Citrus Sinensis ID: 031383

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160
MNTNERRVVVAVDESEESMHALSWCLNNLFSPDTNNTLVLLYVKPPLPVHSSFDAAGYIFSNDVIKAVEKYASESVNSVMNRAEAVYRNFQNNIHVKRVVGCGDAKDVICGTVEKLEADTLVMGSHGYGFIKRALLGSVSDYCAKHVKCPVVIVKHPEEN
ccccccEEEEEEcccHHHHHHHHHHHHHccccccccEEEEEEEEcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEEccHHHHHHHHHHHccccEEEEcccccccccccEEccHHHHHHccccccEEEEcccccc
ccccccEEEEEEcccHHHHHHHHHHHHHHHccccccEEEEEEEccccccccccccccccccHHHHHHHHHHHcccHHHHHHHHHHHHHHccccEEEEEEEEEccHHHHHHHHHHHccccEEEEEcccccHHHHHHHccccHHHHccccccEEEEEccccc
MNTNERRVVVAVDESEESMHALSWCLNnlfspdtnnTLVLLyvkpplpvhssfdaagyifsNDVIKAVEKYASESVNSVMNRAEAVYRNfqnnihvkrvvgcgdakdvICGTVEKLEADTLVMGSHGYGFIKRALLgsvsdycakhvkcpvvivkhpeen
MNTNERRVVVAVDESEESMHALSWCLNNLFSPDTNNTLVLLYVKPPLPVHSSFDAAGYIFSNDVIKAVEKYASESVNSVMNRAEAVYRNFQNNIHVKRVVGCGDAKDVICGTVEKLEADTLVMGSHGYGFIKRALLGSVSDYCAKHVkcpvvivkhpeen
MNTNERRVVVAVDESEESMHALSWCLNNLFSPDTNNTlvllyvkpplpvHSSFDAAGYIFSNDVIKAVEKYASESVNSVMNRAEAVYRNFQNNIHVKRVVGCGDAKDVICGTVEKLEADTLVMGSHGYGFIKRALLGSVSDYCAKHVKCPVVIVKHPEEN
******************MHALSWCLNNLFSPDTNNTLVLLYVKPPLPVHSSFDAAGYIFSNDVIKAVEKYASESVNSVMNRAEAVYRNFQNNIHVKRVVGCGDAKDVICGTVEKLEADTLVMGSHGYGFIKRALLGSVSDYCAKHVKCPVVIVK*****
***NERRVVVAVDESEESMHALSWCLNNLFSPDTNNTLVLLYVKPPLPVHSSFDAAGYIFSNDVIKAVEKYASESVNSVMNRAEAVYRNFQNNIHVKRVVGCGDAKDVICGTVEKLEADTLVMGSHGYGFIKRALLGSVSDYCAKHVKCPV**VKH****
********VVAVDESEESMHALSWCLNNLFSPDTNNTLVLLYVKPPLPVHSSFDAAGYIFSNDVIKAVEKYASESVNSVMNRAEAVYRNFQNNIHVKRVVGCGDAKDVICGTVEKLEADTLVMGSHGYGFIKRALLGSVSDYCAKHVKCPVVIVKHPEEN
****ERRVVVAVDESEESMHALSWCLNNLFSPDTNNTLVLLYVKPPLPVHSSFDAAGYIFSNDVIKAVEKYASESVNSVMNRAEAVYRNFQNNIHVKRVVGCGDAKDVICGTVEKLEADTLVMGSHGYGFIKRALLGSVSDYCAKHVKCPVVIVKH****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNTNERRVVVAVDESEESMHALSWCLNNLFSPDTNNTLVLLYVKPPLPVHSSFDAAGYIFSNDVIKAVEKYASESVNSVMNRAEAVYRNFQNNIHVKRVVGCGDAKDVICGTVEKLEADTLVMGSHGYGFIKRALLGSVSDYCAKHVKCPVVIVKHPEEN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query160 2.2.26 [Sep-21-2011]
Q8LGG8175 Universal stress protein no no 0.906 0.828 0.281 2e-10
P74148154 Universal stress protein N/A no 0.887 0.922 0.246 7e-06
Q57951170 Universal stress protein yes no 0.868 0.817 0.256 8e-06
Q57997162 Universal stress protein no no 0.568 0.561 0.302 9e-05
P64922 295 Universal stress protein yes no 0.818 0.444 0.266 0.0006
P64921 295 Universal stress protein yes no 0.818 0.444 0.266 0.0006
>sp|Q8LGG8|USPAL_ARATH Universal stress protein A-like protein OS=Arabidopsis thaliana GN=At3g01520 PE=1 SV=2 Back     alignment and function desciption
 Score = 64.7 bits (156), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 49/174 (28%), Positives = 84/174 (48%), Gaps = 29/174 (16%)

Query: 1   MNTNERRVVVAVDESE---------ESMHALSWCLNNLFSPDTNN-TLVLLYVKPPLPVH 50
           M +   +V+VAV+ S              A  W L  +   +T++  ++LL+V+      
Sbjct: 1   MGSEPTKVMVAVNASTIKDYPNPSISCKRAFEWTLEKIVRSNTSDFKILLLHVQ------ 54

Query: 51  SSFDAAGYIFSNDVIKAVEKYASESVNSVMNRAEAVY--RNFQNNIHVKRVVGC------ 102
              D  G+   + +  + E +     +   N+A+ ++    F N  H +  VGC      
Sbjct: 55  -VVDEDGFDDVDSIYASPEDFRDMRQS---NKAKGLHLLEFFVNKCH-EIGVGCEAWIKT 109

Query: 103 GDAKDVICGTVEKLEADTLVMGSHGYGFIKRALLGSVSDYCAKHVKCPVVIVKH 156
           GD KDVIC  V+++  D LV+GS G G  ++  +G+VS +C KH +CPV+ +K 
Sbjct: 110 GDPKDVICQEVKRVRPDFLVVGSRGLGRFQKVFVGTVSAFCVKHAECPVMTIKR 163

Arabidopsis thaliana (taxid: 3702)
>sp|P74148|Y1388_SYNY3 Universal stress protein Sll1388 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll1388 PE=3 SV=1 Back     alignment and function description
>sp|Q57951|Y531_METJA Universal stress protein MJ0531 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0531 PE=3 SV=1 Back     alignment and function description
>sp|Q57997|Y577_METJA Universal stress protein MJ0577 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0577 PE=1 SV=1 Back     alignment and function description
>sp|P64922|Y2028_MYCBO Universal stress protein Mb2028c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb2028c PE=3 SV=1 Back     alignment and function description
>sp|P64921|Y2005_MYCTU Universal stress protein Rv2005c/MT2061 OS=Mycobacterium tuberculosis GN=Rv2005c PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query160
255548479161 conserved hypothetical protein [Ricinus 0.962 0.956 0.733 3e-63
224128352164 predicted protein [Populus trichocarpa] 0.975 0.951 0.698 3e-58
449469038167 PREDICTED: universal stress protein MJ05 0.95 0.910 0.712 6e-58
225437541171 PREDICTED: universal stress protein A-li 0.975 0.912 0.689 1e-57
118489951179 unknown [Populus trichocarpa x Populus d 0.975 0.871 0.679 2e-57
224068508179 predicted protein [Populus trichocarpa] 0.975 0.871 0.679 3e-57
147811185171 hypothetical protein VITISV_016798 [Viti 0.95 0.888 0.688 5e-55
297817586162 universal stress protein family protein 0.993 0.981 0.637 2e-54
15228790162 putative adenine nucleotide alpha hydrol 0.987 0.975 0.632 5e-54
357442279158 Universal stress protein A-like protein 0.975 0.987 0.654 8e-54
>gi|255548479|ref|XP_002515296.1| conserved hypothetical protein [Ricinus communis] gi|223545776|gb|EEF47280.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
 Score =  246 bits (627), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 113/154 (73%), Positives = 136/154 (88%)

Query: 4   NERRVVVAVDESEESMHALSWCLNNLFSPDTNNTLVLLYVKPPLPVHSSFDAAGYIFSND 63
            ER+++VAVDES+ESM ALSWCL NL SP++++TLVLLYVKPP PV+S+FDAAGY+FS D
Sbjct: 8   KERKILVAVDESKESMTALSWCLKNLVSPNSSSTLVLLYVKPPPPVYSAFDAAGYLFSGD 67

Query: 64  VIKAVEKYASESVNSVMNRAEAVYRNFQNNIHVKRVVGCGDAKDVICGTVEKLEADTLVM 123
           VI A+EKY+ + +NSVM RAEAVY+N  +N+ ++RVVG GDAKDVIC +VEKL ADTLVM
Sbjct: 68  VISAMEKYSKDLINSVMERAEAVYKNSISNVKIERVVGSGDAKDVICNSVEKLRADTLVM 127

Query: 124 GSHGYGFIKRALLGSVSDYCAKHVKCPVVIVKHP 157
           GSH YGF+KR LLGSVSDYCA+HVKCPVVIVKHP
Sbjct: 128 GSHDYGFLKRTLLGSVSDYCARHVKCPVVIVKHP 161

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224128352|ref|XP_002320308.1| predicted protein [Populus trichocarpa] gi|118487703|gb|ABK95676.1| unknown [Populus trichocarpa] gi|222861081|gb|EEE98623.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449469038|ref|XP_004152228.1| PREDICTED: universal stress protein MJ0531-like [Cucumis sativus] gi|449524130|ref|XP_004169076.1| PREDICTED: universal stress protein MJ0531-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|225437541|ref|XP_002275863.1| PREDICTED: universal stress protein A-like protein [Vitis vinifera] Back     alignment and taxonomy information
>gi|118489951|gb|ABK96772.1| unknown [Populus trichocarpa x Populus deltoides] Back     alignment and taxonomy information
>gi|224068508|ref|XP_002302760.1| predicted protein [Populus trichocarpa] gi|222844486|gb|EEE82033.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147811185|emb|CAN63475.1| hypothetical protein VITISV_016798 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297817586|ref|XP_002876676.1| universal stress protein family protein [Arabidopsis lyrata subsp. lyrata] gi|297322514|gb|EFH52935.1| universal stress protein family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15228790|ref|NP_191814.1| putative adenine nucleotide alpha hydrolase domain-containing universal stress protein [Arabidopsis thaliana] gi|14334946|gb|AAK59650.1| unknown protein [Arabidopsis thaliana] gi|16323382|gb|AAL15185.1| unknown protein [Arabidopsis thaliana] gi|332646842|gb|AEE80363.1| putative adenine nucleotide alpha hydrolase domain-containing universal stress protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|357442279|ref|XP_003591417.1| Universal stress protein A-like protein [Medicago truncatula] gi|355480465|gb|AES61668.1| Universal stress protein A-like protein [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query160
TAIR|locus:2096089162 AT3G62550 "AT3G62550" [Arabido 0.956 0.944 0.581 1.5e-42
TAIR|locus:2076381204 AT3G58450 "AT3G58450" [Arabido 0.975 0.764 0.349 2.4e-21
TAIR|locus:2043273162 AT2G47710 "AT2G47710" [Arabido 0.925 0.913 0.379 8e-21
TAIR|locus:2081531226 AT3G11930 "AT3G11930" [Arabido 0.787 0.557 0.326 1.4e-20
TAIR|locus:2024291171 AT1G09740 "AT1G09740" [Arabido 0.937 0.877 0.388 9.2e-20
TAIR|locus:2199282160 AT1G68300 "AT1G68300" [Arabido 0.918 0.918 0.331 9.8e-16
TAIR|locus:2200036242 AT1G11360 [Arabidopsis thalian 0.35 0.231 0.491 5.2e-15
TAIR|locus:2131719260 PHOS34 "AT4G27320" [Arabidopsi 0.418 0.257 0.410 9.7e-15
TAIR|locus:2147319242 PHOS32 "AT5G54430" [Arabidopsi 0.418 0.276 0.391 3.8e-14
TAIR|locus:2084525160 AT3G53990 "AT3G53990" [Arabido 0.95 0.95 0.283 9.1e-13
TAIR|locus:2096089 AT3G62550 "AT3G62550" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 450 (163.5 bits), Expect = 1.5e-42, P = 1.5e-42
 Identities = 89/153 (58%), Positives = 113/153 (73%)

