electron transport; 2.10A {Chlamydomonas reinhardtii} SCOP: c.47.1.1 PDB: 1tof_A 1ep8_A Back     alignment and structure
>1v98_A Thioredoxin; oxidoreductase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.82A {Thermus thermophilus} Back     alignment and structure
>1nsw_A Thioredoxin, TRX; thermostability, electron transport; 1.90A {Alicyclobacillus acidocaldarius} SCOP: c.47.1.1 PDB: 1rqm_A 1quw_A 1nw2_A Back     alignment and structure
>2yzu_A Thioredoxin; redox protein, electron transport, structural genomics; 1.90A {Thermus thermophilus} PDB: 2cvk_A Back     alignment and structure
>3die_A Thioredoxin, TRX; electron transport, SWAP domain, redox enzymology, oxidoreductase, redox-active center, transport; 1.85A {Staphylococcus aureus} SCOP: c.47.1.1 PDB: 2o7k_A 2o85_A 2o89_A 2o87_A Back     alignment and structure
>3emx_A Thioredoxin; structural genomics, oxidoreductase, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.25A {Aeropyrum pernix} Back     alignment and structure
>1r26_A Thioredoxin; redox-active disulfide, electron transport; 1.40A {Trypanosoma} SCOP: c.47.1.1 Back     alignment and structure
>1xwb_A Thioredoxin; dimerization, redox regulation, THI X-RAY electron transport; 2.20A {Drosophila melanogaster} SCOP: c.47.1.1 PDB: 1xw9_A 1xwc_A 1xwa_A Back     alignment and structure
>3hz4_A Thioredoxin; NYSGXRC, PSI-II, reduced form, protein structure initiative, structural genomics; 2.30A {Methanosarcina mazei} Back     alignment and structure
>3m9j_A Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} SCOP: c.47.1.1 PDB: 3m9k_A 2hsh_A 1erv_A 2ifq_A 2ifq_B 1auc_A 1eru_A 1ert_A 3kd0_A 1aiu_A 3trx_A 4trx_A 1trs_A 1tru_A 1trv_A 1trw_A 3e3e_A* 1cqg_A 1cqh_A 1mdi_A ... Back     alignment and structure
>2voc_A Thioredoxin; electron transport, homodimer, disulfide, transport, redox-active center; 1.50A {Bacillus subtilis} PDB: 2ipa_A 2gzy_A 2gzz_A Back     alignment and structure
>2vlu_A Thioredoxin, thioredoxin H isoform 2.; oxidoreductase, thioredoxin-fold, protein disulfide reductase; 1.70A {Hordeum vulgare var} PDB: 2vlt_A 2vlv_A 2iwt_A* Back     alignment and structure
>2o8v_B Thioredoxin 1; disulfide crosslinked complex, oxidoreductase; 3.00A {Escherichia coli} Back     alignment and structure
>2vim_A Thioredoxin, TRX; thioredoxin fold, oxidoreductase; 1.38A {Fasciola hepatica} Back     alignment and structure
>2i1u_A Thioredoxin, TRX, MPT46; redox protein, electron transport; 1.30A {Mycobacterium tuberculosis} PDB: 3nof_A 3o6t_A* 2l4q_A 2l59_A Back     alignment and structure
>2f9s_A Thiol-disulfide oxidoreductase RESA; thioredoxin-like protein; HET: MSE; 1.40A {Bacillus subtilis} SCOP: c.47.1.10 PDB: 1st9_A 1su9_A 2h1d_A 2h1b_A 2h1a_A 2h19_A 2h1g_A 3c71_A 3c73_A Back     alignment and structure
>1syr_A Thioredoxin; SGPP, structural genomics, PSI, protein structure initiative structural genomics of pathogenic protozoa consortium; 2.95A {Plasmodium falciparum} SCOP: c.47.1.1 Back     alignment and structure
>2xc2_A Thioredoxinn; oxidoreductase, protein disulfide reductase; 1.56A {Schistosoma mansoni} PDB: 2xbq_A 2xbi_A Back     alignment and structure
>3dml_A Putative uncharacterized protein; thioredoxin, oxidoreductase, sulfur oxidation, thiol- disulfide oxidoreductase; HET: MSE; 1.90A {Paracoccus denitrificans} PDB: 3d4t_A* Back     alignment and structure
>3zzx_A Thioredoxin; oxidoreductase; 1.88A {Litopenaeus vannamei} Back     alignment and structure
>2ppt_A Thioredoxin-2; thiredoxin, zinc finger, oxidoreductase; 1.92A {Rhodobacter capsulatus} Back     alignment and structure
>2lja_A Putative thiol-disulfide oxidoreductase; structural genomics, unknown function, thioredoxin-like; NMR {Bacteroides vulgatus} Back     alignment and structure
>2qgv_A Hydrogenase-1 operon protein HYAE; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Shigella flexneri 2A} PDB: 2hfd_A Back     alignment and structure
>3uvt_A Thioredoxin domain-containing protein 5; thioredoxin-like fold, isomerase; 2.00A {Homo sapiens} PDB: 2diz_A 3uj1_A Back     alignment and structure
>1xfl_A Thioredoxin H1; AT3G51030, structural genomics, protein structure initiative, CESG, center for eukaryotic structural genomics; NMR {Arabidopsis thaliana} SCOP: c.47.1.1 Back     alignment and structure
>2l5o_A Putative thioredoxin; structural genomics, unknown function, PSI-2, protein struct initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>2vm1_A Thioredoxin, thioredoxin H isoform 1.; oxidoreductase, protein disulfide reductase, thioredoxin-FOL; 1.7A {Hordeum vulgare var} PDB: 2vm2_A Back     alignment and structure
>2dj1_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>4euy_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; 2.90A {Bacillus cereus} Back     alignment and structure
>3d6i_A Monothiol glutaredoxin-3; thioredoxin-like, electron transport, redox- active center, transport, oxidoreductase; HET: CME; 1.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1x5d_A Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC7, thioredoxin like domain, redox, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3qfa_C Thioredoxin; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_C* Back     alignment and structure
