Citrus Sinensis ID: 031378
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 160 | ||||||
| 224085938 | 212 | predicted protein [Populus trichocarpa] | 0.725 | 0.547 | 0.609 | 2e-34 | |
| 255539052 | 362 | conserved hypothetical protein [Ricinus | 0.65 | 0.287 | 0.657 | 2e-34 | |
| 224061957 | 223 | predicted protein [Populus trichocarpa] | 0.706 | 0.506 | 0.591 | 2e-30 | |
| 8778978 | 538 | Contains similarity to pigpen protein fr | 0.593 | 0.176 | 0.621 | 2e-28 | |
| 22329686 | 233 | TRX domain-containing protein [Arabidops | 0.706 | 0.484 | 0.55 | 5e-28 | |
| 359492074 | 234 | PREDICTED: uncharacterized protein LOC10 | 0.768 | 0.525 | 0.515 | 7e-28 | |
| 297850426 | 529 | hypothetical protein ARALYDRAFT_312946 [ | 0.656 | 0.198 | 0.575 | 9e-28 | |
| 81076617 | 224 | unknown [Solanum tuberosum] | 0.781 | 0.558 | 0.492 | 3e-27 | |
| 351726088 | 236 | uncharacterized protein LOC100500267 pre | 0.687 | 0.466 | 0.513 | 4e-27 | |
| 449450508 | 236 | PREDICTED: uncharacterized protein LOC10 | 0.681 | 0.461 | 0.549 | 5e-27 |
| >gi|224085938|ref|XP_002307747.1| predicted protein [Populus trichocarpa] gi|222857196|gb|EEE94743.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 150 bits (379), Expect = 2e-34, Method: Compositional matrix adjust.
Identities = 75/123 (60%), Positives = 90/123 (73%), Gaps = 7/123 (5%)
Query: 36 LYIKRRLNC-----LLE--IVQQEKFYNAPTQNMTRTAVVKEIVKFAAEGIGNSYSSALE 88
L+I LN LLE QEKFYNA T N+++T++V+EIVKFA +GNSYSSA E
Sbjct: 82 LHIANTLNSSFTFPLLEEFFKHQEKFYNAKTSNLSKTSIVEEIVKFATVAVGNSYSSAFE 141
Query: 89 SGFSDRSTDLLTRVSFKFSATRGVYATPTFFVNGFSLAGAGSPLDYNGWRKVIDPLLSEK 148
SGF+DR TDL TRVSFK+S +RGV+ TP FFVNGF L AGSPLDYNGWR +IDPL+ K
Sbjct: 142 SGFNDRQTDLKTRVSFKYSTSRGVFGTPFFFVNGFVLPDAGSPLDYNGWRSIIDPLVGAK 201
Query: 149 GKK 151
+
Sbjct: 202 SSQ 204
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255539052|ref|XP_002510591.1| conserved hypothetical protein [Ricinus communis] gi|223551292|gb|EEF52778.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|224061957|ref|XP_002300683.1| predicted protein [Populus trichocarpa] gi|222842409|gb|EEE79956.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|8778978|gb|AAF79893.1|AC022472_2 Contains similarity to pigpen protein from Mus musculus gb|AF224264 and contains protein of unknown function DUF78 PF|01918 domain. ESTs gb|N38077, gb|BE037702, gb|AV442191, gb|AV441368, gb|Z17998, gb|AV527266, gb|AV520794, gb|AI997847, gb|AV543000 come from this gene [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|22329686|ref|NP_683315.1| TRX domain-containing protein [Arabidopsis thaliana] gi|17065544|gb|AAL32926.1| Unknown protein [Arabidopsis thaliana] gi|24899723|gb|AAN65076.1| Unknown protein [Arabidopsis thaliana] gi|332191831|gb|AEE29952.1| TRX domain-containing protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|359492074|ref|XP_003634361.1| PREDICTED: uncharacterized protein LOC100854733 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297850426|ref|XP_002893094.1| hypothetical protein ARALYDRAFT_312946 [Arabidopsis lyrata subsp. lyrata] gi|297338936|gb|EFH69353.1| hypothetical protein ARALYDRAFT_312946 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|81076617|gb|ABB55396.1| unknown [Solanum tuberosum] | Back alignment and taxonomy information |
|---|
| >gi|351726088|ref|NP_001235579.1| uncharacterized protein LOC100500267 precursor [Glycine max] gi|255629877|gb|ACU15289.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449450508|ref|XP_004143004.1| PREDICTED: uncharacterized protein LOC101216804 isoform 1 [Cucumis sativus] gi|449450510|ref|XP_004143005.1| PREDICTED: uncharacterized protein LOC101216804 isoform 2 [Cucumis sativus] gi|449521601|ref|XP_004167818.1| PREDICTED: uncharacterized protein LOC101231840 isoform 1 [Cucumis sativus] gi|449521603|ref|XP_004167819.1| PREDICTED: uncharacterized protein LOC101231840 isoform 2 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 160 | ||||||
| TAIR|locus:504956159 | 233 | AT1G20225 "AT1G20225" [Arabido | 0.631 | 0.433 | 0.601 | 8.2e-28 | |
| TAIR|locus:2204415 | 225 | AT1G76020 "AT1G76020" [Arabido | 0.593 | 0.422 | 0.589 | 3.5e-27 |
| TAIR|locus:504956159 AT1G20225 "AT1G20225" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 311 (114.5 bits), Expect = 8.2e-28, P = 8.2e-28
Identities = 62/103 (60%), Positives = 76/103 (73%)
Query: 45 LLEIV--QQEKFYNAPTQNMTRTAVVKEIVKFAAEGIGNSYSSALESGFSDRSTDLLTRV 102
LLE + Q FYN+ TQ M+R AVV+E++K +GNSY S L+SGFS+ +DL TRV
Sbjct: 111 LLEGIFKHQTLFYNSQTQLMSRPAVVEELIKLGTVTLGNSYHSPLKSGFSNSKSDLATRV 170
Query: 103 SFKFSATRGVYATPTFFVNGFSLAGAGSPLDYNGWRKVIDPLL 145
SFK+S +RGV ATPTF+VNGF L GAGSP DY GWR IDPL+
Sbjct: 171 SFKYSVSRGVSATPTFYVNGFELPGAGSPKDYEGWRDTIDPLV 213
|
|
| TAIR|locus:2204415 AT1G76020 "AT1G76020" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| estExt_Genewise1_v1.C_LG_V1891 | hypothetical protein (212 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 160 | |||
| COG2761 | 225 | FrnE Predicted dithiol-disulfide isomerase involve | 99.4 | |
| cd03024 | 201 | DsbA_FrnE DsbA family, FrnE subfamily; FrnE is a D | 99.37 | |
| cd03022 | 192 | DsbA_HCCA_Iso DsbA family, 2-hydroxychromene-2-car | 99.3 | |
| COG3531 | 212 | Predicted protein-disulfide isomerase [Posttransla | 99.29 | |
| cd03023 | 154 | DsbA_Com1_like DsbA family, Com1-like subfamily; c | 99.28 | |
| PF01323 | 193 | DSBA: DSBA-like thioredoxin domain; InterPro: IPR0 | 99.26 | |
| PRK10954 | 207 | periplasmic protein disulfide isomerase I; Provisi | 99.22 | |
| cd03019 | 178 | DsbA_DsbA DsbA family, DsbA subfamily; DsbA is a m | 99.17 | |
| PF13743 | 176 | Thioredoxin_5: Thioredoxin; PDB: 3KZQ_C. | 99.17 | |
| PF13462 | 162 | Thioredoxin_4: Thioredoxin; PDB: 3FEU_A 3HZ8_A 3DV | 99.11 | |
| cd03025 | 193 | DsbA_FrnE_like DsbA family, FrnE-like subfamily; c | 99.05 | |
| COG1651 | 244 | DsbG Protein-disulfide isomerase [Posttranslationa | 98.83 | |
| COG3917 | 203 | NahD 2-hydroxychromene-2-carboxylate isomerase [Se | 98.31 | |
| cd03021 | 209 | DsbA_GSTK DsbA family, Glutathione (GSH) S-transfe | 98.23 | |
| PRK10877 | 232 | protein disulfide isomerase II DsbC; Provisional | 97.98 | |
| PRK11657 | 251 | dsbG disulfide isomerase/thiol-disulfide oxidase; | 97.63 | |
| cd03020 | 197 | DsbA_DsbC_DsbG DsbA family, DsbC and DsbG subfamil | 97.33 | |
| TIGR00411 | 82 | redox_disulf_1 small redox-active disulfide protei | 97.18 | |
| PF13098 | 112 | Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_ | 96.89 | |
| cd02972 | 98 | DsbA_family DsbA family; consists of DsbA and DsbA | 96.58 | |
| PF13192 | 76 | Thioredoxin_3: Thioredoxin domain; PDB: 1ZYP_B 1ZY | 96.37 | |
| PRK11509 | 132 | hydrogenase-1 operon protein HyaE; Provisional | 96.29 | |
| cd03065 | 120 | PDI_b_Calsequestrin_N PDIb family, Calsequestrin s | 96.26 | |
| cd02963 | 111 | TRX_DnaJ TRX domain, DnaJ domain containing protei | 95.92 | |
| cd02951 | 125 | SoxW SoxW family; SoxW is a bacterial periplasmic | 95.85 | |
| PRK10996 | 139 | thioredoxin 2; Provisional | 95.71 | |
| PF00085 | 103 | Thioredoxin: Thioredoxin; InterPro: IPR013766 Thio | 95.55 | |
| TIGR00412 | 76 | redox_disulf_2 small redox-active disulfide protei | 95.51 | |
| PRK09381 | 109 | trxA thioredoxin; Provisional | 95.45 | |
| cd02956 | 96 | ybbN ybbN protein family; ybbN is a hypothetical p | 95.4 | |
| TIGR02196 | 74 | GlrX_YruB Glutaredoxin-like protein, YruB-family. | 95.27 | |
| cd02950 | 142 | TxlA TRX-like protein A (TxlA) family; TxlA was or | 95.17 | |
| cd02948 | 102 | TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fus | 95.05 | |
| PRK15412 | 185 | thiol:disulfide interchange protein DsbE; Provisio | 94.8 | |
| PRK11200 | 85 | grxA glutaredoxin 1; Provisional | 94.77 | |
| cd02947 | 93 | TRX_family TRX family; composed of two groups: Gro | 94.52 | |
| TIGR01068 | 101 | thioredoxin thioredoxin. Several proteins, such as | 94.48 | |
| cd02949 | 97 | TRX_NTR TRX domain, novel NADPH thioredoxin reduct | 94.28 | |
| TIGR00385 | 173 | dsbE periplasmic protein thiol:disulfide oxidoredu | 94.23 | |
| cd03026 | 89 | AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxid | 94.01 | |
| COG2143 | 182 | Thioredoxin-related protein [Posttranslational mod | 94.01 | |
| cd02973 | 67 | TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)- | 94.0 | |
| KOG0910 | 150 | consensus Thioredoxin-like protein [Posttranslatio | 93.94 | |
| PTZ00443 | 224 | Thioredoxin domain-containing protein; Provisional | 93.81 | |
| TIGR01126 | 102 | pdi_dom protein disulfide-isomerase domain. This m | 93.79 | |
| TIGR01295 | 122 | PedC_BrcD bacteriocin transport accessory protein, | 93.68 | |
| cd02997 | 104 | PDI_a_PDIR PDIa family, PDIR subfamily; composed o | 93.5 | |
| PHA02278 | 103 | thioredoxin-like protein | 93.29 | |
| cd02994 | 101 | PDI_a_TMX PDIa family, TMX subfamily; composed of | 93.19 | |
| cd02984 | 97 | TRX_PICOT TRX domain, PICOT (for PKC-interacting c | 93.17 | |
| cd02975 | 113 | PfPDO_like_N Pyrococcus furiosus protein disulfide | 92.9 | |
| cd02961 | 101 | PDI_a_family Protein Disulfide Isomerase (PDIa) fa | 92.6 | |
| cd03003 | 101 | PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfam | 92.59 | |
| cd02985 | 103 | TRX_CDSP32 TRX family, chloroplastic drought-induc | 92.55 | |
| cd03005 | 102 | PDI_a_ERp46 PDIa family, endoplasmic reticulum pro | 92.3 | |
| cd03002 | 109 | PDI_a_MPD1_like PDI family, MPD1-like subfamily; c | 92.25 | |
| cd02996 | 108 | PDI_a_ERp44 PDIa family, endoplasmic reticulum pro | 92.22 | |
| cd02965 | 111 | HyaE HyaE family; HyaE is also called HupG and Hox | 92.14 | |
| TIGR02187 | 215 | GlrX_arch Glutaredoxin-like domain protein. This f | 91.84 | |
| cd03000 | 104 | PDI_a_TMX3 PDIa family, TMX3 subfamily; composed o | 91.67 | |
| cd02953 | 104 | DsbDgamma DsbD gamma family; DsbD gamma is the C-t | 91.59 | |
| cd02958 | 114 | UAS UAS family; UAS is a domain of unknown functio | 91.38 | |
| cd02998 | 105 | PDI_a_ERp38 PDIa family, endoplasmic reticulum pro | 91.21 | |
| cd03004 | 104 | PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfam | 91.14 | |
| cd03001 | 103 | PDI_a_P5 PDIa family, P5 subfamily; composed of eu | 90.89 | |
| TIGR02180 | 84 | GRX_euk Glutaredoxin. This model represents eukary | 90.54 | |
| cd03029 | 72 | GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hyb | 90.48 | |
| cd02999 | 100 | PDI_a_ERp44_like PDIa family, endoplasmic reticulu | 90.29 | |
| PHA02125 | 75 | thioredoxin-like protein | 90.18 | |
| TIGR02187 | 215 | GlrX_arch Glutaredoxin-like domain protein. This f | 89.93 | |
| TIGR02183 | 86 | GRXA Glutaredoxin, GrxA family. This model include | 89.73 | |
| cd03007 | 116 | PDI_a_ERp29_N PDIa family, endoplasmic reticulum p | 89.01 | |
| KOG0908 | 288 | consensus Thioredoxin-like protein [Posttranslatio | 88.85 | |
| PF06764 | 202 | DUF1223: Protein of unknown function (DUF1223); In | 88.52 | |
| TIGR02181 | 79 | GRX_bact Glutaredoxin, GrxC family. This family of | 88.52 | |
| COG3118 | 304 | Thioredoxin domain-containing protein [Posttransla | 88.36 | |
| cd02982 | 103 | PDI_b'_family Protein Disulfide Isomerase (PDIb') | 88.35 | |
| PTZ00051 | 98 | thioredoxin; Provisional | 87.83 | |
| PF00462 | 60 | Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Gl | 87.83 | |
| KOG0907 | 106 | consensus Thioredoxin [Posttranslational modificat | 87.45 | |
| TIGR03143 | 555 | AhpF_homolog putative alkyl hydroperoxide reductas | 87.23 | |
| TIGR02190 | 79 | GlrX-dom Glutaredoxin-family domain. This C-termin | 87.01 | |
| PRK03147 | 173 | thiol-disulfide oxidoreductase; Provisional | 86.66 | |
| TIGR01130 | 462 | ER_PDI_fam protein disulfide isomerases, eukaryoti | 86.26 | |
| PTZ00102 | 477 | disulphide isomerase; Provisional | 86.11 | |
| cd02976 | 73 | NrdH NrdH-redoxin (NrdH) family; NrdH is a small m | 84.64 | |
| cd03419 | 82 | GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX h | 84.47 | |
| cd02957 | 113 | Phd_like Phosducin (Phd)-like family; composed of | 84.47 | |
| cd02989 | 113 | Phd_like_TxnDC9 Phosducin (Phd)-like family, Thior | 83.21 | |
| cd03027 | 73 | GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Eg | 83.15 | |
| COG0695 | 80 | GrxC Glutaredoxin and related proteins [Posttransl | 82.31 | |
| cd02955 | 124 | SSP411 TRX domain, SSP411 protein family; members | 82.3 | |
| TIGR02740 | 271 | TraF-like TraF-like protein. This protein is relat | 82.02 | |
| TIGR02738 | 153 | TrbB type-F conjugative transfer system pilin asse | 82.0 | |
| cd03011 | 123 | TlpA_like_ScsD_MtbDsbE TlpA-like family, suppresso | 82.0 | |
| cd02954 | 114 | DIM1 Dim1 family; Dim1 is also referred to as U5 s | 81.65 | |
| cd02995 | 104 | PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain | 81.57 | |
| PRK14018 | 521 | trifunctional thioredoxin/methionine sulfoxide red | 81.51 | |
| PLN00410 | 142 | U5 snRNP protein, DIM1 family; Provisional | 81.16 | |
| cd02066 | 72 | GRX_family Glutaredoxin (GRX) family; composed of | 81.13 | |
| TIGR02189 | 99 | GlrX-like_plant Glutaredoxin-like family. This fam | 80.97 | |
| PTZ00056 | 199 | glutathione peroxidase; Provisional | 80.82 |
| >COG2761 FrnE Predicted dithiol-disulfide isomerase involved in polyketide biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
Probab=99.40 E-value=7.3e-12 Score=101.13 Aligned_cols=117 Identities=15% Similarity=0.253 Sum_probs=99.8
Q ss_pred hhHHHHHHHHHhhhh-HHHHh--chhhhhcCCCCCCChHHHHHHHHHHHHhhcCCChhHHHHcccCChhHHHHHHHHHHH
Q 031378 30 CFFLVVLYIKRRLNC-LLEIV--QQEKFYNAPTQNMTRTAVVKEIVKFAAEGIGNSYSSALESGFSDRSTDLLTRVSFKF 106 (160)
Q Consensus 30 ~~a~ra~~aar~~~~-~l~~~--~Q~~f~~~~~~~~t~~~i~~~la~~A~~~~Gld~~~~f~~~l~~~~~~~~i~~~~k~ 106 (160)
..|||+.+.|+..|+ ...++ -|++|+.. +.|.+..+++-.|+..+ ||| .+.|++.+.+.+....++.+.+.