Query:     3 TNERRVVVAVDESEESMHALSWCLNNLFSPDTNNTXXXXXXXXXXXXHSSFDAAGYIFSN 62
             T ER++VVAVDESEESM ALSW L+NLF   +NNT            +SS DAAG+I + 
Sbjct:     4 TKERKIVVAVDESEESMEALSWSLDNLFPYGSNNTLILLYVKPPLPVYSSLDAAGFIVTG 63

Query:    63 DVIKAVEKYASESVNSVMNRAEAVYRNFQNNIHVKRVVGCGDAKDVICGTVEKLEADTLV 122
             D + A++KY  E V SVM R+  VY++++++I+++R VG GDAK+VIC  V+KL  D LV
Sbjct:    64 DPVAALKKYEYELVESVMARSRTVYQDYESDINIERRVGRGDAKEVICNAVQKLRVDMLV 123

Query:   123 MGSHGYGFIKRALLGSVSDYCAKHVKCPVVIVK 155
             MG+H YGF KRALLGSVS+YCAK VKCPVVIVK
Sbjct:   124 MGTHDYGFFKRALLGSVSEYCAKRVKCPVVIVK 156
GO:0003674 "molecular_function" evidence=ND
GO:0005634 "nucleus" evidence=ISM
GO:0005773 "vacuole" evidence=IDA
GO:0002238 "response to molecule of fungal origin" evidence=RCA
TAIR|locus:2076381 AT3G58450 "AT3G58450" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2043273 AT2G47710 "AT2G47710" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2081531 AT3G11930 "AT3G11930" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2024291 AT1G09740 "AT1G09740" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2199282 AT1G68300 "AT1G68300" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2200036 AT1G11360 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2131719 PHOS34 "AT4G27320" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2147319 PHOS32 "AT5G54430" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2084525 AT3G53990 "AT3G53990" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.00140672
SubName- Full=Putative uncharacterized protein; (164 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query160
pfam00582139 pfam00582, Usp, Universal stress protein family 3e-28
cd00293130 cd00293, USP_Like, Usp: Universal stress protein f 2e-27
COG0589154 COG0589, UspA, Universal stress protein UspA and r 1e-15
cd01989146 cd01989, STK_N, The N-terminal domain of Eukaryoti 2e-08
cd01988132 cd01988, Na_H_Antiporter_C, The C-terminal domain 2e-06
PRK15005144 PRK15005, PRK15005, universal stress protein F; Pr 3e-04
>gnl|CDD|216006 pfam00582, Usp, Universal stress protein family Back     alignment and domain information 
 Score =  101 bits (253), Expect = 3e-28
 Identities = 47/150 (31%), Positives = 71/150 (47%), Gaps = 13/150 (8%)

Query: 6   RRVVVAVDESEESMHALSWCLNNLFSPDTNNTLVLLYVKPPLPVHSSFDAAGYIFSNDVI 65
           +R++VAVD SEES  AL W L           L+LL+V  P        AA      +  
Sbjct: 3   KRILVAVDGSEESERALEWALELAKRRGA--ELILLHVIDP----EPSGAASEALEEEEE 56

Query: 66  KAVEKYASESVNSVMNRAEAVYRNFQNNIHVKRVVGCGDAKDVICGTVEKLEADTLVMGS 125
           + +E+  +E                   + V+ VV  GD  + I    E+ +AD +VMGS
Sbjct: 57  EELEEEEAE-------AEALAAAAEAGGVVVEVVVRGGDPAEAILEVAEEEDADLIVMGS 109

Query: 126 HGYGFIKRALLGSVSDYCAKHVKCPVVIVK 155
            G   ++R LLGSV++   +H  CPV++V+
Sbjct: 110 RGRSGLRRLLLGSVAEKVLRHAPCPVLVVR 139

The universal stress protein UspA is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents. UspA enhances the rate of cell survival during prolonged exposure to such conditions, and may provide a general "stress endurance" activity. The crystal structure of Haemophilus influenzae UspA reveals an alpha/beta fold similar to that of the Methanococcus jannaschii MJ0577 protein, which binds ATP, though UspA lacks ATP-binding activity. Length = 139
>gnl|CDD|238182 cd00293, USP_Like, Usp: Universal stress protein family Back     alignment and domain information
>gnl|CDD|223662 COG0589, UspA, Universal stress protein UspA and related nucleotide-binding proteins [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|238947 cd01989, STK_N, The N-terminal domain of Eukaryotic Serine Threonine kinases Back     alignment and domain information
>gnl|CDD|238946 cd01988, Na_H_Antiporter_C, The C-terminal domain of a subfamily of Na+ /H+ antiporter existed in bacteria and archea Back     alignment and domain information
>gnl|CDD|184967 PRK15005, PRK15005, universal stress protein F; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 160
PRK15456142 universal stress protein UspG; Provisional 99.96
PRK15005144 universal stress protein F; Provisional 99.96
cd01989146 STK_N The N-terminal domain of Eukaryotic Serine T 99.95
PRK09982142 universal stress protein UspD; Provisional 99.95
PRK15118144 universal stress global response regulator UspA; P 99.94
PF00582140 Usp: Universal stress protein family; InterPro: IP 99.94
PRK10116142 universal stress protein UspC; Provisional 99.94
cd01988132 Na_H_Antiporter_C The C-terminal domain of a subfa 99.93
PRK11175 305 universal stress protein UspE; Provisional 99.92
cd01987124 USP_OKCHK USP domain is located between the N-term 99.92
PRK11175305 universal stress protein UspE; Provisional 99.89
cd00293130 USP_Like Usp: Universal stress protein family. The 99.88
COG0589154 UspA Universal stress protein UspA and related nuc 99.87
PRK12652 357 putative monovalent cation/H+ antiporter subunit E 99.71
PRK10490 895 sensor protein KdpD; Provisional 99.54
COG2205 890 KdpD Osmosensitive K+ channel histidine kinase [Si 99.48
cd0198486 AANH_like Adenine nucleotide alpha hydrolases supe 98.75
PLN03159 832 cation/H(+) antiporter 15; Provisional 98.39
PLN03159832 cation/H(+) antiporter 15; Provisional 97.88
TIGR02432189 lysidine_TilS_N tRNA(Ile)-lysidine synthetase, N-t 97.55
PF01171182 ATP_bind_3: PP-loop family; InterPro: IPR011063 Th 97.32
cd01992185 PP-ATPase N-terminal domain of predicted ATPase of 97.09
PRK10696258 tRNA 2-thiocytidine biosynthesis protein TtcA; Pro 96.73
cd01993185 Alpha_ANH_like_II This is a subfamily of Adenine n 96.37
COG0041162 PurE Phosphoribosylcarboxyaminoimidazole (NCAIR) m 96.32
COG0037 298 MesJ tRNA(Ile)-lysidine synthase MesJ [Cell cycle 96.23
PRK12342 254 hypothetical protein; Provisional 95.24
PRK14665 360 mnmA tRNA-specific 2-thiouridylase MnmA; Provision 95.2
TIGR01162156 purE phosphoribosylaminoimidazole carboxylase, Pur 95.19
PF01012164 ETF: Electron transfer flavoprotein domain; InterP 95.15
TIGR00591 454 phr2 photolyase PhrII. All proteins in this family 95.1
PF00731150 AIRC: AIR carboxylase; InterPro: IPR000031 Phospho 94.73
PF00875165 DNA_photolyase: DNA photolyase from Prosite.; Inte 94.47
PRK05253 301 sulfate adenylyltransferase subunit 2; Provisional 94.19
PRK13820 394 argininosuccinate synthase; Provisional 94.03
PRK10660 436 tilS tRNA(Ile)-lysidine synthetase; Provisional 93.97
TIGR00268252 conserved hypothetical protein TIGR00268. The N-te 93.96
PRK03359 256 putative electron transfer flavoprotein FixA; Revi 93.71
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 93.48
COG2086 260 FixA Electron transfer flavoprotein, beta subunit 93.32
TIGR02765 429 crypto_DASH cryptochrome, DASH family. Photolyases 92.48
KOG1650769 consensus Predicted K+/H+-antiporter [Inorganic io 92.11
PF02601 319 Exonuc_VII_L: Exonuclease VII, large subunit; Inte 90.73
PRK14664 362 tRNA-specific 2-thiouridylase MnmA; Provisional 90.49
cd01995169 ExsB ExsB is a transcription regulator related pro 90.06
PF03652135 UPF0081: Uncharacterised protein family (UPF0081); 89.79
COG1606 269 ATP-utilizing enzymes of the PP-loop superfamily [ 89.74
COG0299200 PurN Folate-dependent phosphoribosylglycinamide fo 89.44
TIGR03556 471 photolyase_8HDF deoxyribodipyrimidine photo-lyase, 89.18
PF02568197 ThiI: Thiamine biosynthesis protein (ThiI); InterP 89.04
TIGR02039 294 CysD sulfate adenylyltransferase, small subunit. I 88.83
cd0556599 PTS_IIB_lactose PTS_IIB_lactose: subunit IIB of en 88.83
COG0541 451 Ffh Signal recognition particle GTPase [Intracellu 88.58
PRK00109138 Holliday junction resolvase-like protein; Reviewed 88.56
TIGR0085395 pts-lac PTS system, lactose/cellobiose family IIB 88.27
PLN00200 404 argininosuccinate synthase; Provisional 87.76
PLN02948577 phosphoribosylaminoimidazole carboxylase 87.64
PRK00286 438 xseA exodeoxyribonuclease VII large subunit; Revie 87.22
cd01713173 PAPS_reductase This domain is found in phosphoaden 85.6
PRK00143 346 mnmA tRNA-specific 2-thiouridylase MnmA; Reviewed 85.43
COG1570 440 XseA Exonuclease VII, large subunit [DNA replicati 84.82
cd01990202 Alpha_ANH_like_I This is a subfamily of Adenine nu 84.72
cd01712177 ThiI ThiI is required for thiazole synthesis in th 84.47
PRK12563 312 sulfate adenylyltransferase subunit 2; Provisional 84.41
TIGR00237 432 xseA exodeoxyribonuclease VII, large subunit. This 84.3
PRK10867 433 signal recognition particle protein; Provisional 83.95
), forming GARS-AIRS-GART. This entry represents the N-domain, which is related to the N-terminal domain of biotin carboxylase/carbamoyl phosphate synthetase (IPR005481 from INTERPRO).; GO: 0004637 phosphoribosylamine-glycine ligase activity, 0009113 purine base biosynthetic process; PDB: 3MJF_A 2XD4_A 2XCL_A 2IP4_A 2YW2_B 2YYA_A 3LP8_A 1VKZ_A 2YS6_A 2YRX_A ...." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF02844">PF02844100 GARS_N: Phosphoribosylglycinamide synthetase, N do 83.87
TIGR00250130 RNAse_H_YqgF RNAse H-fold protein YqgF. This prote 83.83
PRK11914 306 diacylglycerol kinase; Reviewed 83.57
TIGR00342371 thiazole biosynthesis/tRNA modification protein Th 83.42
PRK09590104 celB cellobiose phosphotransferase system IIB comp 83.18
cd0556496 PTS_IIB_chitobiose_lichenan PTS_IIB_chitobiose_lic 82.86
TIGR00032 394 argG argininosuccinate synthase. argG in bacteria, 82.63
PRK05579 399 bifunctional phosphopantothenoylcysteine decarboxy 82.25
PRK11070 575 ssDNA exonuclease RecJ; Provisional 82.04
TIGR01425 429 SRP54_euk signal recognition particle protein SRP5 81.67
COG1597 301 LCB5 Sphingosine kinase and enzymes related to euk 81.56
TIGR02852187 spore_dpaB dipicolinic acid synthetase, B subunit. 81.49
PRK02929 499 L-arabinose isomerase; Provisional 81.49
TIGR01769 205 GGGP geranylgeranylglyceryl phosphate synthase. Th 81.38
TIGR00930 953 2a30 K-Cl cotransporter. 81.04
TIGR02113177 coaC_strep phosphopantothenoylcysteine decarboxyla 80.62
PRK13982 475 bifunctional SbtC-like/phosphopantothenoylcysteine 80.56
COG1646 240 Predicted phosphate-binding enzymes, TIM-barrel fo 80.48
>PRK15456 universal stress protein UspG; Provisional Back     alignment and domain information 
Probab=99.96  E-value=1.7e-28  Score=160.18  Aligned_cols=139  Identities=23%  Similarity=0.272  Sum_probs=108.2