>1oaz_A Thioredoxin 1; immune system, antibody/complex, antibody, allergy, IGE, conformational diversity, multispecficity, redox-active center; 2.77A {Escherichia coli} SCOP: c.47.1.1 Back     alignment and structure
>2b5x_A YKUV protein, TRXY; thioredoxin-like, oxidoreductase; NMR {Bacillus subtilis} SCOP: c.47.1.10 PDB: 2b5y_A Back     alignment and structure
>2j23_A Thioredoxin; immune protein, autoreactivity, cross-reactivity, IGE, fungi, epitope, allergen; 1.41A {Malassezia sympodialis} Back     alignment and structure
>2kuc_A Putative disulphide-isomerase; structural genomics, thioredo PSI-2, protein structure initiative; NMR {Bacteroides thetaiotaomicron} Back     alignment and structure
>2l6c_A Thioredoxin; oxidoreductase; NMR {Desulfovibrio vulgaris} PDB: 2l6d_A Back     alignment and structure
>2ju5_A Thioredoxin disulfide isomerase; protein, oxidoreductase; NMR {Chlamydophila pneumoniae} Back     alignment and structure
>1zma_A Bacterocin transport accessory protein; alpha-beta-alpha-sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.25A {Streptococcus pneumoniae} SCOP: c.47.1.1 Back     alignment and structure
>1ti3_A Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Populus tremula} SCOP: c.47.1.1 Back     alignment and structure
>3eyt_A Uncharacterized protein SPOA0173; thioredoxin-like superfamily protein SPOA0173, silicibacter DSS, structural genomics, PSI-2; 1.95A {Silicibacter pomeroyi} Back     alignment and structure
>2yj7_A LPBCA thioredoxin; oxidoreductase; 1.65A {Synthetic construct} Back     alignment and structure
>1mek_A Protein disulfide isomerase; electron transport, redox-active center, endoplasmic reticulum; NMR {Homo sapiens} SCOP: c.47.1.2 Back     alignment and structure
>2hls_A Protein disulfide oxidoreductase; thioredoxin fold; 1.93A {Aeropyrum pernix} Back     alignment and structure
>1ego_A Glutaredoxin; electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 1egr_A 1grx_A* 1qfn_A Back     alignment and structure
>3f3q_A Thioredoxin-1; His TAG, electron transport, cytoplasm, deoxyribonucleotide synthesis, golgi apparatus, membrane, nucleus; 1.76A {Saccharomyces cerevisiae} PDB: 3f3r_A* 2i9h_A 2fa4_A 2hsy_A 3pin_A 4dss_B Back     alignment and structure
>1zzo_A RV1677; thioredoxin fold, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 1.60A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 3ios_A Back     alignment and structure
>3d22_A TRXH4, thioredoxin H-type; electron transport, cytoplasm, redox-active center, transport, oxidoreductase; 1.60A {Populus trichocarpa x populusdeltoides} PDB: 3d21_A Back     alignment and structure
>1faa_A Thioredoxin F; electron transport; 1.85A {Spinacia oleracea} SCOP: c.47.1.1 Back     alignment and structure
>3ul3_B Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; 2.90A {Plasmodium falciparum} Back     alignment and structure
>3cxg_A Putative thioredoxin; malaria, structural GEN oxidoreductase, structural genomics consortium, SGC; 2.00A {Plasmodium falciparum} Back     alignment and structure
>3hxs_A Thioredoxin, TRXP; electron transport; 2.00A {Bacteroides fragilis} PDB: 3hyp_A Back     alignment and structure
>3lor_A Thiol-disulfide isomerase and thioredoxins; PSI, MCSG, structural genomics, midwest CE structural genomics; HET: MSE; 2.20A {Corynebacterium glutamicum} Back     alignment and structure
>1x5e_A Thioredoxin domain containing protein 1; TMX, TXNDC1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2pu9_C TRX-F, thioredoxin F-type, chloroplast; protein-protein complex, iron-sulfur, electron transport; 1.65A {Spinacia oleracea} PDB: 2pvo_C 1f9m_A Back     alignment and structure
>3ktb_A Arsenical resistance operon trans-acting represso; alpha-beta-alpha sandwich, helix-turn-helix, structural GENO PSI-2; 2.10A {Bacteroides vulgatus} Back     alignment and structure
>2ywm_A Glutaredoxin-like protein; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 2.30A {Aquifex aeolicus} PDB: 2ayt_A Back     alignment and structure
>2lst_A Thioredoxin; structural genomics, NEW YORK structural genomics research consortium, oxidoreductase; NMR {Thermus thermophilus} Back     alignment and structure
>3kp9_A Vkorc1/thioredoxin domain protein; warfarin, disulfide formation, blood coagulation, oxidoreduc blood coagulation,oxidoreductase; HET: U10; 3.60A {Synechococcus SP} Back     alignment and structure
>2l5l_A Thioredoxin; structural genomics, electron transport, PSI-2, protein STRU initiative; NMR {Bacteroides vulgatus} Back     alignment and structure
>3ia1_A THIO-disulfide isomerase/thioredoxin; oxidoreductase, PSI-2, NYSGXRC, structu genomics, protein structure initiative; 1.76A {Thermus thermophilus} Back     alignment and structure
>3msz_A Glutaredoxin 1; alpha-beta sandwich, center for structural genomics of infec diseases, csgid, oxidoreductase; HET: GSH; 2.05A {Francisella tularensis subsp} PDB: 3lgc_A* Back     alignment and structure