T Consensus 103 ~~Ah~l~~~A~~~G~~~~~~~~~lf~AyF~e-g~nI~D~dVL~diA~~~----GLD-~~~~~~~L~s~~~~~avr~d~~~ 176 (225)
T COG2761 103 LDAHRLIKAAELQGKAQDRFLEALFEAYFEE-GRNIGDEDVLADIAEEV----GLD-REEFKADLASDAAKDAVRQDEAA 176 (225)
T ss_pred HHHHHHHHHHHHhCchHHHHHHHHHHHHhcc-CCCCCcHHHHHHHHHHh----CCC-HHHHHHHHhChHHHHHHHHHHHH
Confidence 399999999999997 44555 68888776 67888887766666554 999 69999999999999999999999
Q ss_pred hhcCCccccceEEE-CCEEecCCCCCCCHHHHHHHHHHHhhhcCCCCCcc
Q 031378 107 SATRGVYATPTFFV-NGFSLAGAGSPLDYNGWRKVIDPLLSEKGKKREVP 155 (160)
Q Consensus 107 a~~~GV~GTPTffI-NG~~~~ga~s~~~~e~~~~~Id~~l~~~~~~~~~~ 155 (160)
+++.||+|.|||++ +|..++|+.+ ++.+...|+.+++.+.+.+..|
T Consensus 177 A~e~gI~gVP~fv~d~~~~V~Gaq~---~~v~~~al~~~~~~~~~~~~~~ 223 (225)
T COG2761 177 AQEMGIRGVPTFVFDGKYAVSGAQP---YDVLEDALRQLLAEKAEEHKPP 223 (225)
T ss_pred HHHCCCccCceEEEcCcEeecCCCC---HHHHHHHHHHHHhcccccCCCC
Confidence 99999999999999 7888999888 9999999999998885544443
|
|
| >cd03024 DsbA_FrnE DsbA family, FrnE subfamily; FrnE is a DsbA-like protein containing a CXXC motif | Back alignment and domain information |
|---|
| >cd03022 DsbA_HCCA_Iso DsbA family, 2-hydroxychromene-2-carboxylate (HCCA) isomerase subfamily; HCCA isomerase is a glutathione (GSH) dependent enzyme involved in the naphthalene catabolic pathway | Back alignment and domain information |
|---|
| >COG3531 Predicted protein-disulfide isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd03023 DsbA_Com1_like DsbA family, Com1-like subfamily; composed of proteins similar to Com1, a 27-kDa outer membrane-associated immunoreactive protein originally found in both acute and chronic disease strains of the pathogenic bacteria Coxiella burnetti | Back alignment and domain information |
|---|
| >PF01323 DSBA: DSBA-like thioredoxin domain; InterPro: IPR001853 DSBA is a sub-family of the Thioredoxin family [] | Back alignment and domain information |
|---|
| >PRK10954 periplasmic protein disulfide isomerase I; Provisional | Back alignment and domain information |
|---|
| >cd03019 DsbA_DsbA DsbA family, DsbA subfamily; DsbA is a monomeric thiol disulfide oxidoreductase protein containing a redox active CXXC motif imbedded in a TRX fold | Back alignment and domain information |
|---|
| >PF13743 Thioredoxin_5: Thioredoxin; PDB: 3KZQ_C | Back alignment and domain information |
|---|
| >PF13462 Thioredoxin_4: Thioredoxin; PDB: 3FEU_A 3HZ8_A 3DVW_A 3A3T_E 3GMF_A 1Z6M_A 3GYK_C 3BCK_A 3BD2_A 3BCI_A | Back alignment and domain information |
|---|
| >cd03025 DsbA_FrnE_like DsbA family, FrnE-like subfamily; composed of uncharacterized proteins containing a CXXC motif with similarity to DsbA and FrnE | Back alignment and domain information |
|---|
| >COG1651 DsbG Protein-disulfide isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG3917 NahD 2-hydroxychromene-2-carboxylate isomerase [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >cd03021 DsbA_GSTK DsbA family, Glutathione (GSH) S-transferase Kappa (GSTK) subfamily; GSTK is a member of the GST family of enzymes which catalyzes the transfer of the thiol of GSH to electrophilic substrates | Back alignment and domain information |
|---|
| >PRK10877 protein disulfide isomerase II DsbC; Provisional | Back alignment and domain information |
|---|
| >PRK11657 dsbG disulfide isomerase/thiol-disulfide oxidase; Provisional | Back alignment and domain information |
|---|
| >cd03020 DsbA_DsbC_DsbG DsbA family, DsbC and DsbG subfamily; V-shaped homodimeric proteins containing a redox active CXXC motif imbedded in a TRX fold | Back alignment and domain information |
|---|
| >TIGR00411 redox_disulf_1 small redox-active disulfide protein 1 | Back alignment and domain information |
|---|
| >PF13098 Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_A 2L57_A 1EEJ_B 1TJD_A 1JZD_B 1JZO_A 1G0T_B 3GV1_A 1V58_A 2H0H_A | Back alignment and domain information |
|---|
| >cd02972 DsbA_family DsbA family; consists of DsbA and DsbA-like proteins, including DsbC, DsbG, glutathione (GSH) S-transferase kappa (GSTK), 2-hydroxychromene-2-carboxylate (HCCA) isomerase, an oxidoreductase (FrnE) presumed to be involved in frenolicin biosynthesis, a 27-kDa outer membrane protein, and similar proteins | Back alignment and domain information |
|---|
| >PF13192 Thioredoxin_3: Thioredoxin domain; PDB: 1ZYP_B 1ZYN_A 1HYU_A 1ILO_A 1J08_F 2YWM_B 2AYT_B 2HLS_B 1A8L_A 2K8S_B | Back alignment and domain information |
|---|
| >PRK11509 hydrogenase-1 operon protein HyaE; Provisional | Back alignment and domain information |
|---|
| >cd03065 PDI_b_Calsequestrin_N PDIb family, Calsequestrin subfamily, N-terminal TRX-fold domain; Calsequestrin is the major calcium storage protein in the sarcoplasmic reticulum (SR) of skeletal and cardiac muscle | Back alignment and domain information |
|---|
| >cd02963 TRX_DnaJ TRX domain, DnaJ domain containing protein family; composed of uncharacterized proteins of about 500-800 amino acids, containing an N-terminal DnaJ domain followed by one redox active TRX domain | Back alignment and domain information |
|---|
| >cd02951 SoxW SoxW family; SoxW is a bacterial periplasmic TRX, containing a redox active CXXC motif, encoded by a genetic locus (sox operon) involved in thiosulfate oxidation | Back alignment and domain information |
|---|
| >PRK10996 thioredoxin 2; Provisional | Back alignment and domain information |
|---|
| >PF00085 Thioredoxin: Thioredoxin; InterPro: IPR013766 Thioredoxins [, , , ] are small disulphide-containing redox proteins that have been found in all the kingdoms of living organisms | Back alignment and domain information |
|---|
| >TIGR00412 redox_disulf_2 small redox-active disulfide protein 2 | Back alignment and domain information |
|---|
| >PRK09381 trxA thioredoxin; Provisional | Back alignment and domain information |
|---|
| >cd02956 ybbN ybbN protein family; ybbN is a hypothetical protein containing a redox-inactive TRX-like domain | Back alignment and domain information |
|---|
| >TIGR02196 GlrX_YruB Glutaredoxin-like protein, YruB-family | Back alignment and domain information |
|---|
| >cd02950 TxlA TRX-like protein A (TxlA) family; TxlA was originally isolated from the cyanobacterium Synechococcus | Back alignment and domain information |
|---|
| >cd02948 TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fusion protein family; most members of this group are fusion proteins which contain one redox active TRX domain containing a CXXC motif and three NDPK domains, and are characterized as intermediate chains (ICs) of axonemal outer arm dynein | Back alignment and domain information |
|---|
| >PRK15412 thiol:disulfide interchange protein DsbE; Provisional | Back alignment and domain information |
|---|
| >PRK11200 grxA glutaredoxin 1; Provisional | Back alignment and domain information |
|---|
| >cd02947 TRX_family TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains | Back alignment and domain information |
|---|
| >TIGR01068 thioredoxin thioredoxin | Back alignment and domain information |
|---|
| >cd02949 TRX_NTR TRX domain, novel NADPH thioredoxin reductase (NTR) family; composed of fusion proteins found only in oxygenic photosynthetic organisms containing both TRX and NTR domains | Back alignment and domain information |
|---|
| >TIGR00385 dsbE periplasmic protein thiol:disulfide oxidoreductases, DsbE subfamily | Back alignment and domain information |
|---|
| >cd03026 AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxide reductase F subunit (AhpF) N-terminal domain (NTD) subfamily, C-terminal TRX-fold subdomain; AhpF is a homodimeric flavoenzyme which catalyzes the NADH-dependent reduction of the peroxiredoxin AhpC, which then reduces hydrogen peroxide and organic hydroperoxides | Back alignment and domain information |
|---|
| >COG2143 Thioredoxin-related protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd02973 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)-like family; composed of archaeal and bacterial proteins that show similarity to both TRX and GRX, including the C-terminal TRX-fold subdomain of Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO) | Back alignment and domain information |
|---|
| >KOG0910 consensus Thioredoxin-like protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PTZ00443 Thioredoxin domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01126 pdi_dom protein disulfide-isomerase domain | Back alignment and domain information |
|---|
| >TIGR01295 PedC_BrcD bacteriocin transport accessory protein, putative | Back alignment and domain information |
|---|
| >cd02997 PDI_a_PDIR PDIa family, PDIR subfamily; composed of proteins similar to human PDIR (for Protein Disulfide Isomerase Related) | Back alignment and domain information |
|---|
| >PHA02278 thioredoxin-like protein | Back alignment and domain information |
|---|
| >cd02994 PDI_a_TMX PDIa family, TMX subfamily; composed of proteins similar to the TRX-related human transmembrane protein, TMX | Back alignment and domain information |
|---|
| >cd02984 TRX_PICOT TRX domain, PICOT (for PKC-interacting cousin of TRX) subfamily; PICOT is a protein that interacts with protein kinase C (PKC) theta, a calcium independent PKC isoform selectively expressed in skeletal muscle and T lymphocytes | Back alignment and domain information |
|---|
| >cd02975 PfPDO_like_N Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO)-like family, N-terminal TRX-fold subdomain; composed of proteins with similarity to PfPDO, a redox active thermostable protein believed to be the archaeal counterpart of bacterial DsbA and eukaryotic protein disulfide isomerase (PDI), which are both involved in oxidative protein folding | Back alignment and domain information |
|---|
| >cd02961 PDI_a_family Protein Disulfide Isomerase (PDIa) family, redox active TRX domains; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants | Back alignment and domain information |
|---|
| >cd03003 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains | Back alignment and domain information |
|---|
| >cd02985 TRX_CDSP32 TRX family, chloroplastic drought-induced stress protein of 32 kD (CDSP32); CDSP32 is composed of two TRX domains, a C-terminal TRX domain which contains a redox active CXXC motif and an N-terminal TRX-like domain which contains an SXXS sequence instead of the redox active motif | Back alignment and domain information |
|---|
| >cd03005 PDI_a_ERp46 PDIa family, endoplasmic reticulum protein 46 (ERp46) subfamily; ERp46 is an ER-resident protein containing three redox active TRX domains | Back alignment and domain information |
|---|
| >cd03002 PDI_a_MPD1_like PDI family, MPD1-like subfamily; composed of eukaryotic proteins similar to Saccharomyces cerevisiae MPD1 protein, which contains a single redox active TRX domain located at the N-terminus, and an ER retention signal at the C-terminus indicative of an ER-resident protein | Back alignment and domain information |
|---|
| >cd02996 PDI_a_ERp44 PDIa family, endoplasmic reticulum protein 44 (ERp44) subfamily; ERp44 is an ER-resident protein, induced during stress, involved in thiol-mediated ER retention | Back alignment and domain information |
|---|
| >cd02965 HyaE HyaE family; HyaE is also called HupG and HoxO | Back alignment and domain information |
|---|
| >TIGR02187 GlrX_arch Glutaredoxin-like domain protein | Back alignment and domain information |
|---|
| >cd03000 PDI_a_TMX3 PDIa family, TMX3 subfamily; composed of eukaryotic proteins similar to human TMX3, a TRX related transmembrane protein containing one redox active TRX domain at the N-terminus and a classical ER retrieval sequence for type I transmembrane proteins at the C-terminus | Back alignment and domain information |
|---|
| >cd02953 DsbDgamma DsbD gamma family; DsbD gamma is the C-terminal periplasmic domain of the bacterial protein DsbD | Back alignment and domain information |
|---|
| >cd02958 UAS UAS family; UAS is a domain of unknown function | Back alignment and domain information |
|---|
| >cd02998 PDI_a_ERp38 PDIa family, endoplasmic reticulum protein 38 (ERp38) subfamily; composed of proteins similar to the P5-like protein first isolated from alfalfa, which contains two redox active TRX (a) domains at the N-terminus, like human P5, and a C-terminal domain with homology to the C-terminal domain of ERp29, unlike human P5 | Back alignment and domain information |
|---|
| >cd03004 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains | Back alignment and domain information |
|---|
| >cd03001 PDI_a_P5 PDIa family, P5 subfamily; composed of eukaryotic proteins similar to human P5, a PDI-related protein with a domain structure of aa'b (where a and a' are redox active TRX domains and b is a redox inactive TRX-like domain) | Back alignment and domain information |
|---|
| >TIGR02180 GRX_euk Glutaredoxin | Back alignment and domain information |
|---|