Q ss_pred             ceEEEEEecCCh--HHHHHHHHHHHhcCCCCCCCeEEEEEEeCCCCCCcCCCCCCcccchhHHHHHHHHHHHHHHHHHHH
Q 031383            5 ERRVVVAVDESE--ESMHALSWCLNNLFSPDTNNTLVLLYVKPPLPVHSSFDAAGYIFSNDVIKAVEKYASESVNSVMNR   82 (160)
Q Consensus         5 ~~~Ilv~~d~s~--~s~~al~~a~~~a~~~~~~a~l~~l~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   82 (160)
                      |++||+|+|||+  .+..|+++|..+|+. .  ++++++||+++..... ..   .  .........+...+..++.++.
T Consensus         2 ~~~ILv~vD~S~~~~s~~al~~A~~la~~-~--~~l~llhv~~~~~~~~-~~---~--~~~~~~~~~~~~~~~~~~~l~~   72 (142)
T PRK15456          2 YKTIIMPVDVFEMELSDKAVRHAEFLAQD-D--GVIHLLHVLPGSASLS-LH---R--FAADVRRFEEHLQHEAEERLQT   72 (142)
T ss_pred             CccEEEeccCCchhHHHHHHHHHHHHHhc-C--CeEEEEEEecCccccc-cc---c--cccchhhHHHHHHHHHHHHHHH
Confidence            699999999994  899999999999986 4  5999999997653211 00   0  0011122334444555555666


Q ss_pred             HHHHHHhcCCcceEEEEEecCChhhHHHHHhhhhCCCEEEEeecCCcccceeeccchhHHHhhcCCCCEEEec
Q 031383           83 AEAVYRNFQNNIHVKRVVGCGDAKDVICGTVEKLEADTLVMGSHGYGFIKRALLGSVSDYCAKHVKCPVVIVK  155 (160)
Q Consensus        83 ~~~~~~~~~~~~~~~~~~~~g~~~~~i~~~a~~~~~dllvig~~~~~~~~~~~~gs~~~~ll~~~~~pVlvv~  155 (160)
                      +.+.+...+  +++++++..|++.+.|+++++++++||||||+++++ +.++++||++++++++++||||+||
T Consensus        73 ~~~~~~~~~--~~v~~~v~~G~~~~~I~~~a~~~~~DLIVmG~~g~~-~~~~llGS~a~~v~~~a~~pVLvV~  142 (142)
T PRK15456         73 MVSHFTIDP--SRIKQHVRFGSVRDEVNELAEELGADVVVIGSRNPS-ISTHLLGSNASSVIRHANLPVLVVR  142 (142)
T ss_pred             HHHHhCCCC--cceEEEEcCCChHHHHHHHHhhcCCCEEEEcCCCCC-ccceecCccHHHHHHcCCCCEEEeC
Confidence            655554444  788899999999999999999999999999999976 7888999999999999999999996

>PRK15005 universal stress protein F; Provisional Back     alignment and domain information
>cd01989 STK_N The N-terminal domain of Eukaryotic Serine Threonine kinases Back     alignment and domain information
>PRK09982 universal stress protein UspD; Provisional Back     alignment and domain information
>PRK15118 universal stress global response regulator UspA; Provisional Back     alignment and domain information
>PF00582 Usp: Universal stress protein family; InterPro: IPR006016 The universal stress protein UspA P28242 from SWISSPROT [] is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents Back     alignment and domain information
>PRK10116 universal stress protein UspC; Provisional Back     alignment and domain information
>cd01988 Na_H_Antiporter_C The C-terminal domain of a subfamily of Na+ /H+ antiporter existed in bacteria and archea Back     alignment and domain information
>PRK11175 universal stress protein UspE; Provisional Back     alignment and domain information
>cd01987 USP_OKCHK USP domain is located between the N-terminal sensor domain and C-terminal catalytic domain of this Osmosensitive K+ channel histidine kinase family Back     alignment and domain information
>PRK11175 universal stress protein UspE; Provisional Back     alignment and domain information
>cd00293 USP_Like Usp: Universal stress protein family Back     alignment and domain information
>COG0589 UspA Universal stress protein UspA and related nucleotide-binding proteins [Signal transduction mechanisms] Back     alignment and domain information
>PRK12652 putative monovalent cation/H+ antiporter subunit E; Reviewed Back     alignment and domain information
>PRK10490 sensor protein KdpD; Provisional Back     alignment and domain information
>COG2205 KdpD Osmosensitive K+ channel histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd01984 AANH_like Adenine nucleotide alpha hydrolases superfamily including N type ATP PPases, ATP sulphurylases Universal Stress Response protein and electron transfer flavoprotein (ETF) Back     alignment and domain information
>PLN03159 cation/H(+) antiporter 15; Provisional Back     alignment and domain information
>PLN03159 cation/H(+) antiporter 15; Provisional Back     alignment and domain information
>TIGR02432 lysidine_TilS_N tRNA(Ile)-lysidine synthetase, N-terminal domain Back     alignment and domain information
>PF01171 ATP_bind_3: PP-loop family; InterPro: IPR011063 This entry represents the PP-loop motif superfamily [,] Back     alignment and domain information
>cd01992 PP-ATPase N-terminal domain of predicted ATPase of the PP-loop faimly implicated in cell cycle control [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK10696 tRNA 2-thiocytidine biosynthesis protein TtcA; Provisional Back     alignment and domain information
>cd01993 Alpha_ANH_like_II This is a subfamily of Adenine nucleotide alpha hydrolases superfamily Back     alignment and domain information
>COG0041 PurE Phosphoribosylcarboxyaminoimidazole (NCAIR) mutase [Nucleotide transport and metabolism] Back     alignment and domain information
>COG0037 MesJ tRNA(Ile)-lysidine synthase MesJ [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK12342 hypothetical protein; Provisional Back     alignment and domain information
>PRK14665 mnmA tRNA-specific 2-thiouridylase MnmA; Provisional Back     alignment and domain information
>TIGR01162 purE phosphoribosylaminoimidazole carboxylase, PurE protein Back     alignment and domain information
>PF01012 ETF: Electron transfer flavoprotein domain; InterPro: IPR014730 Electron transfer flavoproteins (ETFs) serve as specific electron acceptors for primary dehydrogenases, transferring the electrons to terminal respiratory systems Back     alignment and domain information
>TIGR00591 phr2 photolyase PhrII Back     alignment and domain information
>PF00731 AIRC: AIR carboxylase; InterPro: IPR000031 Phosphoribosylaminoimidazole carboxylase is a fusion protein in plants and fungi, but consists of two non-interacting proteins in bacteria, PurK and PurE Back     alignment and domain information
>PF00875 DNA_photolyase: DNA photolyase from Prosite Back     alignment and domain information
>PRK05253 sulfate adenylyltransferase subunit 2; Provisional Back     alignment and domain information
>PRK13820 argininosuccinate synthase; Provisional Back     alignment and domain information
>PRK10660 tilS tRNA(Ile)-lysidine synthetase; Provisional Back     alignment and domain information
>TIGR00268 conserved hypothetical protein TIGR00268 Back     alignment and domain information
>PRK03359 putative electron transfer flavoprotein FixA; Reviewed Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>COG2086 FixA Electron transfer flavoprotein, beta subunit [Energy production and conversion] Back     alignment and domain information
>TIGR02765 crypto_DASH cryptochrome, DASH family Back     alignment and domain information
>KOG1650 consensus Predicted K+/H+-antiporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF02601 Exonuc_VII_L: Exonuclease VII, large subunit; InterPro: IPR020579 Exonuclease VII 3 Back     alignment and domain information
>PRK14664 tRNA-specific 2-thiouridylase MnmA; Provisional Back     alignment and domain information
>cd01995 ExsB ExsB is a transcription regulator related protein Back     alignment and domain information
>PF03652 UPF0081: Uncharacterised protein family (UPF0081); InterPro: IPR005227 Holliday junction resolvases (HJRs) are key enzymes of DNA recombination Back     alignment and domain information
>COG1606 ATP-utilizing enzymes of the PP-loop superfamily [General function prediction only] Back     alignment and domain information
>COG0299 PurN Folate-dependent phosphoribosylglycinamide formyltransferase PurN [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR03556 photolyase_8HDF deoxyribodipyrimidine photo-lyase, 8-HDF type Back     alignment and domain information
>PF02568 ThiI: Thiamine biosynthesis protein (ThiI); InterPro: IPR020536 Thiamine pyrophosphate (TPP) is synthesized de novo in many bacteria and is a required cofactor for many enzymes in the cell Back     alignment and domain information
>TIGR02039 CysD sulfate adenylyltransferase, small subunit Back     alignment and domain information
>cd05565 PTS_IIB_lactose PTS_IIB_lactose: subunit IIB of enzyme II (EII) of the lactose-specific phosphoenolpyruvate:carbohydrate phosphotransferase system (PTS) found in Firmicutes as well as Actinobacteria Back     alignment and domain information
>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK00109 Holliday junction resolvase-like protein; Reviewed Back     alignment and domain information
>TIGR00853 pts-lac PTS system, lactose/cellobiose family IIB component Back     alignment and domain information
>PLN00200 argininosuccinate synthase; Provisional Back     alignment and domain information
>PLN02948 phosphoribosylaminoimidazole carboxylase Back     alignment and domain information
>PRK00286 xseA exodeoxyribonuclease VII large subunit; Reviewed Back     alignment and domain information
>cd01713 PAPS_reductase This domain is found in phosphoadenosine phosphosulphate (PAPS) reductase enzymes or PAPS sulphotransferase Back     alignment and domain information
>PRK00143 mnmA tRNA-specific 2-thiouridylase MnmA; Reviewed Back     alignment and domain information
>COG1570 XseA Exonuclease VII, large subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>cd01990 Alpha_ANH_like_I This is a subfamily of Adenine nucleotide alpha hydrolases superfamily Back     alignment and domain information
>cd01712 ThiI ThiI is required for thiazole synthesis in the thiamine biosynthesis pathway Back     alignment and domain information
>PRK12563 sulfate adenylyltransferase subunit 2; Provisional Back     alignment and domain information
>TIGR00237 xseA exodeoxyribonuclease VII, large subunit Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>PF02844 GARS_N: Phosphoribosylglycinamide synthetase, N domain; InterPro: IPR020562 Phosphoribosylglycinamide synthetase (6 Back     alignment and domain information
>TIGR00250 RNAse_H_YqgF RNAse H-fold protein YqgF Back     alignment and domain information
>PRK11914 diacylglycerol kinase; Reviewed Back     alignment and domain information
>TIGR00342 thiazole biosynthesis/tRNA modification protein ThiI Back     alignment and domain information
>PRK09590 celB cellobiose phosphotransferase system IIB component; Reviewed Back     alignment and domain information
>cd05564 PTS_IIB_chitobiose_lichenan PTS_IIB_chitobiose_lichenan: subunit IIB of enzyme II (EII) of the N,N-diacetylchitobiose-specific and lichenan-specific phosphoenolpyruvate:carbohydrate phosphotransferase system (PTS) Back     alignment and domain information
>TIGR00032 argG argininosuccinate synthase Back     alignment and domain information
>PRK05579 bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Validated Back     alignment and domain information
>PRK11070 ssDNA exonuclease RecJ; Provisional Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>COG1597 LCB5 Sphingosine kinase and enzymes related to eukaryotic diacylglycerol kinase [Lipid metabolism / General function prediction only] Back     alignment and domain information
>TIGR02852 spore_dpaB dipicolinic acid synthetase, B subunit Back     alignment and domain information
>PRK02929 L-arabinose isomerase; Provisional Back     alignment and domain information
>TIGR01769 GGGP geranylgeranylglyceryl phosphate synthase Back     alignment and domain information
>TIGR00930 2a30 K-Cl cotransporter Back     alignment and domain information
>TIGR02113 coaC_strep phosphopantothenoylcysteine decarboxylase, streptococcal Back     alignment and domain information
>PRK13982 bifunctional SbtC-like/phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Provisional Back     alignment and domain information
>COG1646 Predicted phosphate-binding enzymes, TIM-barrel fold [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query160
2gm3_A175 Crystal Structure Of An Universal Stress Protein Fa 1e-10
1mjh_A162 Structure-Based Assignment Of The Biochemical Funct 8e-06
1wjg_A137 Crystal Structure Of A Probable Atp Binding Protein 5e-04
>pdb|2GM3|A Chain A, Crystal Structure Of An Universal Stress Protein Family Protein From Arabidopsis Thaliana At3g01520 With Amp Bound Length = 175 Back     alignment and structure 
Iteration: 1