>2qsi_A Putative hydrogenase expression/formation protein; HUPG, MCS SAD, structural genomics, protein structure initiative; 1.80A {Rhodopseudomonas palustris} Back     alignment and structure
>3gix_A Thioredoxin-like protein 4B; PRE-mRNA splicing, TXNL4B, DLP, cell cycle, mRNA processing, mRNA splicing, nucleus, phosphoprotein, splicing; HET: SUC; 1.33A {Homo sapiens} SCOP: c.47.1.0 PDB: 1xbs_A Back     alignment and structure
>1gh2_A Thioredoxin-like protein; redox-active center, electron transport; 2.22A {Homo sapiens} SCOP: c.47.1.1 Back     alignment and structure
>3f9u_A Putative exported cytochrome C biogenesis-related; exported cytochrome C biogenesis-related protein, bacteroide fragilis; 2.20A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>2fwh_A Thiol:disulfide interchange protein DSBD; thioredoxin-like, C-terminal domain, reduced form at PH7, oxidoreductase; 0.99A {Escherichia coli} SCOP: c.47.1.1 PDB: 2fwe_A 2fwf_A 2fwg_A 1vrs_D 1uc7_A Back     alignment and structure
>2e7p_A Glutaredoxin; thioredoxin fold, poplar, electron transport; HET: GSH; 2.10A {Populus tremula x populus tremuloides} PDB: 1z7p_A 1z7r_A Back     alignment and structure
>2wz9_A Glutaredoxin-3; protein binding; 1.55A {Homo sapiens} PDB: 2diy_A Back     alignment and structure
>1wmj_A Thioredoxin H-type; structural genomics, program for RICE genome research, oxidoreductase; NMR {Oryza sativa} Back     alignment and structure
>3raz_A Thioredoxin-related protein; structural genomics, PSI-2, protein structure initiative; 2.00A {Neisseria meningitidis serogroup B} Back     alignment and structure
>2h30_A Thioredoxin, peptide methionine sulfoxide reductase MSRA/MSRB; reduced, thiol-disulfide exchange, oxidoreductase; 1.60A {Neisseria gonorrhoeae} PDB: 2jzr_A 2jzs_A 2k9f_A 2fy6_A Back     alignment and structure
>1kng_A Thiol:disulfide interchange protein CYCY; thioredoxin fold, cytochrome C maturation, atomic resolution oxidoreductase; 1.14A {Bradyrhizobium japonicum} SCOP: c.47.1.10 Back     alignment and structure
>3kgk_A Arsenical resistance operon trans-acting represso; alpha+beta, chaperone, DNA-binding, RE transcription, transcription regulation; 1.40A {Escherichia coli} PDB: 3mwh_A Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Back     alignment and structure
>2lrn_A Thiol:disulfide interchange protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, oxidoreductase; NMR {Bacteroides SP} Back     alignment and structure
>1lu4_A Soluble secreted antigen MPT53; thioredoxin-like fold, structural genomics, PSI, protein structure initiative; 1.12A {Mycobacterium tuberculosis} SCOP: c.47.1.10 Back     alignment and structure
>1r7h_A NRDH-redoxin; thioredoxin, glutaredoxin, redox protein, domain swapping, electron transport; 2.69A {Corynebacterium ammoniagenes} SCOP: c.47.1.1 Back     alignment and structure
>3or5_A Thiol:disulfide interchange protein, thioredoxin protein; PSI-II, structural genomics, protein structure initiative; 1.66A {Chlorobaculum tepidum} SCOP: c.47.1.0 Back     alignment and structure
>2oe3_A Thioredoxin-3; electron transport, alpha/beta sandwich, oxidized, dimer; 1.80A {Saccharomyces cerevisiae} PDB: 2oe1_A 2oe0_A Back     alignment and structure
>4evm_A Thioredoxin family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.51A {Streptococcus pneumoniae} Back     alignment and structure
>1a8l_A Protein disulfide oxidoreductase; PDI, thioredoxin fold; 1.90A {Pyrococcus furiosus} SCOP: c.47.1.2 c.47.1.2 PDB: 1j08_A Back     alignment and structure
>3idv_A Protein disulfide-isomerase A4; thioredoxin-like fold, disulfide bond, endoplasmic reticulum isomerase, redox-active center; 1.95A {Homo sapiens} PDB: 2dj2_A Back     alignment and structure
>3ha9_A Uncharacterized thioredoxin-like protein; PSI, MCSG, structural G midwest center for structural genomics, protein structure initiative; 1.70A {Aeropyrum pernix} Back     alignment and structure
>3idv_A Protein disulfide-isomerase A4; thioredoxin-like fold, disulfide bond, endoplasmic reticulum isomerase, redox-active center; 1.95A {Homo sapiens} PDB: 2dj2_A Back     alignment and structure
>2dml_A Protein disulfide-isomerase A6; thioredoxin domain-containing protein 7, endoplasmic reticulum, redox-active center, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1h75_A Glutaredoxin-like protein NRDH; electron transport, thioredoxin, redox protein; 1.7A {Escherichia coli} SCOP: c.47.1.1 Back     alignment and structure
>1qgv_A Spliceosomal protein U5-15KD; snRNP, thioredoxin, transcription; 1.40A {Homo sapiens} SCOP: c.47.1.8 PDB: 1syx_A 1pqn_A Back     alignment and structure
>3fkf_A Thiol-disulfide oxidoreductase; structural genomics, PSI-2, structure initiative, midwest center for structural genomic oxidoreductase; 2.20A {Bacteroides fragilis} Back     alignment and structure