| >cd03029 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hybrid subfamily; composed of hybrid proteins containing peroxiredoxin (PRX) and GRX domains, which is found in some pathogenic bacteria and cyanobacteria | Back alignment and domain information |
|---|
| >cd02999 PDI_a_ERp44_like PDIa family, endoplasmic reticulum protein 44 (ERp44)-like subfamily; composed of uncharacterized PDI-like eukaryotic proteins containing only one redox active TRX (a) domain with a CXXS motif, similar to ERp44 | Back alignment and domain information |
|---|
| >PHA02125 thioredoxin-like protein | Back alignment and domain information |
|---|
| >TIGR02187 GlrX_arch Glutaredoxin-like domain protein | Back alignment and domain information |
|---|
| >TIGR02183 GRXA Glutaredoxin, GrxA family | Back alignment and domain information |
|---|
| >cd03007 PDI_a_ERp29_N PDIa family, endoplasmic reticulum protein 29 (ERp29) subfamily; ERp29 is a ubiquitous ER-resident protein expressed in high levels in secretory cells | Back alignment and domain information |
|---|
| >KOG0908 consensus Thioredoxin-like protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF06764 DUF1223: Protein of unknown function (DUF1223); InterPro: IPR010634 This family consists of several hypothetical proteins of around 250 residues in length, which are found in both plants and bacteria | Back alignment and domain information |
|---|
| >TIGR02181 GRX_bact Glutaredoxin, GrxC family | Back alignment and domain information |
|---|
| >COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd02982 PDI_b'_family Protein Disulfide Isomerase (PDIb') family, redox inactive TRX-like domain b'; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants | Back alignment and domain information |
|---|
| >PTZ00051 thioredoxin; Provisional | Back alignment and domain information |
|---|
| >PF00462 Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors | Back alignment and domain information |
|---|
| >KOG0907 consensus Thioredoxin [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit | Back alignment and domain information |
|---|
| >TIGR02190 GlrX-dom Glutaredoxin-family domain | Back alignment and domain information |
|---|
| >PRK03147 thiol-disulfide oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >TIGR01130 ER_PDI_fam protein disulfide isomerases, eukaryotic | Back alignment and domain information |
|---|
| >PTZ00102 disulphide isomerase; Provisional | Back alignment and domain information |
|---|
| >cd02976 NrdH NrdH-redoxin (NrdH) family; NrdH is a small monomeric protein with a conserved redox active CXXC motif within a TRX fold, characterized by a glutaredoxin (GRX)-like sequence and TRX-like activity profile | Back alignment and domain information |
|---|
| >cd03419 GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX human class 1 and 2 (h_1_2)-like subfamily; composed of proteins similar to human GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain | Back alignment and domain information |
|---|
| >cd02957 Phd_like Phosducin (Phd)-like family; composed of Phd and Phd-like proteins (PhLP), characterized as cytosolic regulators of G protein functions | Back alignment and domain information |
|---|
| >cd02989 Phd_like_TxnDC9 Phosducin (Phd)-like family, Thioredoxin (TRX) domain containing protein 9 (TxnDC9) subfamily; composed of predominantly uncharacterized eukaryotic proteins, containing a TRX-like domain without the redox active CXXC motif | Back alignment and domain information |
|---|
| >cd03027 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Egl-10, and Pleckstrin (DEP) subfamily; composed of uncharacterized proteins containing a GRX domain and additional domains DEP and DUF547, both of which have unknown functions | Back alignment and domain information |
|---|
| >COG0695 GrxC Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd02955 SSP411 TRX domain, SSP411 protein family; members of this family are highly conserved proteins present in eukaryotes, bacteria and archaea, about 600-800 amino acids in length, which contain a TRX domain with a redox active CXXC motif | Back alignment and domain information |
|---|
| >TIGR02740 TraF-like TraF-like protein | Back alignment and domain information |
|---|
| >TIGR02738 TrbB type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB | Back alignment and domain information |
|---|
| >cd03011 TlpA_like_ScsD_MtbDsbE TlpA-like family, suppressor for copper sensitivity D protein (ScsD) and actinobacterial DsbE homolog subfamily; composed of ScsD, the DsbE homolog of Mycobacterium tuberculosis (MtbDsbE) and similar proteins, all containing a redox-active CXXC motif | Back alignment and domain information |
|---|
| >cd02954 DIM1 Dim1 family; Dim1 is also referred to as U5 small nuclear ribonucleoprotein particle (snRNP)-specific 15kD protein | Back alignment and domain information |
|---|
| >cd02995 PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain (a') subfamily; composed of the C-terminal redox active a' domains of PDI, ERp72, ERp57 (or ERp60) and EFP1 | Back alignment and domain information |
|---|
| >PRK14018 trifunctional thioredoxin/methionine sulfoxide reductase A/B protein; Provisional | Back alignment and domain information |
|---|
| >PLN00410 U5 snRNP protein, DIM1 family; Provisional | Back alignment and domain information |
|---|
| >cd02066 GRX_family Glutaredoxin (GRX) family; composed of GRX, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain | Back alignment and domain information |
|---|
| >TIGR02189 GlrX-like_plant Glutaredoxin-like family | Back alignment and domain information |
|---|
| >PTZ00056 glutathione peroxidase; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 160 | |||
| 3gn3_A | 182 | Putative protein-disulfide isomerase; MCSG, PSI, s | 6e-14 | |
| 3bci_A | 186 | Disulfide bond protein A; thiol-disulfide oxidored | 6e-07 | |
| 3gha_A | 202 | Disulfide bond formation protein D; BDBD, DSBA-lik | 1e-06 | |
| 3gmf_A | 205 | Protein-disulfide isomerase; oxidoreductase, PSI-2 | 3e-06 | |
| 3f4s_A | 226 | Alpha-DSBA1, putative uncharacterized protein; thi | 6e-06 | |
| 1z6m_A | 175 | Conserved hypothetical protein; structural genomic | 6e-04 | |
| 3gyk_A | 175 | 27KDA outer membrane protein; APC61738.2, siliciba | 7e-04 |
| >3gn3_A Putative protein-disulfide isomerase; MCSG, PSI, structural GEN protein structure initiative, midwest center for structural genomics; 2.50A {Pseudomonas syringae PV} Length = 182 | Back alignment and structure |
|---|
Score = 64.7 bits (157), Expect = 6e-14
Identities = 18/92 (19%), Positives = 36/92 (39%), Gaps = 8/92 (8%)
Query: 50 QQEKFYNAPTQNMTRTAVVKEIVKFAAEGIGNSYSSALESGFSDRSTDLLTRVSFKFSAT 109
+ E P + T ++ I +++ AL F++ + + K++
Sbjct: 98 EFEHHAGGPNLDATPNDIIARIERYSGL--------ALAEAFANPELEHAVKWHTKYARQ 149
Query: 110 RGVYATPTFFVNGFSLAGAGSPLDYNGWRKVI 141
G++ +PTF +NG G S + W I
Sbjct: 150 NGIHVSPTFMINGLVQPGMSSGDPVSKWVSDI 181
|
| >3bci_A Disulfide bond protein A; thiol-disulfide oxidoreductase, redox protein, protein folding, redox active centre; 1.81A {Staphylococcus aureus} PDB: 3bd2_A 3bck_A Length = 186 | Back alignment and structure |
|---|
| >3gha_A Disulfide bond formation protein D; BDBD, DSBA-like, TRX-like, oxidoreductase, competence, redox-active center; 1.40A {Bacillus subtilis} PDB: 3eu4_A 3gh9_A 3eu3_A Length = 202 | Back alignment and structure |
|---|
| >3gmf_A Protein-disulfide isomerase; oxidoreductase, PSI-2, NYSGXRC, structu genomics, protein structure initiative; 1.76A {Novosphingobium aromaticivorans} Length = 205 | Back alignment and structure |
|---|
| >3f4s_A Alpha-DSBA1, putative uncharacterized protein; thioredoxin-fold, oxidoreductase; HET: PGE; 1.55A {Wolbachia pipientis} PDB: 3f4r_A* 3f4t_A* Length = 226 | Back alignment and structure |
|---|
| >1z6m_A Conserved hypothetical protein; structural genomics, MCSG,, protein structure initiative, midwest center for structural genomics; HET: MSE; 1.30A {Enterococcus faecalis} SCOP: c.47.1.13 Length = 175 | Back alignment and structure |
|---|
| >3gyk_A 27KDA outer membrane protein; APC61738.2, silicibacter pomeroyi DSS-3, thioredoxin-like, oxidoreductase, structural genomics, PSI-2; HET: MSE; 1.76A {Silicibacter pomeroyi} Length = 175 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 160 | |||
| 3gn3_A | 182 | Putative protein-disulfide isomerase; MCSG, PSI, s | 99.69 | |
| 4dvc_A | 184 | Thiol:disulfide interchange protein DSBA; pilus as | 99.57 | |
| 3gmf_A | 205 | Protein-disulfide isomerase; oxidoreductase, PSI-2 | 99.56 | |
| 3gha_A | 202 | Disulfide bond formation protein D; BDBD, DSBA-lik | 99.51 | |
| 3bci_A | 186 | Disulfide bond protein A; thiol-disulfide oxidored | 99.49 | |
| 3kzq_A | 208 | Putative uncharacterized protein VP2116; protein w | 99.46 | |
| 3hd5_A | 195 | Thiol:disulfide interchange protein DSBA; protein | 99.46 | |
| 3fz5_A | 202 | Possible 2-hydroxychromene-2-carboxylate isomeras; | 99.45 | |
| 3gl5_A | 239 | Putative DSBA oxidoreductase SCO1869; probable DSB | 99.45 | |
| 2imf_A | 203 | HCCA isomerase, 2-hydroxychromene-2-carboxylate is | 99.44 | |
| 3h93_A | 192 | Thiol:disulfide interchange protein DSBA; disulfid | 99.44 | |
| 3gyk_A | 175 | 27KDA outer membrane protein; APC61738.2, siliciba | 99.43 | |
| 2in3_A | 216 | Hypothetical protein; DSBA family, FRNE-like subfa | 99.43 | |
| 3hz8_A | 193 | Thiol:disulfide interchange protein DSBA; thiol-ox | 99.4 | |
| 2rem_A | 193 | Disulfide oxidoreductase; disulfide oxidoreductase | 99.39 | |
| 3l9s_A | 191 | Thiol:disulfide interchange protein; thioredoxin-f | 99.36 | |
| 3l9v_A | 189 | Putative thiol-disulfide isomerase or thioredoxin; | 99.36 | |
| 3f4s_A | 226 | Alpha-DSBA1, putative uncharacterized protein; thi | 99.35 | |
| 2znm_A | 195 | Thiol:disulfide interchange protein DSBA; thioredo | 99.32 | |
| 3c7m_A | 195 | Thiol:disulfide interchange protein DSBA-like; red | 99.32 | |
| 1r4w_A | 226 | Glutathione S-transferase, mitochondrial; glutathi | 99.28 | |
| 3feu_A | 185 | Putative lipoprotein; alpha-beta structure, struct | 99.25 | |
| 3rpp_A | 234 | Glutathione S-transferase kappa 1; glutathione tra | 99.13 | |
| 1z6m_A | 175 | Conserved hypothetical protein; structural genomic | 98.8 | |
| 1un2_A | 197 | DSBA, thiol-disulfide interchange protein; disulfi | 98.74 | |
| 3gv1_A | 147 | Disulfide interchange protein; neisseria gonorrhoe | 98.35 | |
| 1t3b_A | 211 | Thiol:disulfide interchange protein DSBC; oxidored | 97.97 | |
| 1eej_A | 216 | Thiol:disulfide interchange protein; oxidoreductas | 97.88 | |
| 1v58_A | 241 | Thiol:disulfide interchange protein DSBG; reduced | 97.65 | |
| 1nho_A | 85 | Probable thioredoxin; beta sheet, alpha helix, oxi | 97.38 | |
| 1fo5_A | 85 | Thioredoxin; disulfide oxidoreductase, structural | 97.34 | |
| 3kp8_A | 106 | Vkorc1/thioredoxin domain protein; blood coagulati | 97.05 | |
| 2e0q_A | 104 | Thioredoxin; electron transport; 1.49A {Sulfolobus | 96.88 | |
| 2trx_A | 108 | Thioredoxin; electron transport; 1.68A {Escherichi | 96.86 | |
| 1thx_A | 115 | Thioredoxin, thioredoxin 2; oxido-reductase, elect | 96.82 | |
| 1ilo_A | 77 | Conserved hypothetical protein MTH895; beta-alpha- | 96.77 | |
| 1fb6_A | 105 | Thioredoxin M; electron transport; 2.10A {Spinacia | 96.76 | |
| 1t00_A | 112 | Thioredoxin, TRX; redox regulation, multifunction | 96.75 | |
| 3gnj_A | 111 | Thioredoxin domain protein; APC92103, STR genomics | 96.69 | |
| 1dby_A | 107 | Chloroplast thioredoxin M CH2; thioredoxin CH2, ch | 96.65 | |
| 3tco_A | 109 | Thioredoxin (TRXA-1); disulfide oxidoreductase, ox | 96.64 | |
| 2l57_A | 126 | Uncharacterized protein; structural genomics, unkn | 96.61 | |
| 3p2a_A | 148 | Thioredoxin 2, putative thioredoxin-like protein; | 96.61 | |
| 1w4v_A | 119 | Thioredoxin, mitochondrial; antioxidant enzyme, mi | 96.61 | |
| 2es7_A | 142 | Q8ZP25_salty, putative thiol-disulfide isomerase a | 96.61 | |
| 2i4a_A | 107 | Thioredoxin; acidophIle, disulfide exchange, oxido | 96.61 | |
| 1ep7_A | 112 | Thioredoxin CH1, H-type; electron transport; 2.10A | 96.58 | |
| 1v98_A | 140 | Thioredoxin; oxidoreductase, structural genomics, | 96.55 | |
| 1nsw_A | 105 | Thioredoxin, TRX; thermostability, electron transp | 96.55 | |
| 2yzu_A | 109 | Thioredoxin; redox protein, electron transport, st | 96.52 | |
| 3die_A | 106 | Thioredoxin, TRX; electron transport, SWAP domain, | 96.52 | |
| 3emx_A | 135 | Thioredoxin; structural genomics, oxidoreductase, | 96.52 | |
| 1r26_A | 125 | Thioredoxin; redox-active disulfide, electron tran | 96.48 | |
| 1xwb_A | 106 | Thioredoxin; dimerization, redox regulation, THI X | 96.41 | |
| 3hz4_A | 140 | Thioredoxin; NYSGXRC, PSI-II, reduced form, protei | 96.4 | |
| 3m9j_A | 105 | Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} | 96.39 | |
| 2voc_A | 112 | Thioredoxin; electron transport, homodimer, disulf | 96.39 | |
| 2vlu_A | 122 | Thioredoxin, thioredoxin H isoform 2.; oxidoreduct | 96.38 | |
| 2o8v_B | 128 | Thioredoxin 1; disulfide crosslinked complex, oxid | 96.36 | |
| 2vim_A | 104 | Thioredoxin, TRX; thioredoxin fold, oxidoreductase | 96.25 | |