 Score = 62.0 bits (149), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 39/63 (61%), Gaps = 6/63 (9%)
Query: 100 VGC------GDAKDVICGTVEKLEADTLVMGSHGYGFIKRALLGSVSDYCAKHVKCPVVI 153
           VGC      GD KDVIC  V+++  D LV+GS G G  ++  +G+VS +C KH +CPV  
Sbjct: 101 VGCEAWIKTGDPKDVICQEVKRVRPDFLVVGSRGLGRFQKVFVGTVSAFCVKHAECPVXT 160
Query: 154 VKH 156
           +K 
Sbjct: 161 IKR 163
>pdb|1MJH|A Chain A, Structure-Based Assignment Of The Biochemical Function Of Hypothetical Protein Mj0577: A Test Case Of Structural Genomics Length = 162 Back     alignment and structure
>pdb|1WJG|A Chain A, Crystal Structure Of A Probable Atp Binding Protein From Thermus Themophilus Hb8 Length = 137 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query160
2gm3_A175 Unknown protein; AT3G01520, putative ethylene-resp 9e-45
3idf_A138 USP-like protein; universal, stress, PSI, MCSG, st 3e-37
1tq8_A163 Hypothetical protein RV1636; MTCY01B2.28, structur 1e-30
2dum_A170 Hypothetical protein PH0823; conserved hypothetica 3e-30
1mjh_A162 Protein (ATP-binding domain of protein MJ0577); hy 8e-30
2z08_A137 Universal stress protein family; uncharacterized c 3e-27
3s3t_A146 Nucleotide-binding protein, universal stress PROT 1e-26
3hgm_A147 Universal stress protein TEAD; rossman fold, signa 4e-26
3tnj_A150 Universal stress protein (USP); structural genomic 2e-24
3fdx_A143 Putative filament protein / universal stress PROT; 8e-24
3loq_A 294 Universal stress protein; structural genomics, PSI 2e-22
3loq_A294 Universal stress protein; structural genomics, PSI 2e-21
1jmv_A141 USPA, universal stress protein A; chaperone; 1.85A 4e-22
3fg9_A156 Protein of universal stress protein USPA family; A 2e-21
3dlo_A155 Universal stress protein; unknown function, struct 6e-21
3olq_A319 Universal stress protein E; structural genomics, P 5e-19
3olq_A 319 Universal stress protein E; structural genomics, P 2e-16
3cis_A 309 Uncharacterized protein; alpha/beta hydrolase, ATP 2e-18
3cis_A309 Uncharacterized protein; alpha/beta hydrolase, ATP 2e-15
3ab8_A 268 Putative uncharacterized protein TTHA0350; tandem- 3e-17
3ab8_A268 Putative uncharacterized protein TTHA0350; tandem- 2e-12
3mt0_A290 Uncharacterized protein PA1789; structural genomic 4e-15
3mt0_A 290 Uncharacterized protein PA1789; structural genomic 4e-10
1q77_A138 Hypothetical protein AQ_178; structural genomics, 2e-09
>2gm3_A Unknown protein; AT3G01520, putative ethylene-responsive protein, USP domain, nucleotide binding domain, AMP; HET: MSE AMP; 2.46A {Arabidopsis thaliana} SCOP: c.26.2.4 Length = 175 Back     alignment and structure
 Score =  144 bits (364), Expect = 9e-45
 Identities = 38/165 (23%), Positives = 71/165 (43%), Gaps = 13/165 (7%)

Query: 6   RRVVVAVDESE---------ESMHALSWCLNNLFSP-DTNNTLVLLYVKPPLPVHSSFDA 55
            +V+VAV+ S              A  W L  +     ++  ++LL+V+         D 
Sbjct: 6   TKVMVAVNASTIKDYPNPSISCKRAFEWTLEKIVRSNTSDFKILLLHVQVV-DEDGFDDV 64

Query: 56  AGYIFSNDVIKAVEKYASESVNSVMNRAEAVYRNFQNNIHVKRVVGCGDAKDVICGTVEK 115
                S +  + + +        ++          +  +  +  +  GD KDVIC  V++
Sbjct: 65  DSIYASPEDFRDMRQSNKAKGLHLLEFFVNKCH--EIGVGCEAWIKTGDPKDVICQEVKR 122