>3hcz_A Possible thiol-disulfide isomerase; APC61559.2, cytophaga hutchinsoni structural genomics, PSI-2, protein structure initiative; 1.88A {Cytophaga hutchinsonii} Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>3ic4_A Glutaredoxin (GRX-1); structural genomics, PSI, MCSG, protein structure initiative, midwest center for structural genomic oxidoreductase; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>3ewl_A Uncharacterized conserved protein BF1870; alpha-beta fold, structural genomics, PSI-2, protein structu initiative; 2.00A {Bacteroides fragilis} Back     alignment and structure
>3fk8_A Disulphide isomerase; APC61824.1, xylella fastidiosa temecul structural genomics, PSI-2, protein structure initiative; 1.30A {Xylella fastidiosa} Back     alignment and structure
>3erw_A Sporulation thiol-disulfide oxidoreductase A; thioredoxin-like fold, RESA-like fold, dithiol, STOA, redox-active center; 2.50A {Bacillus subtilis} SCOP: c.47.1.0 Back     alignment and structure
>2b1k_A Thiol:disulfide interchange protein DSBE; C-terminal thioredoxin-like domain, N-terminal beta-sheet, fingerprint rigion, oxidoreductase; 1.90A {Escherichia coli} PDB: 3k8n_A 2g0f_A 1z5y_E 2b1l_A Back     alignment and structure
>3h79_A Thioredoxin-like protein; thioredoxin fold, catalytic cysteines missing, unknown funct; 1.50A {Trypanosoma cruzi} SCOP: c.47.1.0 Back     alignment and structure
>1fov_A Glutaredoxin 3, GRX3; active site disulfide, CIS Pro 53, electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 3grx_A* Back     alignment and structure
>3aps_A DNAJ homolog subfamily C member 10; thioredoxin fold, CXXC motif, endoplasmic reticulum, oxidore; 1.90A {Mus musculus} Back     alignment and structure
>3ph9_A Anterior gradient protein 3 homolog; thioredoxin fold, protein disulfide isomerase, endoplasmic R isomerase; 1.83A {Homo sapiens} SCOP: c.47.1.0 PDB: 2lns_A 2lnt_A Back     alignment and structure
>3fw2_A Thiol-disulfide oxidoreductase; structural genomics, APC61456.1, thiol-disulfide oxidoreduct TLPA-like family, PSI-2; 1.74A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2dj3_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1wjk_A C330018D20RIK protein; glutaredoxin, thioredoxin fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 Back     alignment and structure
>1ttz_A Conserved hypothetical protein; structural genomics, unknown function, PSI, protein structure initiative; 2.11A {Xanthomonas campestris} SCOP: c.47.1.1 PDB: 1xpv_A Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3gl3_A Putative thiol:disulfide interchange protein DSBE; oxidoreductase, PSI-II, structural genomics, protein structure initiative; 2.09A {Chlorobium tepidum tls} Back     alignment and structure
>2ywi_A Hypothetical conserved protein; uncharacterized conserved protein, NPPSFA, national project protein structural and functional analyses; 1.60A {Geobacillus kaustophilus} Back     alignment and structure
>3kcm_A Thioredoxin family protein; SGX, thioredoxin protein, PSI, structural genomics, protein initiative; 2.45A {Geobacter metallireducens gs-15} Back     alignment and structure
>2k8s_A Thioredoxin; dimer, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Nitrosomonas europaea} Back     alignment and structure
>3kh7_A Thiol:disulfide interchange protein DSBE; TRX-like, thiol-disulfide exchange, cell inner membrane, CYT C-type biogenesis, disulfide bond; 1.75A {Pseudomonas aeruginosa} PDB: 3kh9_A Back     alignment and structure
>2av4_A Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECIFIC 15KD prote structural genomics, structural genomics consortium, SGC, U function; 1.73A {Plasmodium yoelii} Back     alignment and structure
>2klx_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Bartonella henselae} Back     alignment and structure
>1kte_A Thioltransferase; redox-active center, electron transport, acetylation; 2.20A {Sus scrofa} SCOP: c.47.1.1 PDB: 1jhb_A 1b4q_A* Back     alignment and structure
>2ht9_A Glutaredoxin-2; thioredoxin fold, iron-sulfur cluster, 2Fe2S, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: GSH; 1.90A {Homo sapiens} PDB: 2fls_A* Back     alignment and structure
>2dbc_A PDCL2, unnamed protein product; phosducin-like protein, thioredoxin_FOLD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2djj_A PDI, protein disulfide-isomerase; thioredoxin fold; NMR {Humicola insolens} SCOP: c.47.1.2 PDB: 2kp1_A Back     alignment and structure
>3c1r_A Glutaredoxin-1; oxidized form, oxidoreductase, cytoplasm, electron transport, redox-active center, transport; HET: MES; 2.00A {Saccharomyces cerevisiae} PDB: 3c1s_A* 2jac_A* Back     alignment and structure
>2hze_A Glutaredoxin-1; thioredoxin fold, arsenic, dimethylarsenite., electron trans oxidoreductase; 1.80A {Ectromelia virus} PDB: 2hzf_A 2hze_B Back     alignment and structure
>2dlx_A UBX domain-containing protein 7; UAS domain, protein KIAA0794, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: c.47.1.24 Back     alignment and structure
>2r2j_A Thioredoxin domain-containing protein 4; CRFS motif, chaperone, endoplasmic reticulum, S response; 2.60A {Homo sapiens} Back     alignment and structure