| 2i1u_A | 121 | Thioredoxin, TRX, MPT46; redox protein, electron t | 96.25 | |
| 2f9s_A | 151 | Thiol-disulfide oxidoreductase RESA; thioredoxin-l | 96.25 | |
| 1syr_A | 112 | Thioredoxin; SGPP, structural genomics, PSI, prote | 96.24 | |
| 2xc2_A | 117 | Thioredoxinn; oxidoreductase, protein disulfide re | 96.23 | |
| 3dml_A | 116 | Putative uncharacterized protein; thioredoxin, oxi | 96.2 | |
| 3zzx_A | 105 | Thioredoxin; oxidoreductase; 1.88A {Litopenaeus va | 96.19 | |
| 2ppt_A | 155 | Thioredoxin-2; thiredoxin, zinc finger, oxidoreduc | 96.18 | |
| 2lja_A | 152 | Putative thiol-disulfide oxidoreductase; structura | 96.18 | |
| 2qgv_A | 140 | Hydrogenase-1 operon protein HYAE; alpha-beta prot | 96.14 | |
| 3uvt_A | 111 | Thioredoxin domain-containing protein 5; thioredox | 96.13 | |
| 1xfl_A | 124 | Thioredoxin H1; AT3G51030, structural genomics, pr | 96.13 | |
| 2l5o_A | 153 | Putative thioredoxin; structural genomics, unknown | 96.12 | |
| 2vm1_A | 118 | Thioredoxin, thioredoxin H isoform 1.; oxidoreduct | 96.11 | |
| 2dj1_A | 140 | Protein disulfide-isomerase A4; protein ERP-72, ER | 96.1 | |
| 4euy_A | 105 | Uncharacterized protein; structural genomics, PSI- | 96.09 | |
| 3d6i_A | 112 | Monothiol glutaredoxin-3; thioredoxin-like, electr | 96.09 | |
| 1x5d_A | 133 | Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC | 96.07 | |
| 3qfa_C | 116 | Thioredoxin; protein-protein complex, rossmann fol | 96.07 | |
| 1oaz_A | 123 | Thioredoxin 1; immune system, antibody/complex, an | 96.05 | |
| 2b5x_A | 148 | YKUV protein, TRXY; thioredoxin-like, oxidoreducta | 96.05 | |
| 2j23_A | 121 | Thioredoxin; immune protein, autoreactivity, cross | 96.04 | |
| 2kuc_A | 130 | Putative disulphide-isomerase; structural genomics | 96.03 | |
| 2l6c_A | 110 | Thioredoxin; oxidoreductase; NMR {Desulfovibrio vu | 96.0 | |
| 2ju5_A | 154 | Thioredoxin disulfide isomerase; protein, oxidored | 95.99 | |
| 1zma_A | 118 | Bacterocin transport accessory protein; alpha-beta | 95.97 | |
| 1ti3_A | 113 | Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Popul | 95.94 | |
| 3eyt_A | 158 | Uncharacterized protein SPOA0173; thioredoxin-like | 95.93 | |
| 2yj7_A | 106 | LPBCA thioredoxin; oxidoreductase; 1.65A {Syntheti | 94.92 | |
| 1mek_A | 120 | Protein disulfide isomerase; electron transport, r | 95.91 | |
| 2hls_A | 243 | Protein disulfide oxidoreductase; thioredoxin fold | 95.89 | |
| 1ego_A | 85 | Glutaredoxin; electron transport; NMR {Escherichia | 95.88 | |
| 3f3q_A | 109 | Thioredoxin-1; His TAG, electron transport, cytopl | 95.87 | |
| 1zzo_A | 136 | RV1677; thioredoxin fold, structural genomics, PSI | 95.86 | |
| 3d22_A | 139 | TRXH4, thioredoxin H-type; electron transport, cyt | 95.83 | |
| 1faa_A | 124 | Thioredoxin F; electron transport; 1.85A {Spinacia | 95.82 | |
| 3ul3_B | 128 | Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; | 95.71 | |
| 3cxg_A | 133 | Putative thioredoxin; malaria, structural GEN oxid | 95.71 | |
| 3hxs_A | 141 | Thioredoxin, TRXP; electron transport; 2.00A {Bact | 95.69 | |
| 3lor_A | 160 | Thiol-disulfide isomerase and thioredoxins; PSI, M | 95.67 | |
| 1x5e_A | 126 | Thioredoxin domain containing protein 1; TMX, TXND | 95.62 | |
| 2pu9_C | 111 | TRX-F, thioredoxin F-type, chloroplast; protein-pr | 95.6 | |
| 3ktb_A | 106 | Arsenical resistance operon trans-acting represso; | 95.55 | |
| 2ywm_A | 229 | Glutaredoxin-like protein; redox protein, structur | 95.5 | |
| 2lst_A | 130 | Thioredoxin; structural genomics, NEW YORK structu | 94.49 | |
| 3kp9_A | 291 | Vkorc1/thioredoxin domain protein; warfarin, disul | 95.44 | |
| 2l5l_A | 136 | Thioredoxin; structural genomics, electron transpo | 95.41 | |
| 3ia1_A | 154 | THIO-disulfide isomerase/thioredoxin; oxidoreducta | 95.35 | |
| 3msz_A | 89 | Glutaredoxin 1; alpha-beta sandwich, center for st | 95.35 | |
| 2qsi_A | 137 | Putative hydrogenase expression/formation protein; | 95.34 | |
| 3gix_A | 149 | Thioredoxin-like protein 4B; PRE-mRNA splicing, TX | 95.32 | |
| 1gh2_A | 107 | Thioredoxin-like protein; redox-active center, ele | 95.26 | |
| 3f9u_A | 172 | Putative exported cytochrome C biogenesis-related; | 95.25 | |
| 2fwh_A | 134 | Thiol:disulfide interchange protein DSBD; thioredo | 95.22 | |
| 2e7p_A | 116 | Glutaredoxin; thioredoxin fold, poplar, electron t | 95.2 | |
| 2wz9_A | 153 | Glutaredoxin-3; protein binding; 1.55A {Homo sapie | 95.2 | |
| 1wmj_A | 130 | Thioredoxin H-type; structural genomics, program f | 95.1 | |
| 3raz_A | 151 | Thioredoxin-related protein; structural genomics, | 95.08 | |
| 2h30_A | 164 | Thioredoxin, peptide methionine sulfoxide reductas | 95.07 | |
| 1kng_A | 156 | Thiol:disulfide interchange protein CYCY; thioredo | 95.04 | |
| 3kgk_A | 110 | Arsenical resistance operon trans-acting represso; | 95.04 | |
| 3apq_A | 210 | DNAJ homolog subfamily C member 10; thioredoxin fo | 94.99 | |
| 2lrn_A | 152 | Thiol:disulfide interchange protein; structural ge | 94.85 | |
| 1lu4_A | 136 | Soluble secreted antigen MPT53; thioredoxin-like f | 94.84 | |
| 1r7h_A | 75 | NRDH-redoxin; thioredoxin, glutaredoxin, redox pro | 94.84 | |
| 3or5_A | 165 | Thiol:disulfide interchange protein, thioredoxin p | 94.8 | |
| 2oe3_A | 114 | Thioredoxin-3; electron transport, alpha/beta sand | 94.79 | |
| 4evm_A | 138 | Thioredoxin family protein; structural genomics, n | 94.64 | |
| 1a8l_A | 226 | Protein disulfide oxidoreductase; PDI, thioredoxin | 94.62 | |
| 3idv_A | 241 | Protein disulfide-isomerase A4; thioredoxin-like f | 94.6 | |
| 3ha9_A | 165 | Uncharacterized thioredoxin-like protein; PSI, MCS | 94.55 | |
| 3idv_A | 241 | Protein disulfide-isomerase A4; thioredoxin-like f | 94.51 | |
| 2dml_A | 130 | Protein disulfide-isomerase A6; thioredoxin domain | 94.47 | |
| 1h75_A | 81 | Glutaredoxin-like protein NRDH; electron transport | 94.42 | |
| 1qgv_A | 142 | Spliceosomal protein U5-15KD; snRNP, thioredoxin, | 94.42 | |
| 3fkf_A | 148 | Thiol-disulfide oxidoreductase; structural genomic | 94.34 | |
| 3hcz_A | 148 | Possible thiol-disulfide isomerase; APC61559.2, cy | 94.33 | |
| 3dxb_A | 222 | Thioredoxin N-terminally fused to PUF60(UHM); spli | 94.28 | |
| 3ic4_A | 92 | Glutaredoxin (GRX-1); structural genomics, PSI, MC | 94.24 | |
| 3ewl_A | 142 | Uncharacterized conserved protein BF1870; alpha-be | 94.1 | |
| 3fk8_A | 133 | Disulphide isomerase; APC61824.1, xylella fastidio | 94.05 | |
| 3erw_A | 145 | Sporulation thiol-disulfide oxidoreductase A; thio | 94.05 | |
| 2b1k_A | 168 | Thiol:disulfide interchange protein DSBE; C-termin | 94.0 | |
| 3h79_A | 127 | Thioredoxin-like protein; thioredoxin fold, cataly | 93.83 | |
| 1fov_A | 82 | Glutaredoxin 3, GRX3; active site disulfide, CIS P | 93.75 | |
| 3aps_A | 122 | DNAJ homolog subfamily C member 10; thioredoxin fo | 93.74 | |
| 3ph9_A | 151 | Anterior gradient protein 3 homolog; thioredoxin f | 93.7 | |
| 3fw2_A | 150 | Thiol-disulfide oxidoreductase; structural genomic | 93.47 | |
| 2dj3_A | 133 | Protein disulfide-isomerase A4; protein ERP-72, ER | 93.39 | |
| 1wjk_A | 100 | C330018D20RIK protein; glutaredoxin, thioredoxin f | 93.32 | |
| 1ttz_A | 87 | Conserved hypothetical protein; structural genomic | 93.3 | |
| 3qou_A | 287 | Protein YBBN; thioredoxin-like fold, tetratricopep | 93.27 | |
| 3gl3_A | 152 | Putative thiol:disulfide interchange protein DSBE; | 93.26 | |
| 2ywi_A | 196 | Hypothetical conserved protein; uncharacterized co | 93.23 | |
| 3kcm_A | 154 | Thioredoxin family protein; SGX, thioredoxin prote | 93.19 | |
| 2k8s_A | 80 | Thioredoxin; dimer, structural genomics, PSI-2, pr | 93.05 | |
| 3kh7_A | 176 | Thiol:disulfide interchange protein DSBE; TRX-like | 93.03 | |
| 2av4_A | 160 | Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECI | 92.91 | |
| 2klx_A | 89 | Glutaredoxin; thioredoxin type domain, ssgcid, ele | 92.84 | |
| 1kte_A | 105 | Thioltransferase; redox-active center, electron tr | 92.57 | |
| 2ht9_A | 146 | Glutaredoxin-2; thioredoxin fold, iron-sulfur clus | 92.5 | |
| 2dbc_A | 135 | PDCL2, unnamed protein product; phosducin-like pro | 92.28 | |
| 2djj_A | 121 | PDI, protein disulfide-isomerase; thioredoxin fold | 92.24 | |
| 3c1r_A | 118 | Glutaredoxin-1; oxidized form, oxidoreductase, cyt | 92.06 | |
| 2hze_A | 114 | Glutaredoxin-1; thioredoxin fold, arsenic, dimethy | 91.95 | |
| 2dlx_A | 153 | UBX domain-containing protein 7; UAS domain, prote | 91.8 | |
| 2r2j_A | 382 | Thioredoxin domain-containing protein 4; CRFS moti | 91.48 | |
| 3eur_A | 142 | Uncharacterized protein; PSI2,MCSG, conserved prot | 91.48 | |
| 2djk_A | 133 | PDI, protein disulfide-isomerase; thioredoxin fold | 91.47 | |
| 2ggt_A | 164 | SCO1 protein homolog, mitochondrial; copper chaper | 90.91 | |
| 3f8u_A | 481 | Protein disulfide-isomerase A3ERP57; endoplasmic r | 90.82 | |
| 2cvb_A | 188 | Probable thiol-disulfide isomerase/thioredoxin; re | 90.77 | |
| 2yan_A | 105 | Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {H | 90.73 | |
| 3qmx_A | 99 | Glutaredoxin A, glutaredoxin 3; electron transport | 90.71 | |
| 3nzn_A | 103 | Glutaredoxin; structural genomics, PSI2, MCSG, pro | 90.68 | |
| 3u5r_E | 218 | Uncharacterized protein; structural genomics, PSI- | 90.59 | |
| 1a8l_A | 226 | Protein disulfide oxidoreductase; PDI, thioredoxin | 90.35 | |
| 2f51_A | 118 | Thioredoxin; electron transport; 1.90A {Trichomona | 90.22 | |
| 3evi_A | 118 | Phosducin-like protein 2; alpha beta, 3-layer(ABA) | 90.22 | |
| 3cmi_A | 171 | Peroxiredoxin HYR1; thioredoxin-like fold, oxidore | 90.13 | |
| 2cq9_A | 130 | GLRX2 protein, glutaredoxin 2; glutathione-S-trans | 90.04 | |
| 1wou_A | 123 | Thioredoxin -related protein, 14 kDa; electron tra | 90.03 | |
| 3rhb_A | 113 | ATGRXC5, glutaredoxin-C5, chloroplastic; thioredox | 89.91 | |
| 2khp_A | 92 | Glutaredoxin; thioredoxin type domain, ssgcid, ele | 89.62 | |
| 2lrt_A | 152 | Uncharacterized protein; structural genomics, thio | 89.56 | |
| 3us3_A | 367 | Calsequestrin-1; calcium-binding protein; 1.74A {O | 89.47 | |
| 2hyx_A | 352 | Protein DIPZ; thioredoxin fold, jelly-roll, struct | 89.39 | |
| 2axo_A | 270 | Hypothetical protein ATU2684; alpha beta protein., | 89.32 | |
| 4fo5_A | 143 | Thioredoxin-like protein; AHPC/TSA family protein, | 89.03 | |
| 2vup_A | 190 | Glutathione peroxidase-like protein; oxidoreductas | 88.61 | |
| 2rli_A | 171 | SCO2 protein homolog, mitochondrial; copper protei | 88.51 | |
| 3lwa_A | 183 | Secreted thiol-disulfide isomerase; thioredoxin, P | 88.09 | |
| 2b5e_A | 504 | Protein disulfide-isomerase; 2.40A {Saccharomyces | 88.04 | |
| 2ywm_A | 229 | Glutaredoxin-like protein; redox protein, structur | 87.61 | |
| 2lqo_A | 92 | Putative glutaredoxin RV3198.1/MT3292; TRX fold, o | 87.12 | |
| 3ctg_A | 129 | Glutaredoxin-2; reduced form, electron transport, | 86.88 | |
| 3q6o_A | 244 | Sulfhydryl oxidase 1; protein disulfide isomerase, | 86.63 | |
| 3h8q_A | 114 | Thioredoxin reductase 3; oxidoreductase, structura | 85.94 | |
| 1sji_A | 350 | Calsequestrin 2, calsequestrin, cardiac muscle iso | 85.46 | |
| 2fgx_A | 107 | Putative thioredoxin; NET3, NESG, GFT-glutaredoxin | 85.09 | |
| 2trc_P | 217 | Phosducin, MEKA, PP33; transducin, beta-gamma, sig | 85.04 | |
| 3ed3_A | 298 | Protein disulfide-isomerase MPD1; thioredoxin-like | 84.44 | |
| 1hyu_A | 521 | AHPF, alkyl hydroperoxide reductase subunit F; thi | 83.67 | |
| 2v1m_A | 169 | Glutathione peroxidase; selenium, selenocysteine, | 83.51 | |
| 1sen_A | 164 | Thioredoxin-like protein P19; endoplasmic reticulu | 83.12 | |
| 2qc7_A | 240 | ERP31, ERP28, endoplasmic reticulum protein ERP29; | 82.94 | |
| 3ira_A | 173 | Conserved protein; methanosarcina mazei,structural | 82.77 | |
| 1t1v_A | 93 | SH3BGRL3, SH3 domain-binding glutamic acid-rich pr | 81.89 | |
| 1wik_A | 109 | Thioredoxin-like protein 2; picot homology 2 domai | 81.82 | |
| 1we0_A | 187 | Alkyl hydroperoxide reductase C; peroxiredoxin, AH | 81.74 | |
| 3tdg_A | 273 | DSBG, putative uncharacterized protein; thioredoxi | 81.25 | |
| 3t58_A | 519 | Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2. | 81.08 | |
| 3ipz_A | 109 | Monothiol glutaredoxin-S14, chloroplastic; electro | 80.42 |
| >3gn3_A Putative protein-disulfide isomerase; MCSG, PSI, structural GEN protein structure initiative, midwest center for structural genomics; 2.50A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
Probab=99.69 E-value=1.1e-16 Score=123.79 Aligned_cols=115 Identities=18% Similarity=0.390 Sum_probs=90.8
Q ss_pred eeeeeccCc---h---hhhHHHHHHHHHhhh--h-----HHHHh--chhhh-hcC----CCCCCChHHHHHHHHHHHHhh
Q 031378 19 KLASYFRDK---F---VCFFLVVLYIKRRLN--C-----LLEIV--QQEKF-YNA----PTQNMTRTAVVKEIVKFAAEG 78 (160)
Q Consensus 19 ~~~~~~~~~---~---~~~a~ra~~aar~~~--~-----~l~~~--~Q~~f-~~~----~~~~~t~~~i~~~la~~A~~~ 78 (160)
+|.+++|.- + +..++|+..++++++ + +.+.+ +|+.| +.. +..++++.+++..+++.+
T Consensus 47 ~v~~v~r~~p~~~h~~s~~aaraa~aa~~~~~~~~~f~~~~~aLf~~q~~~~~~~~~~~~~~~~~~~~~l~~~a~~~--- 123 (182)