Query: 116 LEADTLVMGSHGYGFIKRALLGSVSDYCAKHVKCPVVIVKHPEEN 160
           +  D LV+GS G G  ++  +G+VS +C KH +CPV+ +K   + 
Sbjct: 123 VRPDFLVVGSRGLGRFQKVFVGTVSAFCVKHAECPVMTIKRNADE 167
>3idf_A USP-like protein; universal, stress, PSI, MCSG, structural genomics, midwest center for structural genomics structure initiative; 2.00A {Wolinella succinogenes} Length = 138 Back     alignment and structure
>1tq8_A Hypothetical protein RV1636; MTCY01B2.28, structural target, NYSGXRC, PSI, protein structure initiative; 2.40A {Mycobacterium tuberculosis} SCOP: c.26.2.4 Length = 163 Back     alignment and structure
>2dum_A Hypothetical protein PH0823; conserved hypothetical protein, putative universal protein A structural genomics, NPPSFA; 2.75A {Pyrococcus horikoshii} Length = 170 Back     alignment and structure
>1mjh_A Protein (ATP-binding domain of protein MJ0577); hypothetical protein, structural genomics, functional assignment; HET: ATP; 1.70A {Methanocaldococcus jannaschii} SCOP: c.26.2.4 Length = 162 Back     alignment and structure
>2z08_A Universal stress protein family; uncharacterized conserved protein, structural genomics, unknown function, NPPSFA; HET: ATP; 1.55A {Thermus thermophilus} SCOP: c.26.2.4 PDB: 1wjg_A* 2z09_A* 2z3v_A Length = 137 Back     alignment and structure
>3s3t_A Nucleotide-binding protein, universal stress PROT family; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: ATP; 1.90A {Lactobacillus plantarum} Length = 146 Back     alignment and structure
>3hgm_A Universal stress protein TEAD; rossman fold, signaling protein; HET: ATP; 1.90A {Halomonas elongata} Length = 147 Back     alignment and structure
>3tnj_A Universal stress protein (USP); structural genomics, PSI-biology, midwest center for structu genomics, MCSG, chaperone; HET: AMP; 2.00A {Nitrosomonas europaea} PDB: 2pfs_A* Length = 150 Back     alignment and structure
>3fdx_A Putative filament protein / universal stress PROT; structural genomics, APC60640.1, universal protein F, PSI-2; HET: MSE ATP; 1.58A {Klebsiella pneumoniae subsp} PDB: 3fh0_A* Length = 143 Back     alignment and structure
>3loq_A Universal stress protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: AMP; 2.32A {Archaeoglobus fulgidus} Length = 294 Back     alignment and structure
>3loq_A Universal stress protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: AMP; 2.32A {Archaeoglobus fulgidus} Length = 294 Back     alignment and structure
>1jmv_A USPA, universal stress protein A; chaperone; 1.85A {Haemophilus influenzae} SCOP: c.26.2.4 Length = 141 Back     alignment and structure
>3fg9_A Protein of universal stress protein USPA family; APC60691, nucleotide- binding, lactobacillus plantarum WCFS1, structural genomics PSI-2; 1.47A {Lactobacillus plantarum} Length = 156 Back     alignment and structure
>3dlo_A Universal stress protein; unknown function, structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics; HET: MSE; 1.97A {Archaeoglobus fulgidus} PDB: 3qtb_A* Length = 155 Back     alignment and structure
>3olq_A Universal stress protein E; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: UNL; 1.82A {Proteus mirabilis} Length = 319 Back     alignment and structure
>3olq_A Universal stress protein E; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: UNL; 1.82A {Proteus mirabilis} Length = 319 Back     alignment and structure
>3cis_A Uncharacterized protein; alpha/beta hydrolase, ATP, universal stress protein, unknown function; HET: ATP; 2.90A {Mycobacterium tuberculosis} PDB: 2jax_A* Length = 309 Back     alignment and structure
>3cis_A Uncharacterized protein; alpha/beta hydrolase, ATP, universal stress protein, unknown function; HET: ATP; 2.90A {Mycobacterium tuberculosis} PDB: 2jax_A* Length = 309 Back     alignment and structure
>3ab8_A Putative uncharacterized protein TTHA0350; tandem-type universal stress protein, unknown function; HET: ATP; 1.70A {Thermus thermophilus} PDB: 3ab7_A* Length = 268 Back     alignment and structure
>3ab8_A Putative uncharacterized protein TTHA0350; tandem-type universal stress protein, unknown function; HET: ATP; 1.70A {Thermus thermophilus} PDB: 3ab7_A* Length = 268 Back     alignment and structure
>3mt0_A Uncharacterized protein PA1789; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 1.58A {Pseudomonas aeruginosa} Length = 290 Back     alignment and structure
>3mt0_A Uncharacterized protein PA1789; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 1.58A {Pseudomonas aeruginosa} Length = 290 Back     alignment and structure
>1q77_A Hypothetical protein AQ_178; structural genomics, universal stress protein, PSI, protein structure initiative; 2.70A {Aquifex aeolicus} SCOP: c.26.2.4 Length = 138 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query160
1mjh_A162 Protein (ATP-binding domain of protein MJ0577); hy 99.97
3s3t_A146 Nucleotide-binding protein, universal stress PROT 99.97
2dum_A170 Hypothetical protein PH0823; conserved hypothetica 99.97
3idf_A138 USP-like protein; universal, stress, PSI, MCSG, st 99.96
3fg9_A156 Protein of universal stress protein USPA family; A 99.96
3hgm_A147 Universal stress protein TEAD; rossman fold, signa 99.96
1tq8_A163 Hypothetical protein RV1636; MTCY01B2.28, structur 99.96
3dlo_A155 Universal stress protein; unknown function, struct 99.96
2gm3_A175 Unknown protein; AT3G01520, putative ethylene-resp 99.96
3tnj_A150 Universal stress protein (USP); structural genomic 99.95
2z08_A137 Universal stress protein family; uncharacterized c 99.95
3fdx_A143 Putative filament protein / universal stress PROT; 99.95
1jmv_A141 USPA, universal stress protein A; chaperone; 1.85A 99.93
3olq_A 319 Universal stress protein E; structural genomics, P 99.93
3loq_A 294 Universal stress protein; structural genomics, PSI 99.92
3cis_A 309 Uncharacterized protein; alpha/beta hydrolase, ATP 99.92
3mt0_A290 Uncharacterized protein PA1789; structural genomic 99.92
3ab8_A 268 Putative uncharacterized protein TTHA0350; tandem- 99.91
3mt0_A 290 Uncharacterized protein PA1789; structural genomic 99.91
3loq_A294 Universal stress protein; structural genomics, PSI 99.91
1q77_A138 Hypothetical protein AQ_178; structural genomics, 99.9
3cis_A309 Uncharacterized protein; alpha/beta hydrolase, ATP 99.89
3olq_A319 Universal stress protein E; structural genomics, P 99.89
3ab8_A268 Putative uncharacterized protein TTHA0350; tandem- 99.86
3a2k_A 464 TRNA(Ile)-lysidine synthase; ligase, pseudo-knot, 96.93
1wy5_A 317 TILS, hypothetical UPF0072 protein AQ_1887; N-type 96.74
4b4k_A181 N5-carboxyaminoimidazole ribonucleotide mutase; is 96.38
4grd_A173 N5-CAIR mutase, phosphoribosylaminoimidazole carbo 95.93
3oow_A166 Phosphoribosylaminoimidazole carboxylase,catalyic; 95.75
2ywx_A157 Phosphoribosylaminoimidazole carboxylase catalyti; 95.65
3kuu_A174 Phosphoribosylaminoimidazole carboxylase catalyti 95.61
3trh_A169 Phosphoribosylaminoimidazole carboxylase carboxylt 95.57
1xmp_A170 PURE, phosphoribosylaminoimidazole carboxylase; pu 95.5
2iel_A138 Hypothetical protein TT0030; TT0030,thermus thermo 95.44
3lp6_A174 Phosphoribosylaminoimidazole carboxylase catalyti; 95.34
1o4v_A183 Phosphoribosylaminoimidazole mutase PURE; structur 95.33
3ors_A163 N5-carboxyaminoimidazole ribonucleotide mutase; is 95.31
3rg8_A159 Phosphoribosylaminoimidazole carboxylase, PURE PR; 95.14
1u11_A182 PURE (N5-carboxyaminoimidazole ribonucleotide MUT; 95.03
3umv_A 506 Deoxyribodipyrimidine photo-lyase; CPD cyclobutane 94.61
1ni5_A 433 Putative cell cycle protein MESJ; structural genom 94.3
2xry_A 482 Deoxyribodipyrimidine photolyase; DNA damage, DNA 93.78
2wq7_A 543 RE11660P; lyase-DNA complex, DNA repair, DNA lesio 93.72
1zun_A 325 Sulfate adenylyltransferase subunit 2; beta barrel 93.25
3g40_A294 Na-K-CL cotransporter; alpha/beta fold 10-stranded 92.44
1np7_A 489 DNA photolyase; protein with FAD cofactor; HET: DN 92.27
2hma_A 376 Probable tRNA (5-methylaminomethyl-2-thiouridylat 91.93
1iv0_A98 Hypothetical protein; rnaseh-like, YQGF, structura 91.71
2der_A 380 TRNA-specific 2-thiouridylase MNMA; protein-RNA co 91.65
3g40_A 294 Na-K-CL cotransporter; alpha/beta fold 10-stranded 91.51
2nz2_A 413 Argininosuccinate synthase; amino-acid biosynthesi 91.13
3ih5_A217 Electron transfer flavoprotein alpha-subunit; alph 91.06
1k92_A 455 Argininosuccinate synthase, argininosuccinate SY; 90.9
3tqr_A215 Phosphoribosylglycinamide formyltransferase; purin 90.58
2h31_A425 Multifunctional protein ADE2; alpha-beta-alpha, li 89.91
3tvs_A 538 Cryptochrome-1; circadian clock light entrainment, 89.58
2c5s_A413 THII, probable thiamine biosynthesis protein THII; 88.21
3p9x_A211 Phosphoribosylglycinamide formyltransferase; struc 87.81
1o97_C264 Electron transferring flavoprotein beta-subunit; F 87.8
3nbm_A108 PTS system, lactose-specific IIBC components; PTS_ 87.73
1sur_A215 PAPS reductase; assimilatory sulfate reduction, 3- 87.07
1efp_B252 ETF, protein (electron transfer flavoprotein); ele 86.67
1vl2_A 421 Argininosuccinate synthase; TM1780, structural gen 86.22
3kcq_A215 Phosphoribosylglycinamide formyltransferase; struc 85.31
3fy4_A 537 6-4 photolyase; DNA repair, clock cryptochrome; HE 84.64
3da8_A215 Probable 5'-phosphoribosylglycinamide formyltransf 84.41
3bl5_A219 Queuosine biosynthesis protein QUEC; PREQ1 biosynt 84.16
1kor_A 400 Argininosuccinate synthetase; ligase, riken struct 84.08
1u3d_A 509 Cryptochrome 1 apoprotein; photolyase, AMPPNP, sig 83.89
2wsi_A 306 FAD synthetase; transferase, nucleotidyltransferas 83.64
1owl_A 484 Photolyase, deoxyribodipyrimidine photolyase; DNA 83.49
2ywb_A 503 GMP synthase [glutamine-hydrolyzing]; GMP syntheta 83.0
1nu0_A138 Hypothetical protein YQGF; structural genomics, st 82.87
1efv_B255 Electron transfer flavoprotein; electron transport 82.77
2e0i_A 440 432AA long hypothetical deoxyribodipyrimidine PHO; 82.42
1vhx_A150 Putative holliday junction resolvase; structural g 82.24
3s40_A 304 Diacylglycerol kinase; structural genomics, the ce 81.62
3gxq_A54 Putative regulator of transfer genes ARTA; ribbon- 81.42
2pg3_A232 Queuosine biosynthesis protein QUEC; YP_049261.1, 81.2
2qv7_A 337 Diacylglycerol kinase DGKB; alpha-beta domain 1, b 81.11
2j07_A 420 Deoxyribodipyrimidine photo-lyase; flavoprotein, n 80.59
>1mjh_A Protein (ATP-binding domain of protein MJ0577); hypothetical protein, structural genomics, functional assignment; HET: ATP; 1.70A {Methanocaldococcus jannaschii} SCOP: c.26.2.4 Back     alignment and structure
Probab=99.97  E-value=1.1e-29  Score=168.04  Aligned_cols=154  Identities=22%  Similarity=0.231  Sum_probs=120.7

Q ss_pred             CCCCceEEEEEecCChHHHHHHHHHHHhcCCCCCCCeEEEEEEeCCCC----CCcCCCCCCccc-chh--HHHHHHHHHH
Q 031383            1 MNTNERRVVVAVDESEESMHALSWCLNNLFSPDTNNTLVLLYVKPPLP----VHSSFDAAGYIF-SND--VIKAVEKYAS   73 (160)
Q Consensus         1 m~~~~~~Ilv~~d~s~~s~~al~~a~~~a~~~~~~a~l~~l~v~~~~~----~~~~~~~~~~~~-~~~--~~~~~~~~~~   73 (160)
                      |..++++||||+|+|+.+..|+++|+.+|+..+  ++|+++||+++..    ....+....... +..  ......+...
T Consensus         1 M~~~~~~ILv~vD~s~~s~~al~~a~~la~~~~--a~l~ll~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   78 (162)
T 1mjh_A            1 MSVMYKKILYPTDFSETAEIALKHVKAFKTLKA--EEVILLHVIDEREIKKRDIFSLLLGVAGLNKSVEEFENELKNKLT   78 (162)
T ss_dssp             --CCCCEEEEECCSCHHHHHHHHHHHHTCCSSC--CEEEEEEEEEGGGTC-----------------CHHHHHHHHHHHH
T ss_pred             CccccceEEEEeCCCHHHHHHHHHHHHHHhhcC--CeEEEEEEecCccccccccccccccccccccchhhhHHHHHHHHH
Confidence            666789999999999999999999999999988  8999999997541    000110000000 110  0223445555