>3eur_A Uncharacterized protein; PSI2,MCSG, conserved protein, structural genomics, protein S initiative, midwest center for structural genomics; HET: MSE; 1.30A {Bacteroides fragilis} Back     alignment and structure
>2djk_A PDI, protein disulfide-isomerase; thioredoxin fold; NMR {Humicola insolens} SCOP: c.47.1.2 PDB: 2kp2_A Back     alignment and structure
>2ggt_A SCO1 protein homolog, mitochondrial; copper chaperone, Cu-binding protein, mitochondrial assembly factor, redox, nickel, disuplhide, mitochondrion; 2.40A {Homo sapiens} SCOP: c.47.1.10 PDB: 2gqk_A 2gql_A 2gqm_A 2gt5_A 2gt6_A 2gvp_A 2hrf_A 2hrn_A 1wp0_A Back     alignment and structure
>3f8u_A Protein disulfide-isomerase A3ERP57; endoplasmic reticulum, glycoprotein, immunoglobulin domain, microsome, protein disulfide isomerase, thioredoxin-like FO like domain; HET: NAG; 2.60A {Homo sapiens} PDB: 2dmm_A 2alb_A Back     alignment and structure
>2cvb_A Probable thiol-disulfide isomerase/thioredoxin; redox protein, structural genomics, riken struc genomics/proteomics initiative, RSGI; 1.80A {Thermus thermophilus} SCOP: c.47.1.10 PDB: 2ywo_A Back     alignment and structure
>2yan_A Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {Homo sapiens} Back     alignment and structure
>3qmx_A Glutaredoxin A, glutaredoxin 3; electron transport; 1.82A {Synechocystis SP} SCOP: c.47.1.0 Back     alignment and structure
>3nzn_A Glutaredoxin; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics, rossmann fold; 1.10A {Methanosarcina mazei} Back     alignment and structure
>3u5r_E Uncharacterized protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, hypothetical protein; 2.05A {Sinorhizobium meliloti} Back     alignment and structure
>1a8l_A Protein disulfide oxidoreductase; PDI, thioredoxin fold; 1.90A {Pyrococcus furiosus} SCOP: c.47.1.2 c.47.1.2 PDB: 1j08_A Back     alignment and structure
>2f51_A Thioredoxin; electron transport; 1.90A {Trichomonas vaginalis} Back     alignment and structure
>3evi_A Phosducin-like protein 2; alpha beta, 3-layer(ABA) sandwich, unknown function; 2.70A {Homo sapiens} Back     alignment and structure
>3cmi_A Peroxiredoxin HYR1; thioredoxin-like fold, oxidoreductase, peroxidase, redox-ACT center; 2.02A {Saccharomyces cerevisiae} Back     alignment and structure
>2cq9_A GLRX2 protein, glutaredoxin 2; glutathione-S-transferase, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wou_A Thioredoxin -related protein, 14 kDa; electron transport; 1.80A {Homo sapiens} SCOP: c.47.1.16 PDB: 1v9w_A Back     alignment and structure
>3rhb_A ATGRXC5, glutaredoxin-C5, chloroplastic; thioredoxin fold, thiol-disulfide oxidoreductase, glutaredox oxidoreductase; HET: GSH; 1.20A {Arabidopsis thaliana} PDB: 3rhc_A* 3fz9_A* 3fza_A* Back     alignment and structure
>2khp_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Brucella melitensis} Back     alignment and structure
>2lrt_A Uncharacterized protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, nysgrc, PSI-biology; NMR {Bacteroides vulgatus} Back     alignment and structure
>3us3_A Calsequestrin-1; calcium-binding protein; 1.74A {Oryctolagus cuniculus} PDB: 1a8y_A 3v1w_A* 3trq_A* 3trp_A* 3uom_A Back     alignment and structure
>2hyx_A Protein DIPZ; thioredoxin fold, jelly-roll, structural genomics, TB struct genomics consortium, TBSGC, unknown function; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>2axo_A Hypothetical protein ATU2684; alpha beta protein., structural genomics, PSI, protein struc initiative; 1.80A {Agrobacterium tumefaciens str} SCOP: c.47.1.19 Back     alignment and structure
>4fo5_A Thioredoxin-like protein; AHPC/TSA family protein, structural genomics, joint center F structural genomics, JCSG; 2.02A {Parabacteroides distasonis} Back     alignment and structure
>2vup_A Glutathione peroxidase-like protein; oxidoreductase, trypanothione, dithiol-dependant peroxidase; 2.10A {Trypanosoma brucei} Back     alignment and structure
>2rli_A SCO2 protein homolog, mitochondrial; copper protein, thioredoxin fold, metal transport, structural genomics, spine2-complexes; NMR {Homo sapiens} Back     alignment and structure
>3lwa_A Secreted thiol-disulfide isomerase; thioredoxin, PSI, MCSG, structural genomics, midwest center for structural genomics; 1.75A {Corynebacterium glutamicum} Back     alignment and structure
>2b5e_A Protein disulfide-isomerase; 2.40A {Saccharomyces cerevisiae} SCOP: c.47.1.2 c.47.1.2 c.47.1.2 c.47.1.2 PDB: 3boa_A Back     alignment and structure
>2ywm_A Glutaredoxin-like protein; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 2.30A {Aquifex aeolicus} PDB: 2ayt_A Back     alignment and structure
>2lqo_A Putative glutaredoxin RV3198.1/MT3292; TRX fold, oxidoreductase; NMR {Mycobacterium tuberculosis} Back     alignment and structure
>3ctg_A Glutaredoxin-2; reduced form, electron transport, mitochondrion, redox-activ transit peptide, transport, oxidoreductase; 1.50A {Saccharomyces cerevisiae} PDB: 3ctf_A 3d4m_A 3d5j_A* Back     alignment and structure