T 3gn3_A 47 NVTVRIRLQSQPWHMFSGVIVRCILAAATLEGGKESAKAVMTAVASHREEFEFEHHAGGPNLDATPNDIIARIERYS--- 123 (182)
T ss_dssp TEEEEEEECCCTTSTTHHHHHHHHHHHTTSTTHHHHHHHHHHHHHHTGGGGSCBTTTBSGGGGCCHHHHHHHHHHHH---
T ss_pred CEEEEEEEcCCCCCccHHHHHHHHHHHHHhccChHHHHHHHHHHHhcCcccccccccccccCCCCHHHHHHHHHHHh---
Confidence 556655531 1 247889999998873 2 45544 89998 342 345678888777777664
Q ss_pred cCCChhHHHHcccCChhHHHHHHHHHHHhhcCCccccceEEECCEEecCCCCCCCHHHHHHHH
Q 031378 79 IGNSYSSALESGFSDRSTDLLTRVSFKFSATRGVYATPTFFVNGFSLAGAGSPLDYNGWRKVI 141 (160)
Q Consensus 79 ~Gld~~~~f~~~l~~~~~~~~i~~~~k~a~~~GV~GTPTffING~~~~ga~s~~~~e~~~~~I 141 (160)
|+| .+++ ++++++...++.+.++++++||+|||||+|||+++++.+|++++++|.++|
T Consensus 124 -Gld-~~~~---l~~~~~~~~v~~~~~~a~~~GV~gtPtf~ing~~~~~~s~~~~~e~w~~~l 181 (182)
T 3gn3_A 124 -GLA-LAEA---FANPELEHAVKWHTKYARQNGIHVSPTFMINGLVQPGMSSGDPVSKWVSDI 181 (182)
T ss_dssp -TCC-CHHH---HHCGGGHHHHHHHHHHHHHHTCCSSSEEEETTEECTTCCTTSCHHHHHHHH
T ss_pred -CCC-HHHH---hcChHHHHHHHHHHHHHHHCCCCccCEEEECCEEccCCCCCCCHHHHHHHh
Confidence 999 4877 778899999999999999999999999999999998888999999999987
|
| >4dvc_A Thiol:disulfide interchange protein DSBA; pilus assembly, oxidoreductase, thioredoxin fold, D disulfide bond, DSBB; HET: DMS; 1.20A {Vibrio cholerae} PDB: 2ijy_A 1bed_A | Back alignment and structure |
|---|
| >3gmf_A Protein-disulfide isomerase; oxidoreductase, PSI-2, NYSGXRC, structu genomics, protein structure initiative; 1.76A {Novosphingobium aromaticivorans} | Back alignment and structure |
|---|
| >3gha_A Disulfide bond formation protein D; BDBD, DSBA-like, TRX-like, oxidoreductase, competence, redox-active center; 1.40A {Bacillus subtilis} PDB: 3eu4_A 3gh9_A 3eu3_A | Back alignment and structure |
|---|
| >3bci_A Disulfide bond protein A; thiol-disulfide oxidoreductase, redox protein, protein folding, redox active centre; 1.81A {Staphylococcus aureus} PDB: 3bd2_A 3bck_A | Back alignment and structure |
|---|
| >3kzq_A Putative uncharacterized protein VP2116; protein with unknown function, STRU genomics, PSI, MCSG, protein structure initiative; HET: PG6; 2.10A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >3hd5_A Thiol:disulfide interchange protein DSBA; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.35A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >3fz5_A Possible 2-hydroxychromene-2-carboxylate isomeras; 2-hydroxychromene-2-carboxylate ISO structural genomics, PSI-2; HET: MSE GSH PGE; 2.40A {Rhodobacter sphaeroides 2} | Back alignment and structure |
|---|
| >3gl5_A Putative DSBA oxidoreductase SCO1869; probable DSBA oxidoreductase structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.15A {Streptomyces coelicolor A3} | Back alignment and structure |
|---|
| >2imf_A HCCA isomerase, 2-hydroxychromene-2-carboxylate isomerase; glutathione, KGST, kappa GST, transferase; HET: GSH TOM CXS; 1.30A {Pseudomonas putida} PDB: 2ime_A* 2imd_A* | Back alignment and structure |
|---|
| >3h93_A Thiol:disulfide interchange protein DSBA; disulfide bond, redox-active center, transcription regulator; HET: MSE GOL; 1.50A {Pseudomonas aeruginosa PAO1} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >3gyk_A 27KDA outer membrane protein; APC61738.2, silicibacter pomeroyi DSS-3, thioredoxin-like, oxidoreductase, structural genomics, PSI-2; HET: MSE; 1.76A {Silicibacter pomeroyi} | Back alignment and structure |
|---|
| >2in3_A Hypothetical protein; DSBA family, FRNE-like subfamily, disulfide isomerase, struc genomics, PSI-2, protein structure initiative; 1.85A {Nitrosomonas europaea} | Back alignment and structure |
|---|
| >3hz8_A Thiol:disulfide interchange protein DSBA; thiol-oxidoreductase, disulfide bond; 1.45A {Neisseria meningitidis MC58} PDB: 3dvw_A 3a3t_A | Back alignment and structure |
|---|
| >2rem_A Disulfide oxidoreductase; disulfide oxidoreductase, DSBA, thioredoxin fold, redox- active center; 1.90A {Xylella fastidiosa} | Back alignment and structure |
|---|
| >3l9s_A Thiol:disulfide interchange protein; thioredoxin-fold, DSBA, thiol-disulfide oxidoreductase, DISU bond, redox-active center; 1.58A {Salmonella enterica subsp} SCOP: c.47.1.13 PDB: 1a23_A 1a24_A 1a2j_A 1a2l_A 1a2m_A 1dsb_A 1fvk_A 3dks_A 1bq7_A 1fvj_A 1acv_A 1u3a_A* 1ti1_A* 2hi7_A* 2leg_A* 2zup_A* 3e9j_B* 1ac1_A 2b6m_A 2b3s_A | Back alignment and structure |
|---|
| >3l9v_A Putative thiol-disulfide isomerase or thioredoxin; thioredoxin-fold, SRGA, thiol-disulfide oxidoreductase, ISOM oxidoreductase; HET: PE8 P4C P6G; 2.15A {Salmonella enterica subsp} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >3f4s_A Alpha-DSBA1, putative uncharacterized protein; thioredoxin-fold, oxidoreductase; HET: PGE; 1.55A {Wolbachia pipientis} PDB: 3f4r_A* 3f4t_A* | Back alignment and structure |
|---|
| >2znm_A Thiol:disulfide interchange protein DSBA; thioredoxin fold, DSBA-like, oxidoreductase; 2.30A {Neisseria meningitidis serogroup B} PDB: 3dvx_A | Back alignment and structure |
|---|
| >3c7m_A Thiol:disulfide interchange protein DSBA-like; redox protein, periplasm, redox-active center, oxidoreductase; HET: PGE; 1.55A {Escherichia coli} PDB: 3l9u_A | Back alignment and structure |
|---|
| >1r4w_A Glutathione S-transferase, mitochondrial; glutathione transferase, kappa GST, RGSTK1-1; HET: GSH; 2.50A {Rattus norvegicus} SCOP: c.47.1.13 | Back alignment and structure |
|---|
| >3feu_A Putative lipoprotein; alpha-beta structure, structural genomics, PSI-2, protein ST initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.76A {Vibrio fischeri} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >3rpp_A Glutathione S-transferase kappa 1; glutathione transferase, kappa GST, TRX domain, GSH binding, detoxification, APO form; 1.80A {Homo sapiens} PDB: 3rpn_A 1yzx_A* | Back alignment and structure |
|---|
| >1z6m_A Conserved hypothetical protein; structural genomics, MCSG,, protein structure initiative, midwest center for structural genomics; HET: MSE; 1.30A {Enterococcus faecalis} SCOP: c.47.1.13 | Back alignment and structure |
|---|
| >1un2_A DSBA, thiol-disulfide interchange protein; disulfide oxidoreductase, oxidoreductase, protein disulfide isomerase, protein folding, thioredoxin; 2.4A {Escherichia coli} SCOP: c.47.1.13 | Back alignment and structure |
|---|
| >3gv1_A Disulfide interchange protein; neisseria gonorrhoeae (strain 700825 / FA 1090), DSBC, structural genomics, unknown funct 2; 2.00A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >1t3b_A Thiol:disulfide interchange protein DSBC; oxidoreductase, protein disulfide isomerase, protein folding, redox protein; 2.50A {Haemophilus influenzae} SCOP: c.47.1.9 d.17.3.1 | Back alignment and structure |
|---|
| >1eej_A Thiol:disulfide interchange protein; oxidoreductase, protein disulfide isomerase, protein folding, redox protein, redox-active center; HET: MES; 1.90A {Escherichia coli} SCOP: c.47.1.9 d.17.3.1 PDB: 1tjd_A 1jzd_A 1jzo_A 1g0t_A 2iyj_A | Back alignment and structure |
|---|
| >1v58_A Thiol:disulfide interchange protein DSBG; reduced DSBG, redox protein, protein disulfide isomerase, thioredoxin fold; 1.70A {Escherichia coli} SCOP: c.47.1.9 d.17.3.1 PDB: 1v57_A 2h0i_A 2h0h_A 2h0g_A 2iy2_A | Back alignment and structure |
|---|
| >1nho_A Probable thioredoxin; beta sheet, alpha helix, oxidoreductase; NMR {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >1fo5_A Thioredoxin; disulfide oxidoreductase, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; NMR {Methanocaldococcus jannaschii} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3kp8_A Vkorc1/thioredoxin domain protein; blood coagulation, disulfide formation, redox partner, oxidoreductase; 1.66A {Synechococcus SP} | Back alignment and structure |
|---|
| >2e0q_A Thioredoxin; electron transport; 1.49A {Sulfolobus tokodaii} PDB: 3hhv_A | Back alignment and structure |
|---|
| >2trx_A Thioredoxin; electron transport; 1.68A {Escherichia coli} SCOP: c.47.1.1 PDB: 1skr_B* 1skw_B* 1sl0_B* 1sks_B* 1sl2_B* 1t7p_B* 1t8e_B* 1tk0_B* 1tk5_B* 1tk8_B* 1tkd_B* 1sl1_B* 1x9s_B* 1x9w_B* 1xoa_A 1xob_A 1zyq_B* 2ajq_B* 2bto_T* 2h6x_A ... | Back alignment and structure |
|---|
| >1thx_A Thioredoxin, thioredoxin 2; oxido-reductase, electron transport; 1.60A {Nostoc SP} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >1ilo_A Conserved hypothetical protein MTH895; beta-alpha-beta-alpha-beta-BETA-alpha motif, structural genomics, PSI; NMR {Methanothermobacterthermautotrophicus str} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >1fb6_A Thioredoxin M; electron transport; 2.10A {Spinacia oleracea} SCOP: c.47.1.1 PDB: 1fb0_A 1gl8_A 2puk_C | Back alignment and structure |
|---|
| >1t00_A Thioredoxin, TRX; redox regulation, multifunction macromolecule, electron transport; 1.51A {Streptomyces coelicolor} | Back alignment and structure |
|---|
| >3gnj_A Thioredoxin domain protein; APC92103, STR genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.99A {Desulfitobacterium hafniense dcb-2} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >1dby_A Chloroplast thioredoxin M CH2; thioredoxin CH2, chloroplastic thioredoxin, oxidoreductase; NMR {Chlamydomonas reinhardtii} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3tco_A Thioredoxin (TRXA-1); disulfide oxidoreductase, oxidoreductase; 1.90A {Sulfolobus solfataricus} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >2l57_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, PSI protein structure initiative; NMR {Clostridium perfringens} | Back alignment and structure |
|---|
| >3p2a_A Thioredoxin 2, putative thioredoxin-like protein; structural genomics, center for structural genomics of infec diseases, csgid; 2.19A {Yersinia pestis} | Back alignment and structure |
|---|
| >1w4v_A Thioredoxin, mitochondrial; antioxidant enzyme, mitochondrion, electron TRA oxidoreductase; 1.80A {Homo sapiens} PDB: 1uvz_A 1w89_A | Back alignment and structure |
|---|
| >2es7_A Q8ZP25_salty, putative thiol-disulfide isomerase and thioredoxi; structural genomics, PSI, protein structure initiative; 2.80A {Salmonella typhimurium} SCOP: c.47.1.20 PDB: 2gzp_A 2jzt_A | Back alignment and structure |
|---|
| >2i4a_A Thioredoxin; acidophIle, disulfide exchange, oxidoreductase; 1.00A {Acetobacter aceti} | Back alignment and structure |
|---|
| >1ep7_A Thioredoxin CH1, H-type; electron transport; 2.10A {Chlamydomonas reinhardtii} SCOP: c.47.1.1 PDB: 1tof_A 1ep8_A | Back alignment and structure |
|---|
| >1v98_A Thioredoxin; oxidoreductase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.82A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1nsw_A Thioredoxin, TRX; thermostability, electron transport; 1.90A {Alicyclobacillus acidocaldarius} SCOP: c.47.1.1 PDB: 1rqm_A 1quw_A 1nw2_A | Back alignment and structure |
|---|
| >2yzu_A Thioredoxin; redox protein, electron transport, structural genomics; 1.90A {Thermus thermophilus} PDB: 2cvk_A | Back alignment and structure |
|---|
| >3die_A Thioredoxin, TRX; electron transport, SWAP domain, redox enzymology, oxidoreductase, redox-active center, transport; 1.85A {Staphylococcus aureus} SCOP: c.47.1.1 PDB: 2o7k_A 2o85_A 2o89_A 2o87_A | Back alignment and structure |
|---|
| >3emx_A Thioredoxin; structural genomics, oxidoreductase, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.25A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1r26_A Thioredoxin; redox-active disulfide, electron transport; 1.40A {Trypanosoma} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >1xwb_A Thioredoxin; dimerization, redox regulation, THI X-RAY electron transport; 2.20A {Drosophila melanogaster} SCOP: c.47.1.1 PDB: 1xw9_A 1xwc_A 1xwa_A | Back alignment and structure |
|---|
| >3hz4_A Thioredoxin; NYSGXRC, PSI-II, reduced form, protein structure initiative, structural genomics; 2.30A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3m9j_A Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} SCOP: c.47.1.1 PDB: 3m9k_A 2hsh_A 1erv_A 2ifq_A 2ifq_B 1auc_A 1eru_A 1ert_A 3kd0_A 1aiu_A 3trx_A 4trx_A 1trs_A 1tru_A 1trv_A 1trw_A 3e3e_A* 1cqg_A 1cqh_A 1mdi_A ... | Back alignment and structure |
|---|
| >2voc_A Thioredoxin; electron transport, homodimer, disulfide, transport, redox-active center; 1.50A {Bacillus subtilis} PDB: 2ipa_A 2gzy_A 2gzz_A | Back alignment and structure |
|---|
| >2vlu_A Thioredoxin, thioredoxin H isoform 2.; oxidoreductase, thioredoxin-fold, protein disulfide reductase; 1.70A {Hordeum vulgare var} PDB: 2vlt_A 2vlv_A 2iwt_A* | Back alignment and structure |
|---|
| >2o8v_B Thioredoxin 1; disulfide crosslinked complex, oxidoreductase; 3.00A {Escherichia coli} | Back alignment and structure |
|---|
| >2vim_A Thioredoxin, TRX; thioredoxin fold, oxidoreductase; 1.38A {Fasciola hepatica} | Back alignment and structure |
|---|
| >2i1u_A Thioredoxin, TRX, MPT46; redox protein, electron transport; 1.30A {Mycobacterium tuberculosis} PDB: 3nof_A 3o6t_A* 2l4q_A 2l59_A | Back alignment and structure |
|---|
| >2f9s_A Thiol-disulfide oxidoreductase RESA; thioredoxin-like protein; HET: MSE; 1.40A {Bacillus subtilis} SCOP: c.47.1.10 PDB: 1st9_A 1su9_A 2h1d_A 2h1b_A 2h1a_A 2h19_A 2h1g_A 3c71_A 3c73_A | Back alignment and structure |