Q ss_pred             HHHHHHHHHHHHHHHhcCCcceEEEEEecCChhhHHHHHhhhhCCCEEEEeecCCcccceeeccchhHHHhhcCCCCEEE
Q 031383           74 ESVNSVMNRAEAVYRNFQNNIHVKRVVGCGDAKDVICGTVEKLEADTLVMGSHGYGFIKRALLGSVSDYCAKHVKCPVVI  153 (160)
Q Consensus        74 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~i~~~a~~~~~dllvig~~~~~~~~~~~~gs~~~~ll~~~~~pVlv  153 (160)
                      +..++.++.+.+.+...|  +++++.+..|++.+.|+++++++++|+||||+++++++.++++||++++|+++++||||+
T Consensus        79 ~~~~~~l~~~~~~~~~~g--~~~~~~v~~G~~~~~I~~~a~~~~~dlIV~G~~g~~~~~~~~~GSv~~~vl~~~~~pVlv  156 (162)
T 1mjh_A           79 EEAKNKMENIKKELEDVG--FKVKDIIVVGIPHEEIVKIAEDEGVDIIIMGSHGKTNLKEILLGSVTENVIKKSNKPVLV  156 (162)
T ss_dssp             HHHHHHHHHHHHHHHHTT--CEEEEEEEEECHHHHHHHHHHHTTCSEEEEESCCSSCCTTCSSCHHHHHHHHHCCSCEEE
T ss_pred             HHHHHHHHHHHHHHHHcC--CceEEEEcCCCHHHHHHHHHHHcCCCEEEEcCCCCCCccceEecchHHHHHHhCCCCEEE
Confidence            667777888888888888  888888889999999999999999999999999999999999999999999999999999


Q ss_pred             ecCCC
Q 031383          154 VKHPE  158 (160)
Q Consensus       154 v~~~~  158 (160)
                      ||+..
T Consensus       157 v~~~~  161 (162)
T 1mjh_A          157 VKRKN  161 (162)
T ss_dssp             ECCCC
T ss_pred             EeCCC
Confidence            99764
>3s3t_A Nucleotide-binding protein, universal stress PROT family; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: ATP; 1.90A {Lactobacillus plantarum} SCOP: c.26.2.0 Back     alignment and structure
>2dum_A Hypothetical protein PH0823; conserved hypothetical protein, putative universal protein A structural genomics, NPPSFA; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>3idf_A USP-like protein; universal, stress, PSI, MCSG, structural genomics, midwest center for structural genomics structure initiative; 2.00A {Wolinella succinogenes} Back     alignment and structure
>3fg9_A Protein of universal stress protein USPA family; APC60691, nucleotide- binding, lactobacillus plantarum WCFS1, structural genomics PSI-2; 1.47A {Lactobacillus plantarum} Back     alignment and structure
>3hgm_A Universal stress protein TEAD; rossman fold, signaling protein; HET: ATP; 1.90A {Halomonas elongata} SCOP: c.26.2.0 Back     alignment and structure
>1tq8_A Hypothetical protein RV1636; MTCY01B2.28, structural target, NYSGXRC, PSI, protein structure initiative; 2.40A {Mycobacterium tuberculosis} SCOP: c.26.2.4 Back     alignment and structure
>3dlo_A Universal stress protein; unknown function, structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics; HET: MSE; 1.97A {Archaeoglobus fulgidus} PDB: 3qtb_A* Back     alignment and structure
>2gm3_A Unknown protein; AT3G01520, putative ethylene-responsive protein, USP domain, nucleotide binding domain, AMP; HET: MSE AMP; 2.46A {Arabidopsis thaliana} SCOP: c.26.2.4 Back     alignment and structure
>3tnj_A Universal stress protein (USP); structural genomics, PSI-biology, midwest center for structu genomics, MCSG, chaperone; HET: AMP; 2.00A {Nitrosomonas europaea} PDB: 2pfs_A* Back     alignment and structure
>2z08_A Universal stress protein family; uncharacterized conserved protein, structural genomics, unknown function, NPPSFA; HET: ATP; 1.55A {Thermus thermophilus} SCOP: c.26.2.4 PDB: 1wjg_A* 2z09_A* 2z3v_A Back     alignment and structure
>3fdx_A Putative filament protein / universal stress PROT; structural genomics, APC60640.1, universal protein F, PSI-2; HET: MSE ATP; 1.58A {Klebsiella pneumoniae subsp} PDB: 3fh0_A* Back     alignment and structure
>1jmv_A USPA, universal stress protein A; chaperone; 1.85A {Haemophilus influenzae} SCOP: c.26.2.4 Back     alignment and structure
>3olq_A Universal stress protein E; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: UNL; 1.82A {Proteus mirabilis} Back     alignment and structure
>3loq_A Universal stress protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: AMP; 2.32A {Archaeoglobus fulgidus} Back     alignment and structure
>3cis_A Uncharacterized protein; alpha/beta hydrolase, ATP, universal stress protein, unknown function; HET: ATP; 2.90A {Mycobacterium tuberculosis} PDB: 2jax_A* Back     alignment and structure
>3mt0_A Uncharacterized protein PA1789; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 1.58A {Pseudomonas aeruginosa} Back     alignment and structure
>3ab8_A Putative uncharacterized protein TTHA0350; tandem-type universal stress protein, unknown function; HET: ATP; 1.70A {Thermus thermophilus} PDB: 3ab7_A* Back     alignment and structure
>3mt0_A Uncharacterized protein PA1789; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 1.58A {Pseudomonas aeruginosa} Back     alignment and structure
>3loq_A Universal stress protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: AMP; 2.32A {Archaeoglobus fulgidus} Back     alignment and structure
>1q77_A Hypothetical protein AQ_178; structural genomics, universal stress protein, PSI, protein structure initiative; 2.70A {Aquifex aeolicus} SCOP: c.26.2.4 Back     alignment and structure
>3cis_A Uncharacterized protein; alpha/beta hydrolase, ATP, universal stress protein, unknown function; HET: ATP; 2.90A {Mycobacterium tuberculosis} PDB: 2jax_A* Back     alignment and structure
>3olq_A Universal stress protein E; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: UNL; 1.82A {Proteus mirabilis} Back     alignment and structure
>3ab8_A Putative uncharacterized protein TTHA0350; tandem-type universal stress protein, unknown function; HET: ATP; 1.70A {Thermus thermophilus} PDB: 3ab7_A* Back     alignment and structure
>3a2k_A TRNA(Ile)-lysidine synthase; ligase, pseudo-knot, ligase/RNA complex; 3.65A {Geobacillus kaustophilus} Back     alignment and structure
>1wy5_A TILS, hypothetical UPF0072 protein AQ_1887; N-type ATP-ppase, structural genomics, translation, NPPSFA; 2.42A {Aquifex aeolicus} SCOP: c.26.2.5 d.229.1.1 PDB: 2e21_A* 2e89_A* Back     alignment and structure
>4b4k_A N5-carboxyaminoimidazole ribonucleotide mutase; isomerase; 2.50A {Bacillus anthracis} Back     alignment and structure
>4grd_A N5-CAIR mutase, phosphoribosylaminoimidazole carboxylase catalyti; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures; 1.85A {Burkholderia cenocepacia} Back     alignment and structure
>3oow_A Phosphoribosylaminoimidazole carboxylase,catalyic; structural genomics, center for structural genomics of infec diseases, csgid; HET: MSE; 1.75A {Francisella tularensis subsp} SCOP: c.23.8.1 PDB: 3opq_A* Back     alignment and structure
>2ywx_A Phosphoribosylaminoimidazole carboxylase catalyti; rossmann fold, structural genomics, NPPSFA; 2.31A {Methanocaldococcus jannaschii} Back     alignment and structure
>3kuu_A Phosphoribosylaminoimidazole carboxylase catalyti PURE; 3-layer (ABA) sandwich, rossmann fold, csgid, lyase, structu genomics; 1.41A {Yersinia pestis} SCOP: c.23.8.1 PDB: 1d7a_A* 1qcz_A 2ate_A* 2nsl_A* 2nsh_A* 2nsj_A* Back     alignment and structure
>3trh_A Phosphoribosylaminoimidazole carboxylase carboxyltransferase subunit; purines, pyrimidines, nucleosides, nucleotides, lyase; 2.20A {Coxiella burnetii} Back     alignment and structure
>1xmp_A PURE, phosphoribosylaminoimidazole carboxylase; purine biosynthesis, spine, lyase; 1.80A {Bacillus anthracis} SCOP: c.23.8.1 Back     alignment and structure
>2iel_A Hypothetical protein TT0030; TT0030,thermus thermophilus, structural genomics, PSI, protein structure initiative; 1.60A {Thermus thermophilus} SCOP: c.26.2.4 Back     alignment and structure
>3lp6_A Phosphoribosylaminoimidazole carboxylase catalyti; alpha and beta protein, structural genomics, PSI-2, protein initiative; 1.70A {Mycobacterium tuberculosis} SCOP: c.23.8.0 Back     alignment and structure
>1o4v_A Phosphoribosylaminoimidazole mutase PURE; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; 1.77A {Thermotoga maritima} SCOP: c.23.8.1 Back     alignment and structure
>3ors_A N5-carboxyaminoimidazole ribonucleotide mutase; isomerase, isomerase,biosynthetic protein; 1.45A {Staphylococcus aureus subsp} Back     alignment and structure
>3rg8_A Phosphoribosylaminoimidazole carboxylase, PURE PR; purine biosynthesis, lyase; 1.74A {Treponema denticola} SCOP: c.23.8.0 PDB: 3rgg_A* Back     alignment and structure
>1u11_A PURE (N5-carboxyaminoimidazole ribonucleotide MUT; acidophIle, protein stability, lyase; HET: CIT; 1.55A {Acetobacter aceti} SCOP: c.23.8.1 PDB: 2fwj_A* 2fw1_A* 2fwb_A 2fwa_A 2fw9_A 2fw7_A 2fw6_A 2fwp_A* 2fwi_A* 2fw8_A Back     alignment and structure
>3umv_A Deoxyribodipyrimidine photo-lyase; CPD cyclobutane pyrimidine dimers, UV damaged DNA, DNA repai flavoprotein; HET: FAD; 1.71A {Oryza sativa japonica group} Back     alignment and structure