>3q6o_A Sulfhydryl oxidase 1; protein disulfide isomerase, thioredoxin, thioredoxin fold, oxidoreductase, reductive methylation; HET: MLY; 2.05A {Homo sapiens} Back     alignment and structure
>3h8q_A Thioredoxin reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC, developmental protein, differentiation; 2.21A {Homo sapiens} SCOP: c.47.1.0 Back     alignment and structure
>1sji_A Calsequestrin 2, calsequestrin, cardiac muscle isoform; glycoprotein, calcium-binding, muscle protein, metal binding protein; 2.40A {Canis lupus familiaris} PDB: 2vaf_A Back     alignment and structure
>2fgx_A Putative thioredoxin; NET3, NESG, GFT-glutaredoxin-like, structural genomics, PSI, protein structure initiative; NMR {Nitrosomonas europaea} Back     alignment and structure
>2trc_P Phosducin, MEKA, PP33; transducin, beta-gamma, signal transduction, regulation, phosphorylation, G proteins, thioredoxin, vision; 2.40A {Rattus norvegicus} SCOP: c.47.1.6 Back     alignment and structure
>3ed3_A Protein disulfide-isomerase MPD1; thioredoxin-like domain, CXXC, endoplasmic reticulum, glycoprotein, redox-active center; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>2v1m_A Glutathione peroxidase; selenium, selenocysteine, oxidoreductase, lipid peroxidase, schistosoma detoxification pathway; 1.00A {Schistosoma mansoni} PDB: 2wgr_A Back     alignment and structure
>1sen_A Thioredoxin-like protein P19; endoplasmic reticulum, RP19, structural genomics, PSI, protein structure initiative; 1.20A {Homo sapiens} SCOP: c.47.1.1 PDB: 2k8v_A Back     alignment and structure
>2qc7_A ERP31, ERP28, endoplasmic reticulum protein ERP29; B domain (residues 33-153), D domain (residues 154-261), CHA; 2.90A {Homo sapiens} PDB: 1g7e_A 1g7d_A Back     alignment and structure
>3ira_A Conserved protein; methanosarcina mazei,structural genomics, MCSG, protein structure initiative, midwest center for STRU genomics; 2.10A {Methanosarcina mazei} Back     alignment and structure
>1t1v_A SH3BGRL3, SH3 domain-binding glutamic acid-rich protein-LIK; glutaredoxin, thioredoxin fold, protein 3D-structure, X-RAY crystallography; 1.60A {Mus musculus} SCOP: c.47.1.14 PDB: 1j0f_A 1sj6_A Back     alignment and structure
>1wik_A Thioredoxin-like protein 2; picot homology 2 domain, picot protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 Back     alignment and structure
>1we0_A Alkyl hydroperoxide reductase C; peroxiredoxin, AHPC, oxidoreductase; 2.90A {Amphibacillus xylanus} SCOP: c.47.1.10 Back     alignment and structure
>3tdg_A DSBG, putative uncharacterized protein; thioredoxin fold, reductase, oxidoreductase; HET: P6G; 2.10A {Helicobacter pylori} Back     alignment and structure
>3t58_A Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2.40A {Mus musculus} PDB: 3t59_A* Back     alignment and structure
>3ipz_A Monothiol glutaredoxin-S14, chloroplastic; electron transport, PL redox-active center, transit peptide, transport, oxidoreduc; 2.40A {Arabidopsis thaliana} PDB: 2lku_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 160
d1beda_181 c.47.1.13 (A:) Disulfide-bond formation facilitato 4e-06
d1z6ma1172 c.47.1.13 (A:1-172) Hypothetical protein EF0770 {E 3e-04
>d1beda_ c.47.1.13 (A:) Disulfide-bond formation facilitator (DsbA) {Vibrio cholerae [TaxId: 666]} Length = 181 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Thioredoxin fold
superfamily: Thioredoxin-like
family: DsbA-like
domain: Disulfide-bond formation facilitator (DsbA)
species: Vibrio cholerae [TaxId: 666]
 Score = 42.3 bits (98), Expect = 4e-06
 Identities = 9/38 (23%), Positives = 16/38 (42%)

Query: 111 GVYATPTFFVNGFSLAGAGSPLDYNGWRKVIDPLLSEK 148
           G+   P   VN   L    S    + +  +++ LL+ K
Sbjct: 144 GLTGVPAVVVNNRYLVQGQSVKSLDEYFDLVNYLLTLK 181


>d1z6ma1 c.47.1.13 (A:1-172) Hypothetical protein EF0770 {Enterococcus faecalis [TaxId: 1351]} Length = 172 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query160
d1beda_181 Disulfide-bond formation facilitator (DsbA) {Vibri 99.41
d1fvka_188 Disulfide-bond formation facilitator (DsbA) {Esche 99.21
d1un2a_195 Disulfide-bond formation facilitator (DsbA) {Esche 99.12
d1z6ma1172 Hypothetical protein EF0770 {Enterococcus faecalis 99.03
d1eeja1156 Disulfide bond isomerase, DsbC, C-terminal domain 98.84
d1t3ba1150 Disulfide bond isomerase, DsbC, C-terminal domain 98.75
d1r4wa_221 Mitochondrial class kappa glutathione S-transferas 98.46
d1v58a1169 Thiol:disulfide interchange protein DsbG, C-termin 98.25
d1nhoa_85 MTH807, thioredoxin/glutaredoxin-like protein {Arc 97.05
d2trxa_108 Thioredoxin {Escherichia coli [TaxId: 562]} 97.03
d1hyua496 Alkyl hydroperoxide reductase subunit F (AhpF), N- 96.99
d1fo5a_85 MJ0307, thioredoxin/glutaredoxin-like protein {Arc 96.97
d1a8la2107 Protein disulfide isomerase, PDI {Archaeon Pyrococ 96.93
d2hfda1132 Hydrogenase-1 operon protein HyaE {Escherichia col 96.9
d1fb6a_104 Thioredoxin {Spinach (Spinacia oleracea), thioredo 96.89
d1thxa_108 Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} 96.74
d2es7a1119 Hydrogenase-1 operon protein HyaE {Salmonella typh 96.73
d1nw2a_105 Thioredoxin {Alicyclobacillus acidocaldarius, form 96.66