|---|
| >1syr_A Thioredoxin; SGPP, structural genomics, PSI, protein structure initiative structural genomics of pathogenic protozoa consortium; 2.95A {Plasmodium falciparum} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2xc2_A Thioredoxinn; oxidoreductase, protein disulfide reductase; 1.56A {Schistosoma mansoni} PDB: 2xbq_A 2xbi_A | Back alignment and structure |
|---|
| >3dml_A Putative uncharacterized protein; thioredoxin, oxidoreductase, sulfur oxidation, thiol- disulfide oxidoreductase; HET: MSE; 1.90A {Paracoccus denitrificans} PDB: 3d4t_A* | Back alignment and structure |
|---|
| >3zzx_A Thioredoxin; oxidoreductase; 1.88A {Litopenaeus vannamei} | Back alignment and structure |
|---|
| >2ppt_A Thioredoxin-2; thiredoxin, zinc finger, oxidoreductase; 1.92A {Rhodobacter capsulatus} | Back alignment and structure |
|---|
| >2lja_A Putative thiol-disulfide oxidoreductase; structural genomics, unknown function, thioredoxin-like; NMR {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >2qgv_A Hydrogenase-1 operon protein HYAE; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Shigella flexneri 2A} PDB: 2hfd_A | Back alignment and structure |
|---|
| >3uvt_A Thioredoxin domain-containing protein 5; thioredoxin-like fold, isomerase; 2.00A {Homo sapiens} PDB: 2diz_A 3uj1_A | Back alignment and structure |
|---|
| >1xfl_A Thioredoxin H1; AT3G51030, structural genomics, protein structure initiative, CESG, center for eukaryotic structural genomics; NMR {Arabidopsis thaliana} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2l5o_A Putative thioredoxin; structural genomics, unknown function, PSI-2, protein struct initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >2vm1_A Thioredoxin, thioredoxin H isoform 1.; oxidoreductase, protein disulfide reductase, thioredoxin-FOL; 1.7A {Hordeum vulgare var} PDB: 2vm2_A | Back alignment and structure |
|---|
| >2dj1_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >4euy_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; 2.90A {Bacillus cereus} | Back alignment and structure |
|---|
| >3d6i_A Monothiol glutaredoxin-3; thioredoxin-like, electron transport, redox- active center, transport, oxidoreductase; HET: CME; 1.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1x5d_A Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC7, thioredoxin like domain, redox, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3qfa_C Thioredoxin; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_C* | Back alignment and structure |
|---|
| >1oaz_A Thioredoxin 1; immune system, antibody/complex, antibody, allergy, IGE, conformational diversity, multispecficity, redox-active center; 2.77A {Escherichia coli} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2b5x_A YKUV protein, TRXY; thioredoxin-like, oxidoreductase; NMR {Bacillus subtilis} SCOP: c.47.1.10 PDB: 2b5y_A | Back alignment and structure |
|---|
| >2j23_A Thioredoxin; immune protein, autoreactivity, cross-reactivity, IGE, fungi, epitope, allergen; 1.41A {Malassezia sympodialis} | Back alignment and structure |
|---|
| >2kuc_A Putative disulphide-isomerase; structural genomics, thioredo PSI-2, protein structure initiative; NMR {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2l6c_A Thioredoxin; oxidoreductase; NMR {Desulfovibrio vulgaris} PDB: 2l6d_A | Back alignment and structure |
|---|
| >2ju5_A Thioredoxin disulfide isomerase; protein, oxidoreductase; NMR {Chlamydophila pneumoniae} | Back alignment and structure |
|---|
| >1zma_A Bacterocin transport accessory protein; alpha-beta-alpha-sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.25A {Streptococcus pneumoniae} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >1ti3_A Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Populus tremula} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3eyt_A Uncharacterized protein SPOA0173; thioredoxin-like superfamily protein SPOA0173, silicibacter DSS, structural genomics, PSI-2; 1.95A {Silicibacter pomeroyi} | Back alignment and structure |
|---|
| >2yj7_A LPBCA thioredoxin; oxidoreductase; 1.65A {Synthetic construct} | Back alignment and structure |
|---|
| >1mek_A Protein disulfide isomerase; electron transport, redox-active center, endoplasmic reticulum; NMR {Homo sapiens} SCOP: c.47.1.2 | Back alignment and structure |
|---|
| >2hls_A Protein disulfide oxidoreductase; thioredoxin fold; 1.93A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1ego_A Glutaredoxin; electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 1egr_A 1grx_A* 1qfn_A | Back alignment and structure |
|---|
| >3f3q_A Thioredoxin-1; His TAG, electron transport, cytoplasm, deoxyribonucleotide synthesis, golgi apparatus, membrane, nucleus; 1.76A {Saccharomyces cerevisiae} PDB: 3f3r_A* 2i9h_A 2fa4_A 2hsy_A 3pin_A 4dss_B | Back alignment and structure |
|---|
| >1zzo_A RV1677; thioredoxin fold, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 1.60A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 3ios_A | Back alignment and structure |
|---|
| >3d22_A TRXH4, thioredoxin H-type; electron transport, cytoplasm, redox-active center, transport, oxidoreductase; 1.60A {Populus trichocarpa x populusdeltoides} PDB: 3d21_A | Back alignment and structure |
|---|
| >1faa_A Thioredoxin F; electron transport; 1.85A {Spinacia oleracea} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3ul3_B Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; 2.90A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3cxg_A Putative thioredoxin; malaria, structural GEN oxidoreductase, structural genomics consortium, SGC; 2.00A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3hxs_A Thioredoxin, TRXP; electron transport; 2.00A {Bacteroides fragilis} PDB: 3hyp_A | Back alignment and structure |
|---|
| >3lor_A Thiol-disulfide isomerase and thioredoxins; PSI, MCSG, structural genomics, midwest CE structural genomics; HET: MSE; 2.20A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >1x5e_A Thioredoxin domain containing protein 1; TMX, TXNDC1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2pu9_C TRX-F, thioredoxin F-type, chloroplast; protein-protein complex, iron-sulfur, electron transport; 1.65A {Spinacia oleracea} PDB: 2pvo_C 1f9m_A | Back alignment and structure |
|---|
| >3ktb_A Arsenical resistance operon trans-acting represso; alpha-beta-alpha sandwich, helix-turn-helix, structural GENO PSI-2; 2.10A {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >2ywm_A Glutaredoxin-like protein; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 2.30A {Aquifex aeolicus} PDB: 2ayt_A | Back alignment and structure |
|---|
| >2lst_A Thioredoxin; structural genomics, NEW YORK structural genomics research consortium, oxidoreductase; NMR {Thermus thermophilus} | Back alignment and structure |
|---|
| >3kp9_A Vkorc1/thioredoxin domain protein; warfarin, disulfide formation, blood coagulation, oxidoreduc blood coagulation,oxidoreductase; HET: U10; 3.60A {Synechococcus SP} | Back alignment and structure |
|---|
| >2l5l_A Thioredoxin; structural genomics, electron transport, PSI-2, protein STRU initiative; NMR {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >3ia1_A THIO-disulfide isomerase/thioredoxin; oxidoreductase, PSI-2, NYSGXRC, structu genomics, protein structure initiative; 1.76A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3msz_A Glutaredoxin 1; alpha-beta sandwich, center for structural genomics of infec diseases, csgid, oxidoreductase; HET: GSH; 2.05A {Francisella tularensis subsp} PDB: 3lgc_A* | Back alignment and structure |
|---|
| >2qsi_A Putative hydrogenase expression/formation protein; HUPG, MCS SAD, structural genomics, protein structure initiative; 1.80A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >3gix_A Thioredoxin-like protein 4B; PRE-mRNA splicing, TXNL4B, DLP, cell cycle, mRNA processing, mRNA splicing, nucleus, phosphoprotein, splicing; HET: SUC; 1.33A {Homo sapiens} SCOP: c.47.1.0 PDB: 1xbs_A | Back alignment and structure |
|---|
| >1gh2_A Thioredoxin-like protein; redox-active center, electron transport; 2.22A {Homo sapiens} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3f9u_A Putative exported cytochrome C biogenesis-related; exported cytochrome C biogenesis-related protein, bacteroide fragilis; 2.20A {Bacteroides fragilis nctc 9343} | Back alignment and structure |
|---|
| >2fwh_A Thiol:disulfide interchange protein DSBD; thioredoxin-like, C-terminal domain, reduced form at PH7, oxidoreductase; 0.99A {Escherichia coli} SCOP: c.47.1.1 PDB: 2fwe_A 2fwf_A 2fwg_A 1vrs_D 1uc7_A | Back alignment and structure |
|---|
| >2e7p_A Glutaredoxin; thioredoxin fold, poplar, electron transport; HET: GSH; 2.10A {Populus tremula x populus tremuloides} PDB: 1z7p_A 1z7r_A | Back alignment and structure |
|---|
| >2wz9_A Glutaredoxin-3; protein binding; 1.55A {Homo sapiens} PDB: 2diy_A | Back alignment and structure |
|---|
| >1wmj_A Thioredoxin H-type; structural genomics, program for RICE genome research, oxidoreductase; NMR {Oryza sativa} | Back alignment and structure |
|---|
| >3raz_A Thioredoxin-related protein; structural genomics, PSI-2, protein structure initiative; 2.00A {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >2h30_A Thioredoxin, peptide methionine sulfoxide reductase MSRA/MSRB; reduced, thiol-disulfide exchange, oxidoreductase; 1.60A {Neisseria gonorrhoeae} PDB: 2jzr_A 2jzs_A 2k9f_A 2fy6_A | Back alignment and structure |
|---|
| >1kng_A Thiol:disulfide interchange protein CYCY; thioredoxin fold, cytochrome C maturation, atomic resolution oxidoreductase; 1.14A {Bradyrhizobium japonicum} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >3kgk_A Arsenical resistance operon trans-acting represso; alpha+beta, chaperone, DNA-binding, RE transcription, transcription regulation; 1.40A {Escherichia coli} PDB: 3mwh_A | Back alignment and structure |
|---|
| >3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} | Back alignment and structure |
|---|
| >2lrn_A Thiol:disulfide interchange protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, oxidoreductase; NMR {Bacteroides SP} | Back alignment and structure |
|---|
| >1lu4_A Soluble secreted antigen MPT53; thioredoxin-like fold, structural genomics, PSI, protein structure initiative; 1.12A {Mycobacterium tuberculosis} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >1r7h_A NRDH-redoxin; thioredoxin, glutaredoxin, redox protein, domain swapping, electron transport; 2.69A {Corynebacterium ammoniagenes} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3or5_A Thiol:disulfide interchange protein, thioredoxin protein; PSI-II, structural genomics, protein structure initiative; 1.66A {Chlorobaculum tepidum} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >2oe3_A Thioredoxin-3; electron transport, alpha/beta sandwich, oxidized, dimer; 1.80A {Saccharomyces cerevisiae} PDB: 2oe1_A 2oe0_A | Back alignment and structure |
|---|
| >4evm_A Thioredoxin family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.51A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >1a8l_A Protein disulfide oxidoreductase; PDI, thioredoxin fold; 1.90A {Pyrococcus furiosus} SCOP: c.47.1.2 c.47.1.2 PDB: 1j08_A | Back alignment and structure |
|---|
| >3idv_A Protein disulfide-isomerase A4; thioredoxin-like fold, disulfide bond, endoplasmic reticulum isomerase, redox-active center; 1.95A {Homo sapiens} PDB: 2dj2_A | Back alignment and structure |
|---|
| >3ha9_A Uncharacterized thioredoxin-like protein; PSI, MCSG, structural G midwest center for structural genomics, protein structure initiative; 1.70A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >3idv_A Protein disulfide-isomerase A4; thioredoxin-like fold, disulfide bond, endoplasmic reticulum isomerase, redox-active center; 1.95A {Homo sapiens} PDB: 2dj2_A | Back alignment and structure |
|---|
| >2dml_A Protein disulfide-isomerase A6; thioredoxin domain-containing protein 7, endoplasmic reticulum, redox-active center, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1h75_A Glutaredoxin-like protein NRDH; electron transport, thioredoxin, redox protein; 1.7A {Escherichia coli} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >1qgv_A Spliceosomal protein U5-15KD; snRNP, thioredoxin, transcription; 1.40A {Homo sapiens} SCOP: c.47.1.8 PDB: 1syx_A 1pqn_A | Back alignment and structure |
|---|
| >3fkf_A Thiol-disulfide oxidoreductase; structural genomics, PSI-2, structure initiative, midwest center for structural genomic oxidoreductase; 2.20A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3hcz_A Possible thiol-disulfide isomerase; APC61559.2, cytophaga hutchinsoni structural genomics, PSI-2, protein structure initiative; 1.88A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} | Back alignment and structure |
|---|