>1ni5_A Putative cell cycle protein MESJ; structural genomics, ATPase, PP-type, putative cell cycle PR PSI, protein structure initiative; 2.65A {Escherichia coli} SCOP: b.153.1.2 c.26.2.5 d.229.1.1 Back     alignment and structure
>2xry_A Deoxyribodipyrimidine photolyase; DNA damage, DNA repair; HET: FAD; 1.50A {Methanosarcina mazei} PDB: 2xrz_A* Back     alignment and structure
>2wq7_A RE11660P; lyase-DNA complex, DNA repair, DNA lesion, lyase; HET: TDY Z FAD; 2.00A {Drosophila melanogaster} PDB: 2wb2_A* 2wq6_A* 3cvu_A* 3cvv_A* 3cvy_A* 3cvw_A* 3cvx_A* Back     alignment and structure
>1zun_A Sulfate adenylyltransferase subunit 2; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae} SCOP: c.26.2.2 Back     alignment and structure
>3g40_A Na-K-CL cotransporter; alpha/beta fold 10-stranded twisted beta sheet, transport protein; 1.90A {Methanosarcina acetivorans} Back     alignment and structure
>1np7_A DNA photolyase; protein with FAD cofactor; HET: DNA FAD; 1.90A {Synechocystis SP} SCOP: a.99.1.1 c.28.1.1 Back     alignment and structure
>2hma_A Probable tRNA (5-methylaminomethyl-2-thiouridylat methyltransferase; alpha-beta, beta barrel, structural genomics, PSI-2; HET: MSE SAM; 2.41A {Streptococcus pneumoniae} Back     alignment and structure
>1iv0_A Hypothetical protein; rnaseh-like, YQGF, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Thermus thermophilus} SCOP: c.55.3.8 Back     alignment and structure
>2der_A TRNA-specific 2-thiouridylase MNMA; protein-RNA complex, transferase/RNA complex; 3.10A {Escherichia coli} PDB: 2det_A 2deu_A* Back     alignment and structure
>3g40_A Na-K-CL cotransporter; alpha/beta fold 10-stranded twisted beta sheet, transport protein; 1.90A {Methanosarcina acetivorans} Back     alignment and structure
>2nz2_A Argininosuccinate synthase; amino-acid biosynthesis, aspartate, citrulline, ST genomics, structural genomics consortium, SGC, ligase; HET: CIR; 2.40A {Homo sapiens} Back     alignment and structure
>3ih5_A Electron transfer flavoprotein alpha-subunit; alpha-beta-alpha sandwich, structural genomics, PSI-2, protein structure initiative; 2.60A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1k92_A Argininosuccinate synthase, argininosuccinate SY; N-type ATP pyrophosphatase, ligase; 1.60A {Escherichia coli} SCOP: c.26.2.1 d.210.1.1 PDB: 1k97_A* 1kp2_A* 1kp3_A* Back     alignment and structure
>3tqr_A Phosphoribosylglycinamide formyltransferase; purines, pyrimidines, nucleosides, nucleotides; HET: NHE; 1.97A {Coxiella burnetii} SCOP: c.65.1.0 Back     alignment and structure
>2h31_A Multifunctional protein ADE2; alpha-beta-alpha, ligase, lyase; 2.80A {Homo sapiens} Back     alignment and structure
>2c5s_A THII, probable thiamine biosynthesis protein THII; RNA-binding protein, RNA binding protein, tRNA modification, 4-thiouridine synthase; HET: AMP; 2.5A {Bacillus anthracis} SCOP: c.26.2.6 d.308.1.1 Back     alignment and structure
>3p9x_A Phosphoribosylglycinamide formyltransferase; structural genomics, PSI-biology, protein STRU initiative; 1.90A {Bacillus halodurans} Back     alignment and structure
>1o97_C Electron transferring flavoprotein beta-subunit; FAD binding; HET: AMP FAD; 1.6A {Methylophilus methylotrophus} SCOP: c.26.2.3 PDB: 1o95_C* 1o96_A* 1o94_C* 3clr_C* 3cls_C* 3clt_C* 3clu_C* Back     alignment and structure
>3nbm_A PTS system, lactose-specific IIBC components; PTS_IIB_LACTOSE, phosphoenolpyruvate:carbohydrate system, P- phosphorylation; HET: MSE; 1.30A {Streptococcus pneumoniae} Back     alignment and structure
>1sur_A PAPS reductase; assimilatory sulfate reduction, 3-phospho-adenylyl-sulfate reductase, oxidoreductase; 2.00A {Escherichia coli} SCOP: c.26.2.2 Back     alignment and structure
>1efp_B ETF, protein (electron transfer flavoprotein); electron transport, glutaric acidemia type II; HET: FAD AMP; 2.60A {Paracoccus denitrificans} SCOP: c.26.2.3 Back     alignment and structure
>1vl2_A Argininosuccinate synthase; TM1780, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics, ligase; 1.65A {Thermotoga maritima} SCOP: c.26.2.1 d.210.1.1 Back     alignment and structure
>3kcq_A Phosphoribosylglycinamide formyltransferase; structural genomics, niaid, seattle structural center for infectious disease, ssgcid; 2.20A {Anaplasma phagocytophilum} SCOP: c.65.1.0 Back     alignment and structure
>3fy4_A 6-4 photolyase; DNA repair, clock cryptochrome; HET: MES FAD; 2.70A {Arabidopsis thaliana} Back     alignment and structure
>3da8_A Probable 5'-phosphoribosylglycinamide formyltransferase PURN; glycinamide ribonucleotide transformylase, structure; 1.30A {Mycobacterium tuberculosis} PDB: 3dcj_A* Back     alignment and structure
>3bl5_A Queuosine biosynthesis protein QUEC; PREQ1 biosynthesis, RNA modification, tRNA, hydrolase; 2.95A {Bacillus subtilis} Back     alignment and structure
>1kor_A Argininosuccinate synthetase; ligase, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: ANP ARG; 1.95A {Thermus thermophilus} SCOP: c.26.2.1 d.210.1.1 PDB: 1j1z_A* 1j21_A* 1kh1_A 1kh2_A* 1kh3_A* 1j20_A* Back     alignment and structure
>1u3d_A Cryptochrome 1 apoprotein; photolyase, AMPPNP, signaling protein; HET: FAD ANP NDS; 2.45A {Arabidopsis thaliana} SCOP: a.99.1.1 c.28.1.1 PDB: 1u3c_A* Back     alignment and structure
>2wsi_A FAD synthetase; transferase, nucleotidyltransferase, nucleotide-binding; HET: FAD; 1.90A {Saccharomyces cerevisiae} Back     alignment and structure
>1owl_A Photolyase, deoxyribodipyrimidine photolyase; DNA repair, flavin enzyme, photoreactivating enzyme; HET: FAD; 1.80A {Synechococcus elongatus} SCOP: a.99.1.1 c.28.1.1 PDB: 1owm_A* 1own_A* 1owo_A* 1owp_A* 1qnf_A* 1tez_A* Back     alignment and structure
>2ywb_A GMP synthase [glutamine-hydrolyzing]; GMP synthetase, XMP binding, ATP binding, purine nucleotide biosynthetic pathway, structural genomics; 2.10A {Thermus thermophilus} PDB: 2ywc_A* Back     alignment and structure
>1nu0_A Hypothetical protein YQGF; structural genomics, structure 2 function project, S2F, unknown function; 1.60A {Escherichia coli} SCOP: c.55.3.8 PDB: 1nmn_A 1ovq_A Back     alignment and structure
>1efv_B Electron transfer flavoprotein; electron transport, glutaric acidemia type II; HET: FAD AMP; 2.10A {Homo sapiens} SCOP: c.26.2.3 PDB: 1t9g_S* 2a1u_B* 2a1t_S* Back     alignment and structure
>2e0i_A 432AA long hypothetical deoxyribodipyrimidine PHO; photolyase, FAD, DNA repair, lyase; HET: FAD; 2.80A {Sulfolobus tokodaii} Back     alignment and structure
>1vhx_A Putative holliday junction resolvase; structural genomics, hydrolase; 1.96A {Bacillus subtilis} SCOP: c.55.3.8 Back     alignment and structure
>3s40_A Diacylglycerol kinase; structural genomics, the center for structural genomics of infectious diseases, csgid, transfer; 2.10A {Bacillus anthracis} PDB: 3t5p_A Back     alignment and structure
>3gxq_A Putative regulator of transfer genes ARTA; ribbon-helix-helix, plasmid, DNA binding protein/DNA complex; HET: DNA; 2.35A {Staphylococcus aureus subsp} Back     alignment and structure
>2pg3_A Queuosine biosynthesis protein QUEC; YP_049261.1, hypothetical protein, structural genomics, JOIN for structural genomics; 2.40A {Pectobacterium atrosepticum SCRI1043} SCOP: c.26.2.1 Back     alignment and structure
>2qv7_A Diacylglycerol kinase DGKB; alpha-beta domain 1, beta sandwich domain 2, protein-ADP COM transferase; HET: ADP; 2.30A {Staphylococcus aureus} SCOP: e.52.1.2 PDB: 2qvl_A Back     alignment and structure
>2j07_A Deoxyribodipyrimidine photo-lyase; flavoprotein, nucleotide-binding, DNA repair; HET: FAD HDF; 1.95A {Thermus thermophilus} SCOP: a.99.1.1 c.28.1.1 PDB: 1iqu_A* 1iqr_A* 2j08_A* 2j09_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 160
d2gm3a1171 c.26.2.4 (A:5-175) Putative ethylene-responsive pr 8e-29
d1mjha_160 c.26.2.4 (A:) "Hypothetical" protein MJ0577 {Archa 4e-23
d1tq8a_147 c.26.2.4 (A:) Hypothetical protein Rv1636 {Mycobac 6e-20
d2z3va1135 c.26.2.4 (A:2-136) Hypothetical protein TTHA0895 { 3e-18
d1jmva_140 c.26.2.4 (A:) Universal stress protein A, UspA {Ha 1e-14
d1q77a_138 c.26.2.4 (A:) Hypothetical protein Aq_178 {Aquifex 2e-11
>d2gm3a1 c.26.2.4 (A:5-175) Putative ethylene-responsive protein AT3g01520/F4P13_7 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 171 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Adenine nucleotide alpha hydrolase-like
superfamily: Adenine nucleotide alpha hydrolases-like
family: Universal stress protein-like
domain: Putative ethylene-responsive protein AT3g01520/F4P13 7
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