d1dbya_107 Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305 96.45
d2ifqa1105 Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} 96.42
d1xfla_114 Thioredoxin {Thale cress (Arabidopsis thaliana) [T 96.39
d1ep7a_112 Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305 96.25
d1zmaa1115 Bacterocin transport accessory protein Bta {Strept 96.1
d1knga_144 Thioredoxin-like protein CcmG (CycY, DsbE) {Bradyr 95.81
d1f9ma_112 Thioredoxin {Spinach (Spinacia oleracea), thioredo 95.74
d1gh2a_107 Thioredoxin-like protein, N-terminal domain {Human 95.68
d1syra_103 Thioredoxin {Malarial parasite (Plasmodium falcipa 95.57
d1ti3a_113 Thioredoxin {European aspen (Populus tremula), thi 95.34
d1r26a_113 Thioredoxin {Trypanosoma brucei [TaxId: 5691]} 95.28
d2fwha1117 Thiol:disulfide interchange protein DsbD, C-termin 95.27
d1xwaa_111 Thioredoxin {Fruit fly (Drosophila melanogaster) [ 95.02
d1z5ye1136 Thioredoxin-like protein CcmG (CycY, DsbE) {Escher 94.96
d1iloa_77 MTH985, a thioredoxin {Archaeon Methanobacterium t 94.88
d1a8ya1124 Calsequestrin {Rabbit (Oryctolagus cuniculus) [Tax 94.69
d2b5xa1143 thiol:disulfide oxidoreductase YkuV {Bacillus subt 93.86
d1zzoa1134 Lipoprotein DsbF {Mycobacterium tuberculosis [TaxI 93.66
d1lu4a_134 Soluble secreted antigen MPT53 {Mycobacterium tube 93.47
d2b5ea4119 Protein disulfide isomerase, PDI {Baker's yeast (S 93.36
d2fy6a1143 Peptide methionine sulfoxide reductase MsrA/MsrB, 93.34
d1meka_120 Protein disulfide isomerase, PDI {Human (Homo sapi 92.42
d1qgva_137 spliceosomal protein U5-15Kd {Human (Homo sapiens) 92.3
d1egoa_85 Glutaredoxin (Grx, thioltransferase) {Escherichia 92.06
d1st9a_137 Thiol-disulfide oxidoreductase ResA {Bacillus subt 91.7
d1r7ha_74 Glutaredoxin-like NRDH-redoxin {Corynebacterium am 91.55
d2cvba1187 Probable thiol-disulfide isomerase/thioredoxin TTH 91.05
d1wjka_100 Thioredoxin-like structure containing protein C330 91.01
d2djja1116 Protein disulfide isomerase, PDI {Fungi (Humicola 90.63
d2b5ea1140 Protein disulfide isomerase, PDI {Baker's yeast (S 89.53
d2axoa1 225 Hypothetical protein Atu2684 {Agrobacterium tumefa 88.71
d2dlxa1147 UBX domain-containing protein 7 {Human (Homo sapie 87.72
d1woua_119 Putative 42-9-9 protein (thioredoxin containing pr 87.34
d1fova_82 Glutaredoxin (Grx, thioltransferase) {Escherichia 86.17
d2c0ga2122 Windbeutel, N-terminal domain {Fruit fly (Drosophi 85.14
d1jfua_176 Membrane-anchored thioredoxin-like protein TlpA, s 82.43
d1h75a_76 Glutaredoxin-like NRDH-redoxin {Escherichia coli [ 81.72
>d1beda_ c.47.1.13 (A:) Disulfide-bond formation facilitator (DsbA) {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Thioredoxin fold
superfamily: Thioredoxin-like
family: DsbA-like
domain: Disulfide-bond formation facilitator (DsbA)
species: Vibrio cholerae [TaxId: 666]
Probab=99.41  E-value=8.6e-13  Score=97.02  Aligned_cols=77  Identities=18%  Similarity=0.235  Sum_probs=66.5

Q ss_pred             HHHHHHHhhcCCChhHHHHcccCChhHHHHHHHHHHHhhcCCccccceEEECCEEecCCCCCCCHHHHHHHHHHHhhhc
Q 031378           70 EIVKFAAEGIGNSYSSALESGFSDRSTDLLTRVSFKFSATRGVYATPTFFVNGFSLAGAGSPLDYNGWRKVIDPLLSEK  148 (160)
Q Consensus        70 ~la~~A~~~~Gld~~~~f~~~l~~~~~~~~i~~~~k~a~~~GV~GTPTffING~~~~ga~s~~~~e~~~~~Id~~l~~~  148 (160)
                      .+...+.+ .|+| .++|.+|++++++.+.++.+.+.+++.||+|||||+|||+.+.+..+..++++|.++|+.++..|
T Consensus       105 ~l~~~~~~-~gvd-~~~~~~~~~~~~~~~~v~~~~~~~~~~gi~gTPt~~InGk~~v~~~~~~~~~~l~~~i~~L~~~~  181 (181)
T d1beda_         105 ELRQIFLD-EGID-AAKFDAAYNGFAVDSMVRRFDKQFQDSGLTGVPAVVVNNRYLVQGQSVKSLDEYFDLVNYLLTLK  181 (181)
T ss_dssp             HHHHHHHT-TTCC-HHHHHHHHTSHHHHHHHHHHHHHHHHHTCCSSSEEEETTTEEECGGGCCSHHHHHHHHHHHHHCC
T ss_pred             HHHHHHHH-hcCC-HHHHHHHHhChHHHHHHHHHHHHHHHhCCccccEEEECCEEeeCCCCCCCHHHHHHHHHHHHhCc
Confidence            35555555 5999 59999999999999999999999999999999999999997656556677999999999988754



>d1fvka_ c.47.1.13 (A:) Disulfide-bond formation facilitator (DsbA) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1un2a_ c.47.1.13 (A:) Disulfide-bond formation facilitator (DsbA) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z6ma1 c.47.1.13 (A:1-172) Hypothetical protein EF0770 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1eeja1 c.47.1.9 (A:61-216) Disulfide bond isomerase, DsbC, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t3ba1 c.47.1.9 (A:61-210) Disulfide bond isomerase, DsbC, C-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1r4wa_ c.47.1.13 (A:) Mitochondrial class kappa glutathione S-transferase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1v58a1 c.47.1.9 (A:62-230) Thiol:disulfide interchange protein DsbG, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nhoa_ c.47.1.1 (A:) MTH807, thioredoxin/glutaredoxin-like protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2trxa_ c.47.1.1 (A:) Thioredoxin {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hyua4 c.47.1.2 (A:103-198) Alkyl hydroperoxide reductase subunit F (AhpF), N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1fo5a_ c.47.1.1 (A:) MJ0307, thioredoxin/glutaredoxin-like protein {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1a8la2 c.47.1.2 (A:120-226) Protein disulfide isomerase, PDI {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2hfda1 c.47.1.20 (A:1-132) Hydrogenase-1 operon protein HyaE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fb6a_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin M [TaxId: 3562]} Back     information, alignment and structure
>d1thxa_ c.47.1.1 (A:) Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} Back     information, alignment and structure
>d2es7a1 c.47.1.20 (A:7-125) Hydrogenase-1 operon protein HyaE {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1nw2a_ c.47.1.1 (A:) Thioredoxin {Alicyclobacillus acidocaldarius, formerly Bacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d1dbya_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} Back     information, alignment and structure
>d2ifqa1 c.47.1.1 (A:1-105) Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xfla_ c.47.1.1 (A:) Thioredoxin {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ep7a_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} Back     information, alignment and structure
>d1zmaa1 c.47.1.1 (A:1-115) Bacterocin transport accessory protein Bta {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1knga_ c.47.1.10 (A:) Thioredoxin-like protein CcmG (CycY, DsbE) {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d1f9ma_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin F [TaxId: 3562]} Back     information, alignment and structure
>d1gh2a_ c.47.1.1 (A:) Thioredoxin-like protein, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1syra_ c.47.1.1 (A:) Thioredoxin {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1ti3a_ c.47.1.1 (A:) Thioredoxin {European aspen (Populus tremula), thioredoxin H [TaxId: 113636]} Back     information, alignment and structure
>d1r26a_ c.47.1.1 (A:) Thioredoxin {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2fwha1 c.47.1.1 (A:428-544) Thiol:disulfide interchange protein DsbD, C-terminal domain (DsbD-gamma) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xwaa_ c.47.1.1 (A:) Thioredoxin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1z5ye1 c.47.1.10 (E:49-184) Thioredoxin-like protein CcmG (CycY, DsbE) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iloa_ c.47.1.1 (A:) MTH985, a thioredoxin {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1a8ya1 c.47.1.3 (A:3-126) Calsequestrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2b5xa1 c.47.1.10 (A:1-143) thiol:disulfide oxidoreductase YkuV {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1zzoa1 c.47.1.10 (A:45-178) Lipoprotein DsbF {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1lu4a_ c.47.1.10 (A:) Soluble secreted antigen MPT53 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2b5ea4 c.47.1.2 (A:23-141) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fy6a1 c.47.1.10 (A:33-175) Peptide methionine sulfoxide reductase MsrA/MsrB, N-terminal domain {Neisseria meningitidis serogroup A [TaxId: 65699]} Back     information, alignment and structure
>d1meka_ c.47.1.2 (A:) Protein disulfide isomerase, PDI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qgva_ c.47.1.8 (A:) spliceosomal protein U5-15Kd {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1egoa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1st9a_ c.47.1.10 (A:) Thiol-disulfide oxidoreductase ResA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1r7ha_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Corynebacterium ammoniagenes [TaxId: 1697]} Back     information, alignment and structure
>d2cvba1 c.47.1.10 (A:2-188) Probable thiol-disulfide isomerase/thioredoxin TTHA0593 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wjka_ c.47.1.1 (A:) Thioredoxin-like structure containing protein C330018D20Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2djja1 c.47.1.2 (A:6-121) Protein disulfide isomerase, PDI {Fungi (Humicola insolens) [TaxId: 34413]} Back     information, alignment and structure
>d2b5ea1 c.47.1.2 (A:365-504) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2axoa1 c.47.1.19 (A:38-262) Hypothetical protein Atu2684 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2dlxa1 c.47.1.24 (A:1-147) UBX domain-containing protein 7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1woua_ c.47.1.16 (A:) Putative 42-9-9 protein (thioredoxin containing protein Txnl5) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fova_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli, Grx3 [TaxId: 562]} Back     information, alignment and structure
>d2c0ga2 c.47.1.7 (A:1024-1145) Windbeutel, N-terminal domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1jfua_ c.47.1.10 (A:) Membrane-anchored thioredoxin-like protein TlpA, soluble domain {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d1h75a_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Escherichia coli [TaxId: 562]} Back     information, alignment and structure