| >3ic4_A Glutaredoxin (GRX-1); structural genomics, PSI, MCSG, protein structure initiative, midwest center for structural genomic oxidoreductase; 1.70A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3ewl_A Uncharacterized conserved protein BF1870; alpha-beta fold, structural genomics, PSI-2, protein structu initiative; 2.00A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3fk8_A Disulphide isomerase; APC61824.1, xylella fastidiosa temecul structural genomics, PSI-2, protein structure initiative; 1.30A {Xylella fastidiosa} | Back alignment and structure |
|---|
| >3erw_A Sporulation thiol-disulfide oxidoreductase A; thioredoxin-like fold, RESA-like fold, dithiol, STOA, redox-active center; 2.50A {Bacillus subtilis} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >2b1k_A Thiol:disulfide interchange protein DSBE; C-terminal thioredoxin-like domain, N-terminal beta-sheet, fingerprint rigion, oxidoreductase; 1.90A {Escherichia coli} PDB: 3k8n_A 2g0f_A 1z5y_E 2b1l_A | Back alignment and structure |
|---|
| >3h79_A Thioredoxin-like protein; thioredoxin fold, catalytic cysteines missing, unknown funct; 1.50A {Trypanosoma cruzi} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >1fov_A Glutaredoxin 3, GRX3; active site disulfide, CIS Pro 53, electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 3grx_A* | Back alignment and structure |
|---|
| >3aps_A DNAJ homolog subfamily C member 10; thioredoxin fold, CXXC motif, endoplasmic reticulum, oxidore; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >3ph9_A Anterior gradient protein 3 homolog; thioredoxin fold, protein disulfide isomerase, endoplasmic R isomerase; 1.83A {Homo sapiens} SCOP: c.47.1.0 PDB: 2lns_A 2lnt_A | Back alignment and structure |
|---|
| >3fw2_A Thiol-disulfide oxidoreductase; structural genomics, APC61456.1, thiol-disulfide oxidoreduct TLPA-like family, PSI-2; 1.74A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2dj3_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1wjk_A C330018D20RIK protein; glutaredoxin, thioredoxin fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >1ttz_A Conserved hypothetical protein; structural genomics, unknown function, PSI, protein structure initiative; 2.11A {Xanthomonas campestris} SCOP: c.47.1.1 PDB: 1xpv_A | Back alignment and structure |
|---|
| >3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* | Back alignment and structure |
|---|
| >3gl3_A Putative thiol:disulfide interchange protein DSBE; oxidoreductase, PSI-II, structural genomics, protein structure initiative; 2.09A {Chlorobium tepidum tls} | Back alignment and structure |
|---|
| >2ywi_A Hypothetical conserved protein; uncharacterized conserved protein, NPPSFA, national project protein structural and functional analyses; 1.60A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
| >3kcm_A Thioredoxin family protein; SGX, thioredoxin protein, PSI, structural genomics, protein initiative; 2.45A {Geobacter metallireducens gs-15} | Back alignment and structure |
|---|
| >2k8s_A Thioredoxin; dimer, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Nitrosomonas europaea} | Back alignment and structure |
|---|
| >3kh7_A Thiol:disulfide interchange protein DSBE; TRX-like, thiol-disulfide exchange, cell inner membrane, CYT C-type biogenesis, disulfide bond; 1.75A {Pseudomonas aeruginosa} PDB: 3kh9_A | Back alignment and structure |
|---|
| >2av4_A Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECIFIC 15KD prote structural genomics, structural genomics consortium, SGC, U function; 1.73A {Plasmodium yoelii} | Back alignment and structure |
|---|
| >2klx_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Bartonella henselae} | Back alignment and structure |
|---|
| >1kte_A Thioltransferase; redox-active center, electron transport, acetylation; 2.20A {Sus scrofa} SCOP: c.47.1.1 PDB: 1jhb_A 1b4q_A* | Back alignment and structure |
|---|
| >2ht9_A Glutaredoxin-2; thioredoxin fold, iron-sulfur cluster, 2Fe2S, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: GSH; 1.90A {Homo sapiens} PDB: 2fls_A* | Back alignment and structure |
|---|
| >2dbc_A PDCL2, unnamed protein product; phosducin-like protein, thioredoxin_FOLD, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2djj_A PDI, protein disulfide-isomerase; thioredoxin fold; NMR {Humicola insolens} SCOP: c.47.1.2 PDB: 2kp1_A | Back alignment and structure |
|---|
| >3c1r_A Glutaredoxin-1; oxidized form, oxidoreductase, cytoplasm, electron transport, redox-active center, transport; HET: MES; 2.00A {Saccharomyces cerevisiae} PDB: 3c1s_A* 2jac_A* | Back alignment and structure |
|---|
| >2hze_A Glutaredoxin-1; thioredoxin fold, arsenic, dimethylarsenite., electron trans oxidoreductase; 1.80A {Ectromelia virus} PDB: 2hzf_A 2hze_B | Back alignment and structure |
|---|
| >2dlx_A UBX domain-containing protein 7; UAS domain, protein KIAA0794, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: c.47.1.24 | Back alignment and structure |
|---|
| >2r2j_A Thioredoxin domain-containing protein 4; CRFS motif, chaperone, endoplasmic reticulum, S response; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3eur_A Uncharacterized protein; PSI2,MCSG, conserved protein, structural genomics, protein S initiative, midwest center for structural genomics; HET: MSE; 1.30A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2djk_A PDI, protein disulfide-isomerase; thioredoxin fold; NMR {Humicola insolens} SCOP: c.47.1.2 PDB: 2kp2_A | Back alignment and structure |
|---|
| >2ggt_A SCO1 protein homolog, mitochondrial; copper chaperone, Cu-binding protein, mitochondrial assembly factor, redox, nickel, disuplhide, mitochondrion; 2.40A {Homo sapiens} SCOP: c.47.1.10 PDB: 2gqk_A 2gql_A 2gqm_A 2gt5_A 2gt6_A 2gvp_A 2hrf_A 2hrn_A 1wp0_A | Back alignment and structure |
|---|
| >3f8u_A Protein disulfide-isomerase A3ERP57; endoplasmic reticulum, glycoprotein, immunoglobulin domain, microsome, protein disulfide isomerase, thioredoxin-like FO like domain; HET: NAG; 2.60A {Homo sapiens} PDB: 2dmm_A 2alb_A | Back alignment and structure |
|---|
| >2cvb_A Probable thiol-disulfide isomerase/thioredoxin; redox protein, structural genomics, riken struc genomics/proteomics initiative, RSGI; 1.80A {Thermus thermophilus} SCOP: c.47.1.10 PDB: 2ywo_A | Back alignment and structure |
|---|
| >2yan_A Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3qmx_A Glutaredoxin A, glutaredoxin 3; electron transport; 1.82A {Synechocystis SP} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >3nzn_A Glutaredoxin; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics, rossmann fold; 1.10A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3u5r_E Uncharacterized protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, hypothetical protein; 2.05A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1a8l_A Protein disulfide oxidoreductase; PDI, thioredoxin fold; 1.90A {Pyrococcus furiosus} SCOP: c.47.1.2 c.47.1.2 PDB: 1j08_A | Back alignment and structure |
|---|
| >2f51_A Thioredoxin; electron transport; 1.90A {Trichomonas vaginalis} | Back alignment and structure |
|---|
| >3evi_A Phosducin-like protein 2; alpha beta, 3-layer(ABA) sandwich, unknown function; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3cmi_A Peroxiredoxin HYR1; thioredoxin-like fold, oxidoreductase, peroxidase, redox-ACT center; 2.02A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2cq9_A GLRX2 protein, glutaredoxin 2; glutathione-S-transferase, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wou_A Thioredoxin -related protein, 14 kDa; electron transport; 1.80A {Homo sapiens} SCOP: c.47.1.16 PDB: 1v9w_A | Back alignment and structure |
|---|
| >3rhb_A ATGRXC5, glutaredoxin-C5, chloroplastic; thioredoxin fold, thiol-disulfide oxidoreductase, glutaredox oxidoreductase; HET: GSH; 1.20A {Arabidopsis thaliana} PDB: 3rhc_A* 3fz9_A* 3fza_A* | Back alignment and structure |
|---|
| >2khp_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Brucella melitensis} | Back alignment and structure |
|---|
| >2lrt_A Uncharacterized protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, nysgrc, PSI-biology; NMR {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >3us3_A Calsequestrin-1; calcium-binding protein; 1.74A {Oryctolagus cuniculus} PDB: 1a8y_A 3v1w_A* 3trq_A* 3trp_A* 3uom_A | Back alignment and structure |
|---|
| >2hyx_A Protein DIPZ; thioredoxin fold, jelly-roll, structural genomics, TB struct genomics consortium, TBSGC, unknown function; 1.90A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2axo_A Hypothetical protein ATU2684; alpha beta protein., structural genomics, PSI, protein struc initiative; 1.80A {Agrobacterium tumefaciens str} SCOP: c.47.1.19 | Back alignment and structure |
|---|
| >4fo5_A Thioredoxin-like protein; AHPC/TSA family protein, structural genomics, joint center F structural genomics, JCSG; 2.02A {Parabacteroides distasonis} | Back alignment and structure |
|---|
| >2vup_A Glutathione peroxidase-like protein; oxidoreductase, trypanothione, dithiol-dependant peroxidase; 2.10A {Trypanosoma brucei} | Back alignment and structure |
|---|
| >2rli_A SCO2 protein homolog, mitochondrial; copper protein, thioredoxin fold, metal transport, structural genomics, spine2-complexes; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3lwa_A Secreted thiol-disulfide isomerase; thioredoxin, PSI, MCSG, structural genomics, midwest center for structural genomics; 1.75A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >2b5e_A Protein disulfide-isomerase; 2.40A {Saccharomyces cerevisiae} SCOP: c.47.1.2 c.47.1.2 c.47.1.2 c.47.1.2 PDB: 3boa_A | Back alignment and structure |
|---|
| >2ywm_A Glutaredoxin-like protein; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 2.30A {Aquifex aeolicus} PDB: 2ayt_A | Back alignment and structure |
|---|
| >2lqo_A Putative glutaredoxin RV3198.1/MT3292; TRX fold, oxidoreductase; NMR {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3ctg_A Glutaredoxin-2; reduced form, electron transport, mitochondrion, redox-activ transit peptide, transport, oxidoreductase; 1.50A {Saccharomyces cerevisiae} PDB: 3ctf_A 3d4m_A 3d5j_A* | Back alignment and structure |
|---|
| >3q6o_A Sulfhydryl oxidase 1; protein disulfide isomerase, thioredoxin, thioredoxin fold, oxidoreductase, reductive methylation; HET: MLY; 2.05A {Homo sapiens} | Back alignment and structure |
|---|
| >3h8q_A Thioredoxin reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC, developmental protein, differentiation; 2.21A {Homo sapiens} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >1sji_A Calsequestrin 2, calsequestrin, cardiac muscle isoform; glycoprotein, calcium-binding, muscle protein, metal binding protein; 2.40A {Canis lupus familiaris} PDB: 2vaf_A | Back alignment and structure |
|---|
| >2fgx_A Putative thioredoxin; NET3, NESG, GFT-glutaredoxin-like, structural genomics, PSI, protein structure initiative; NMR {Nitrosomonas europaea} | Back alignment and structure |
|---|
| >2trc_P Phosducin, MEKA, PP33; transducin, beta-gamma, signal transduction, regulation, phosphorylation, G proteins, thioredoxin, vision; 2.40A {Rattus norvegicus} SCOP: c.47.1.6 | Back alignment and structure |
|---|
| >3ed3_A Protein disulfide-isomerase MPD1; thioredoxin-like domain, CXXC, endoplasmic reticulum, glycoprotein, redox-active center; 2.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A | Back alignment and structure |
|---|
| >2v1m_A Glutathione peroxidase; selenium, selenocysteine, oxidoreductase, lipid peroxidase, schistosoma detoxification pathway; 1.00A {Schistosoma mansoni} PDB: 2wgr_A | Back alignment and structure |
|---|
| >1sen_A Thioredoxin-like protein P19; endoplasmic reticulum, RP19, structural genomics, PSI, protein structure initiative; 1.20A {Homo sapiens} SCOP: c.47.1.1 PDB: 2k8v_A | Back alignment and structure |
|---|
| >2qc7_A ERP31, ERP28, endoplasmic reticulum protein ERP29; B domain (residues 33-153), D domain (residues 154-261), CHA; 2.90A {Homo sapiens} PDB: 1g7e_A 1g7d_A | Back alignment and structure |
|---|
| >3ira_A Conserved protein; methanosarcina mazei,structural genomics, MCSG, protein structure initiative, midwest center for STRU genomics; 2.10A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >1t1v_A SH3BGRL3, SH3 domain-binding glutamic acid-rich protein-LIK; glutaredoxin, thioredoxin fold, protein 3D-structure, X-RAY crystallography; 1.60A {Mus musculus} SCOP: c.47.1.14 PDB: 1j0f_A 1sj6_A | Back alignment and structure |
|---|
| >1wik_A Thioredoxin-like protein 2; picot homology 2 domain, picot protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >1we0_A Alkyl hydroperoxide reductase C; peroxiredoxin, AHPC, oxidoreductase; 2.90A {Amphibacillus xylanus} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >3tdg_A DSBG, putative uncharacterized protein; thioredoxin fold, reductase, oxidoreductase; HET: P6G; 2.10A {Helicobacter pylori} | Back alignment and structure |
|---|
| >3t58_A Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2.40A {Mus musculus} PDB: 3t59_A* | Back alignment and structure |
|---|
| >3ipz_A Monothiol glutaredoxin-S14, chloroplastic; electron transport, PL redox-active center, transit peptide, transport, oxidoreduc; 2.40A {Arabidopsis thaliana} PDB: 2lku_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 160 | ||||
| d1beda_ | 181 | c.47.1.13 (A:) Disulfide-bond formation facilitato | 4e-06 | |
| d1z6ma1 | 172 | c.47.1.13 (A:1-172) Hypothetical protein EF0770 {E | 3e-04 |
| >d1beda_ c.47.1.13 (A:) Disulfide-bond formation facilitator (DsbA) {Vibrio cholerae [TaxId: 666]} Length = 181 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Thioredoxin fold superfamily: Thioredoxin-like family: DsbA-like domain: Disulfide-bond formation facilitator (DsbA) species: Vibrio cholerae [TaxId: 666]
Score = 42.3 bits (98), Expect = 4e-06
Identities = 9/38 (23%), Positives = 16/38 (42%)
Query: 111 GVYATPTFFVNGFSLAGAGSPLDYNGWRKVIDPLLSEK 148
G+ P VN L S + + +++ LL+ K
Sbjct: 144 GLTGVPAVVVNNRYLVQGQSVKSLDEYFDLVNYLLTLK 181
|
| >d1z6ma1 c.47.1.13 (A:1-172) Hypothetical protein EF0770 {Enterococcus faecalis [TaxId: 1351]} Length = 172 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 160 | |||
| d1beda_ | 181 | Disulfide-bond formation facilitator (DsbA) {Vibri | 99.41 | |
| d1fvka_ | 188 | Disulfide-bond formation facilitator (DsbA) {Esche | 99.21 | |
| d1un2a_ | 195 | Disulfide-bond formation facilitator (DsbA) {Esche | 99.12 | |
| d1z6ma1 | 172 | Hypothetical protein EF0770 {Enterococcus faecalis | 99.03 | |
| d1eeja1 | 156 | Disulfide bond isomerase, DsbC, C-terminal domain | 98.84 | |
| d1t3ba1 | 150 | Disulfide bond isomerase, DsbC, C-terminal domain | 98.75 | |
| d1r4wa_ | 221 | Mitochondrial class kappa glutathione S-transferas | 98.46 | |
| d1v58a1 | 169 | Thiol:disulfide interchange protein DsbG, C-termin | 98.25 | |
| d1nhoa_ | 85 | MTH807, thioredoxin/glutaredoxin-like protein {Arc | 97.05 | |
| d2trxa_ | 108 | Thioredoxin {Escherichia coli [TaxId: 562]} | 97.03 | |
| d1hyua4 | 96 | Alkyl hydroperoxide reductase subunit F (AhpF), N- | 96.99 | |
| d1fo5a_ | 85 | MJ0307, thioredoxin/glutaredoxin-like protein {Arc | 96.97 | |
| d1a8la2 | 107 | Protein disulfide isomerase, PDI {Archaeon Pyrococ | 96.93 | |
| d2hfda1 | 132 | Hydrogenase-1 operon protein HyaE {Escherichia col | 96.9 | |
| d1fb6a_ | 104 | Thioredoxin {Spinach (Spinacia oleracea), thioredo | 96.89 | |
| d1thxa_ | 108 | Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} | 96.74 | |
| d2es7a1 | 119 | Hydrogenase-1 operon protein HyaE {Salmonella typh | 96.73 | |
| d1nw2a_ | 105 | Thioredoxin {Alicyclobacillus acidocaldarius, form | 96.66 | |
| d1dbya_ | 107 | Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305 | 96.45 | |
| d2ifqa1 | 105 | Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} | 96.42 | |
| d1xfla_ | 114 | Thioredoxin {Thale cress (Arabidopsis thaliana) [T | 96.39 | |
| d1ep7a_ | 112 | Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305 | 96.25 | |
| d1zmaa1 | 115 | Bacterocin transport accessory protein Bta {Strept | 96.1 | |
| d1knga_ | 144 | Thioredoxin-like protein CcmG (CycY, DsbE) {Bradyr | 95.81 | |
| d1f9ma_ | 112 | Thioredoxin {Spinach (Spinacia oleracea), thioredo | 95.74 | |
| d1gh2a_ | 107 | Thioredoxin-like protein, N-terminal domain {Human | 95.68 | |
| d1syra_ | 103 | Thioredoxin {Malarial parasite (Plasmodium falcipa | 95.57 | |
| d1ti3a_ | 113 | Thioredoxin {European aspen (Populus tremula), thi | 95.34 | |
| d1r26a_ | 113 | Thioredoxin {Trypanosoma brucei [TaxId: 5691]} | 95.28 | |
| d2fwha1 | 117 | Thiol:disulfide interchange protein DsbD, C-termin | 95.27 | |
| d1xwaa_ | 111 | Thioredoxin {Fruit fly (Drosophila melanogaster) [ | 95.02 | |
| d1z5ye1 | 136 | Thioredoxin-like protein CcmG (CycY, DsbE) {Escher | 94.96 | |
| d1iloa_ | 77 | MTH985, a thioredoxin {Archaeon Methanobacterium t | 94.88 | |
| d1a8ya1 | 124 | Calsequestrin {Rabbit (Oryctolagus cuniculus) [Tax | 94.69 | |
| d2b5xa1 | 143 | thiol:disulfide oxidoreductase YkuV {Bacillus subt | 93.86 | |
| d1zzoa1 | 134 | Lipoprotein DsbF {Mycobacterium tuberculosis [TaxI | 93.66 | |
| d1lu4a_ | 134 | Soluble secreted antigen MPT53 {Mycobacterium tube | 93.47 | |
| d2b5ea4 | 119 | Protein disulfide isomerase, PDI {Baker's yeast (S | 93.36 | |
| d2fy6a1 | 143 | Peptide methionine sulfoxide reductase MsrA/MsrB, | 93.34 | |
| d1meka_ | 120 | Protein disulfide isomerase, PDI {Human (Homo sapi | 92.42 | |
| d1qgva_ | 137 | spliceosomal protein U5-15Kd {Human (Homo sapiens) | 92.3 | |
| d1egoa_ | 85 | Glutaredoxin (Grx, thioltransferase) {Escherichia | 92.06 | |
| d1st9a_ | 137 | Thiol-disulfide oxidoreductase ResA {Bacillus subt | 91.7 | |
| d1r7ha_ | 74 | Glutaredoxin-like NRDH-redoxin {Corynebacterium am | 91.55 | |
| d2cvba1 | 187 | Probable thiol-disulfide isomerase/thioredoxin TTH | 91.05 | |
| d1wjka_ | 100 | Thioredoxin-like structure containing protein C330 | 91.01 | |
| d2djja1 | 116 | Protein disulfide isomerase, PDI {Fungi (Humicola | 90.63 | |
| d2b5ea1 | 140 | Protein disulfide isomerase, PDI {Baker's yeast (S | 89.53 | |
| d2axoa1 | 225 | Hypothetical protein Atu2684 {Agrobacterium tumefa | 88.71 | |
| d2dlxa1 | 147 | UBX domain-containing protein 7 {Human (Homo sapie | 87.72 | |
| d1woua_ | 119 | Putative 42-9-9 protein (thioredoxin containing pr | 87.34 | |
| d1fova_ | 82 | Glutaredoxin (Grx, thioltransferase) {Escherichia | 86.17 | |
| d2c0ga2 | 122 | Windbeutel, N-terminal domain {Fruit fly (Drosophi | 85.14 | |
| d1jfua_ | 176 | Membrane-anchored thioredoxin-like protein TlpA, s | 82.43 | |
| d1h75a_ | 76 | Glutaredoxin-like NRDH-redoxin {Escherichia coli [ | 81.72 |
| >d1beda_ c.47.1.13 (A:) Disulfide-bond formation facilitator (DsbA) {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Thioredoxin fold superfamily: Thioredoxin-like family: DsbA-like domain: Disulfide-bond formation facilitator (DsbA) species: Vibrio cholerae [TaxId: 666]
Probab=99.41 E-value=8.6e-13 Score=97.02 Aligned_cols=77 Identities=18% Similarity=0.235 Sum_probs=66.5
Q ss_pred HHHHHHHhhcCCChhHHHHcccCChhHHHHHHHHHHHhhcCCccccceEEECCEEecCCCCCCCHHHHHHHHHHHhhhc
Q 031378 70 EIVKFAAEGIGNSYSSALESGFSDRSTDLLTRVSFKFSATRGVYATPTFFVNGFSLAGAGSPLDYNGWRKVIDPLLSEK 148 (160)
Q Consensus 70 ~la~~A~~~~Gld~~~~f~~~l~~~~~~~~i~~~~k~a~~~GV~GTPTffING~~~~ga~s~~~~e~~~~~Id~~l~~~ 148 (160)
.+...+.+ .|+| .++|.+|++++++.+.++.+.+.+++.||+|||||+|||+.+.+..+..++++|.++|+.++..|
T Consensus 105 ~l~~~~~~-~gvd-~~~~~~~~~~~~~~~~v~~~~~~~~~~gi~gTPt~~InGk~~v~~~~~~~~~~l~~~i~~L~~~~ 181 (181)
T d1beda_ 105 ELRQIFLD-EGID-AAKFDAAYNGFAVDSMVRRFDKQFQDSGLTGVPAVVVNNRYLVQGQSVKSLDEYFDLVNYLLTLK 181 (181)
T ss_dssp HHHHHHHT-TTCC-HHHHHHHHTSHHHHHHHHHHHHHHHHHTCCSSSEEEETTTEEECGGGCCSHHHHHHHHHHHHHCC
T ss_pred HHHHHHHH-hcCC-HHHHHHHHhChHHHHHHHHHHHHHHHhCCccccEEEECCEEeeCCCCCCCHHHHHHHHHHHHhCc
Confidence 35555555 5999 59999999999999999999999999999999999999997656556677999999999988754
|
| >d1fvka_ c.47.1.13 (A:) Disulfide-bond formation facilitator (DsbA) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1un2a_ c.47.1.13 (A:) Disulfide-bond formation facilitator (DsbA) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1z6ma1 c.47.1.13 (A:1-172) Hypothetical protein EF0770 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1eeja1 c.47.1.9 (A:61-216) Disulfide bond isomerase, DsbC, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1t3ba1 c.47.1.9 (A:61-210) Disulfide bond isomerase, DsbC, C-terminal domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1r4wa_ c.47.1.13 (A:) Mitochondrial class kappa glutathione S-transferase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1v58a1 c.47.1.9 (A:62-230) Thiol:disulfide interchange protein DsbG, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nhoa_ c.47.1.1 (A:) MTH807, thioredoxin/glutaredoxin-like protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d2trxa_ c.47.1.1 (A:) Thioredoxin {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1hyua4 c.47.1.2 (A:103-198) Alkyl hydroperoxide reductase subunit F (AhpF), N-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1fo5a_ c.47.1.1 (A:) MJ0307, thioredoxin/glutaredoxin-like protein {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1a8la2 c.47.1.2 (A:120-226) Protein disulfide isomerase, PDI {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2hfda1 c.47.1.20 (A:1-132) Hydrogenase-1 operon protein HyaE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1fb6a_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin M [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d1thxa_ c.47.1.1 (A:) Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} | Back information, alignment and structure |
|---|
| >d2es7a1 c.47.1.20 (A:7-125) Hydrogenase-1 operon protein HyaE {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1nw2a_ c.47.1.1 (A:) Thioredoxin {Alicyclobacillus acidocaldarius, formerly Bacillus acidocaldarius [TaxId: 405212]} | Back information, alignment and structure |
|---|
| >d1dbya_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d2ifqa1 c.47.1.1 (A:1-105) Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xfla_ c.47.1.1 (A:) Thioredoxin {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1ep7a_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1zmaa1 c.47.1.1 (A:1-115) Bacterocin transport accessory protein Bta {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1knga_ c.47.1.10 (A:) Thioredoxin-like protein CcmG (CycY, DsbE) {Bradyrhizobium japonicum [TaxId: 375]} | Back information, alignment and structure |
|---|
| >d1f9ma_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin F [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d1gh2a_ c.47.1.1 (A:) Thioredoxin-like protein, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1syra_ c.47.1.1 (A:) Thioredoxin {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1ti3a_ c.47.1.1 (A:) Thioredoxin {European aspen (Populus tremula), thioredoxin H [TaxId: 113636]} | Back information, alignment and structure |
|---|
| >d1r26a_ c.47.1.1 (A:) Thioredoxin {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d2fwha1 c.47.1.1 (A:428-544) Thiol:disulfide interchange protein DsbD, C-terminal domain (DsbD-gamma) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xwaa_ c.47.1.1 (A:) Thioredoxin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1z5ye1 c.47.1.10 (E:49-184) Thioredoxin-like protein CcmG (CycY, DsbE) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1iloa_ c.47.1.1 (A:) MTH985, a thioredoxin {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1a8ya1 c.47.1.3 (A:3-126) Calsequestrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d2b5xa1 c.47.1.10 (A:1-143) thiol:disulfide oxidoreductase YkuV {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1zzoa1 c.47.1.10 (A:45-178) Lipoprotein DsbF {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1lu4a_ c.47.1.10 (A:) Soluble secreted antigen MPT53 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2b5ea4 c.47.1.2 (A:23-141) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2fy6a1 c.47.1.10 (A:33-175) Peptide methionine sulfoxide reductase MsrA/MsrB, N-terminal domain {Neisseria meningitidis serogroup A [TaxId: 65699]} | Back information, alignment and structure |
|---|
| >d1meka_ c.47.1.2 (A:) Protein disulfide isomerase, PDI {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qgva_ c.47.1.8 (A:) spliceosomal protein U5-15Kd {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1egoa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1st9a_ c.47.1.10 (A:) Thiol-disulfide oxidoreductase ResA {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1r7ha_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Corynebacterium ammoniagenes [TaxId: 1697]} | Back information, alignment and structure |
|---|
| >d2cvba1 c.47.1.10 (A:2-188) Probable thiol-disulfide isomerase/thioredoxin TTHA0593 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1wjka_ c.47.1.1 (A:) Thioredoxin-like structure containing protein C330018D20Rik {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2djja1 c.47.1.2 (A:6-121) Protein disulfide isomerase, PDI {Fungi (Humicola insolens) [TaxId: 34413]} | Back information, alignment and structure |
|---|
| >d2b5ea1 c.47.1.2 (A:365-504) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2axoa1 c.47.1.19 (A:38-262) Hypothetical protein Atu2684 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d2dlxa1 c.47.1.24 (A:1-147) UBX domain-containing protein 7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1woua_ c.47.1.16 (A:) Putative 42-9-9 protein (thioredoxin containing protein Txnl5) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fova_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli, Grx3 [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2c0ga2 c.47.1.7 (A:1024-1145) Windbeutel, N-terminal domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1jfua_ c.47.1.10 (A:) Membrane-anchored thioredoxin-like protein TlpA, soluble domain {Bradyrhizobium japonicum [TaxId: 375]} | Back information, alignment and structure |
|---|
| >d1h75a_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|