 Score =  102 bits (254), Expect = 8e-29
 Identities = 38/165 (23%), Positives = 68/165 (41%), Gaps = 13/165 (7%)

Query: 6   RRVVVAVDESE---------ESMHALSWCLNNLFSP-DTNNTLVLLYVKPPLPVHSSFDA 55
            +V+VAV+ S              A  W L  +     ++  ++LL+V+         D 
Sbjct: 2   TKVMVAVNASTIKDYPNPSISCKRAFEWTLEKIVRSNTSDFKILLLHVQVV-DEDGFDDV 60

Query: 56  AGYIFSNDVIKAVEKYASESVNSVMNRAEAVYRNFQNNIHVKRVVGCGDAKDVICGTVEK 115
                S +  + + +        ++                   +  GD KDVIC  V++
Sbjct: 61  DSIYASPEDFRDMRQSNKAKGLHLLEFFVNKCHEIGVGCEA--WIKTGDPKDVICQEVKR 118

Query: 116 LEADTLVMGSHGYGFIKRALLGSVSDYCAKHVKCPVVIVKHPEEN 160
           +  D LV+GS G G  ++  +G+VS +C KH +CPV+ +K   + 
Sbjct: 119 VRPDFLVVGSRGLGRFQKVFVGTVSAFCVKHAECPVMTIKRNADE 163
>d1mjha_ c.26.2.4 (A:) "Hypothetical" protein MJ0577 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 160 Back     information, alignment and structure
>d1tq8a_ c.26.2.4 (A:) Hypothetical protein Rv1636 {Mycobacterium tuberculosis [TaxId: 1773]} Length = 147 Back     information, alignment and structure
>d2z3va1 c.26.2.4 (A:2-136) Hypothetical protein TTHA0895 {Thermus thermophilus [TaxId: 274]} Length = 135 Back     information, alignment and structure
>d1jmva_ c.26.2.4 (A:) Universal stress protein A, UspA {Haemophilus influenzae [TaxId: 727]} Length = 140 Back     information, alignment and structure
>d1q77a_ c.26.2.4 (A:) Hypothetical protein Aq_178 {Aquifex aeolicus [TaxId: 63363]} Length = 138 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query160
d1mjha_160 "Hypothetical" protein MJ0577 {Archaeon Methanococ 100.0
d2z3va1135 Hypothetical protein TTHA0895 {Thermus thermophilu 99.96
d2gm3a1171 Putative ethylene-responsive protein AT3g01520/F4P 99.96
d1tq8a_147 Hypothetical protein Rv1636 {Mycobacterium tubercu 99.95
d1jmva_140 Universal stress protein A, UspA {Haemophilus infl 99.94
d1q77a_138 Hypothetical protein Aq_178 {Aquifex aeolicus [Tax 99.92
d1wy5a1216 TilS-like protein Aq_1887 {Aquifex aeolicus [TaxId 97.43
d1u11a_159 N5-CAIR mutase (phosphoribosylaminoimidazole carbo 96.37
d1np7a2204 Cryptochrome {Synechocystis sp., pcc 6803 [TaxId: 96.26
d1xmpa_155 N5-CAIR mutase (phosphoribosylaminoimidazole carbo 96.26
d1qcza_163 N5-CAIR mutase (phosphoribosylaminoimidazole carbo 96.16
d1o4va_169 N5-CAIR mutase (phosphoribosylaminoimidazole carbo 95.96
d1ni5a1227 tRNA-Ile-lysidine synthetase, TilS, N-terminal dom 95.83
d2j07a2170 DNA photolyase {Thermus thermophilus [TaxId: 274]} 94.49
d2c5sa1218 Thiamine biosynthesis protein ThiI, C-terminal dom 93.0
d1owla2202 DNA photolyase {Synechococcus elongatus [TaxId: 32 92.47
d3clsc1 262 Small, beta subunit of electron transfer flavoprot 92.3
d1efpb_246 Small, beta subunit of electron transfer flavoprot 91.46
d1s8na_ 190 Probable two-component system transcriptional regu 90.52
d1u3da2185 Cryptochrome {Thale cress (Arabidopsis thaliana) [ 89.75
d2pjua1 186 Propionate catabolism operon regulatory protein Pr 88.94
d1iv0a_98 Hypothetical protein, YqgF homologue {Thermus ther 87.21
d1p3y1_183 MrsD {Bacillus sp. hil-y85/54728 [TaxId: 69002]} 86.61
d1efvb_252 Small, beta subunit of electron transfer flavoprot 86.33
d1ls1a2207 GTPase domain of the signal sequence recognition p 86.1
d1nu0a_138 Hypothetical protein YqgF (RuvX) {Escherichia coli 85.91
d2a9pa1117 DNA-binding response regulator MicA, N-terminal do 85.46
d2bona1 295 Lipid kinase YegS {Escherichia coli [TaxId: 562]} 85.08
d1ccwa_137 Glutamate mutase, small subunit {Clostridium cochl 83.54
d1dnpa2200 DNA photolyase {Escherichia coli [TaxId: 562]} 83.48
d2qv7a1 312 Diacylglycerol kinase DgkB {Staphylococcus aureus 82.53
d1gsoa2105 Glycinamide ribonucleotide synthetase (GAR-syn), N 82.38
d3clsd1192 Large, alpha subunit of electron transfer flavopro 81.71
d7reqa2168 Methylmalonyl-CoA mutase alpha subunit, C-terminal 80.62
d1g2ua_345 3-isopropylmalate dehydrogenase, IPMDH {Thermus th 80.26
d3beda1132 PTS system, IIA subunit {Enterococcus faecalis [Ta 80.04
>d1mjha_ c.26.2.4 (A:) "Hypothetical" protein MJ0577 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Adenine nucleotide alpha hydrolase-like
superfamily: Adenine nucleotide alpha hydrolases-like
family: Universal stress protein-like
domain: "Hypothetical" protein MJ0577
species: Archaeon Methanococcus jannaschii [TaxId: 2190]

Probab=100.00  E-value=6.9e-32  Score=176.84  Aligned_cols=152  Identities=21%  Similarity=0.232  Sum_probs=126.2

Q ss_pred             CceEEEEEecCChHHHHHHHHHHHhcCCCCCCCeEEEEEEeCCCCCCcCCCCC-------CcccchhHHHHHHHHHHHHH
Q 031383            4 NERRVVVAVDESEESMHALSWCLNNLFSPDTNNTLVLLYVKPPLPVHSSFDAA-------GYIFSNDVIKAVEKYASESV   76 (160)
Q Consensus         4 ~~~~Ilv~~d~s~~s~~al~~a~~~a~~~~~~a~l~~l~v~~~~~~~~~~~~~-------~~~~~~~~~~~~~~~~~~~~   76 (160)
                      +++|||||+|+|+.+..+++||..+|+..+  ++|+++||+++..........       .............+...+..
T Consensus         2 m~~~ILvavD~s~~s~~al~~a~~la~~~~--a~l~llhV~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   79 (160)
T d1mjha_           2 MYKKILYPTDFSETAEIALKHVKAFKTLKA--EEVILLHVIDEREIKKRDIFSLLLGVAGLNKSVEEFENELKNKLTEEA   79 (160)
T ss_dssp             CCCEEEEECCSCHHHHHHHHHHHHTCCSSC--CEEEEEEEEEGGGTC-----------------CHHHHHHHHHHHHHHH
T ss_pred             CcCeEEEEECCCHHHHHHHHHHHHHHHhcC--CEEEEEEecccccccccccccccccccccchhHHHHHHHHHHHHHHHH
Confidence            479999999999999999999999999999  899999998665432111100       11122344445556667777


Q ss_pred             HHHHHHHHHHHHhcCCcceEEEEEecCChhhHHHHHhhhhCCCEEEEeecCCcccceeeccchhHHHhhcCCCCEEEecC
Q 031383           77 NSVMNRAEAVYRNFQNNIHVKRVVGCGDAKDVICGTVEKLEADTLVMGSHGYGFIKRALLGSVSDYCAKHVKCPVVIVKH  156 (160)
Q Consensus        77 ~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~i~~~a~~~~~dllvig~~~~~~~~~~~~gs~~~~ll~~~~~pVlvv~~  156 (160)
                      ++.++.+...+.+.|  +.+++.+..|++.+.|++++++.++||||||+++++++.++++||++++|+++++|||||||+
T Consensus        80 ~~~l~~~~~~~~~~g--v~~~~~~~~G~~~~~I~~~a~~~~~dliV~G~~~~~~~~~~~~GS~a~~vl~~s~~pVlvV~~  157 (160)
T d1mjha_          80 KNKMENIKKELEDVG--FKVKDIIVVGIPHEEIVKIAEDEGVDIIIMGSHGKTNLKEILLGSVTENVIKKSNKPVLVVKR  157 (160)
T ss_dssp             HHHHHHHHHHHHHTT--CEEEEEEEEECHHHHHHHHHHHTTCSEEEEESCCSSCCTTCSSCHHHHHHHHHCCSCEEEECC
T ss_pred             HHHHHHHHHHHHhcC--CeEEEEEEeccHHHHHhhhhhccccceEEeccCCCCcccccccCcHHHHHHhcCCCCEEEEcC
Confidence            888888888888888  999999999999999999999999999999999999999999999999999999999999998


Q ss_pred             CCC
Q 031383          157 PEE  159 (160)
Q Consensus       157 ~~~  159 (160)
                      +.+
T Consensus       158 ~~~  160 (160)
T d1mjha_         158 KNS  160 (160)
T ss_dssp             CCC
T ss_pred             CCC
Confidence            753
>d2z3va1 c.26.2.4 (A:2-136) Hypothetical protein TTHA0895 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2gm3a1 c.26.2.4 (A:5-175) Putative ethylene-responsive protein AT3g01520/F4P13_7 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1tq8a_ c.26.2.4 (A:) Hypothetical protein Rv1636 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1jmva_ c.26.2.4 (A:) Universal stress protein A, UspA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1q77a_ c.26.2.4 (A:) Hypothetical protein Aq_178 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1wy5a1 c.26.2.5 (A:1-216) TilS-like protein Aq_1887 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1u11a_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Acetobacter aceti [TaxId: 435]} Back     information, alignment and structure
>d1np7a2 c.28.1.1 (A:1-204) Cryptochrome {Synechocystis sp., pcc 6803 [TaxId: 1143]} Back     information, alignment and structure
>d1xmpa_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Bacillus anthracis [TaxId: 1392]} Back     information, alignment and structure
>d1qcza_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o4va_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ni5a1 c.26.2.5 (A:0-226) tRNA-Ile-lysidine synthetase, TilS, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2j07a2 c.28.1.1 (A:2-171) DNA photolyase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2c5sa1 c.26.2.6 (A:174-391) Thiamine biosynthesis protein ThiI, C-terminal domain {Bacillus anthracis [TaxId: 1392]} Back     information, alignment and structure
>d1owla2 c.28.1.1 (A:3-204) DNA photolyase {Synechococcus elongatus [TaxId: 32046]} Back     information, alignment and structure
>d3clsc1 c.26.2.3 (C:1-262) Small, beta subunit of electron transfer flavoprotein ETFP {Methylophilus methylotrophus [TaxId: 17]} Back     information, alignment and structure
>d1efpb_ c.26.2.3 (B:) Small, beta subunit of electron transfer flavoprotein ETFP {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1s8na_ c.23.1.1 (A:) Probable two-component system transcriptional regulator Rv1626 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1u3da2 c.28.1.1 (A:13-197) Cryptochrome {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2pjua1 c.92.3.1 (A:11-196) Propionate catabolism operon regulatory protein PrpR {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iv0a_ c.55.3.8 (A:) Hypothetical protein, YqgF homologue {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1p3y1_ c.34.1.1 (1:) MrsD {Bacillus sp. hil-y85/54728 [TaxId: 69002]} Back     information, alignment and structure
>d1efvb_ c.26.2.3 (B:) Small, beta subunit of electron transfer flavoprotein ETFP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1nu0a_ c.55.3.8 (A:) Hypothetical protein YqgF (RuvX) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a9pa1 c.23.1.1 (A:2-118) DNA-binding response regulator MicA, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2bona1 e.52.1.2 (A:5-299) Lipid kinase YegS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ccwa_ c.23.6.1 (A:) Glutamate mutase, small subunit {Clostridium cochlearium [TaxId: 1494]} Back     information, alignment and structure
>d1dnpa2 c.28.1.1 (A:1-200) DNA photolyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qv7a1 e.52.1.2 (A:1-312) Diacylglycerol kinase DgkB {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d3clsd1 c.26.2.3 (D:1-192) Large, alpha subunit of electron transfer flavoprotein ETFP, N-terminal domain {Methylophilus methylotrophus [TaxId: 17]} Back     information, alignment and structure
>d7reqa2 c.23.6.1 (A:561-728) Methylmalonyl-CoA mutase alpha subunit, C-terminal domain {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} Back     information, alignment and structure
>d1g2ua_ c.77.1.1 (A:) 3-isopropylmalate dehydrogenase, IPMDH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d3beda1 c.54.1.1 (A:1-132) PTS system, IIA subunit {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure