Citrus Sinensis ID: 031518

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------16
MVSREHKKAAALHEKLQLLRSITNSHALSKTSIIVDASNYIEELKQKVERLNRDIENGQTSSDPNALPIQVTVKTLEKGFMINVFSKKSCPGLLVSILETFEELALNVLEARVSCTDTFSLQAIGGENEEQGETIDAHVVKQALLQVIRNWSESNEQV
cHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHcccccEEEEEEEccccccHHHHHHHHHHccccEEEEEEEEEcccEEEEEEccccccccccccHHHHHHHHHHHHHcHHHccccc
cccHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEEEEccEEEEEEEcccccccHHHHHHHHHHHHcccEEEEEEEccccEEEEEEEEccccccccccHHHHHHHHHHHHHHcccccccc
MVSREHKKAAALHEKLQLLRSITnshalsktsIIVDASNYIEELKQKVERLNRDiengqtssdpnalpiQVTVKTLEKGFMINVFSKKSCPGLLVSILETFEELALNVLEARVSctdtfslqaiggeneeqgeTIDAHVVKQALLQVIRNWSESNEQV
MVSREHKKAAALHEKLQLLRSItnshalsktsiivdasNYIEELKQKVERLNRDIengqtssdpnalpIQVTVKTLEKGFMINVFSKKSCPGLLVSILETFEELALNVLEARVSCTDTFSLQAIGGENEEQGETIDAHVVKQALLQVIRnwsesneqv
MVSREHKKAAALHEKLQLLRSITNSHALSKTSIIVDASNYIEELKQKVERLNRDIENGQTSSDPNALPIQVTVKTLEKGFMINVFSKKSCPGLLVSILETFEELALNVLEARVSCTDTFSLQAIGGENEEQGETIDAHVVKQALLQVIRNWSESNEQV
****************QLLRSITNSHALSKTSIIVDASNYIEEL**********************LPIQVTVKTLEKGFMINVFSKKSCPGLLVSILETFEELALNVLEARVSCTDTFSLQAIGGEN**QGETIDAHVVKQALLQVIRNW*******
******K***ALHEKLQLLRSITNSHALSKTSIIVDASNYIEELKQK*******************************GFMINVFSKKSCPGLLVSILETFEELALNVLEARVSCTDTFSLQAIGGEN******IDAHVVKQALLQV***********
**********ALHEKLQLLRSITNSHALSKTSIIVDASNYIEELKQKVERLNRDIENGQTSSDPNALPIQVTVKTLEKGFMINVFSKKSCPGLLVSILETFEELALNVLEARVSCTDTFSLQAIGGENEEQGETIDAHVVKQALLQVIRNWSESNEQV
******K**AALHEKLQLLRSITNSHALSKTSIIVDASNYIEELKQKVERLNRDIENGQTSSDPNALPIQVTVKTLEKGFMINVFSKKSCPGLLVSILETFEELALNVLEARVSCTDTFSLQAIGGENEEQGETIDAHVVKQALLQVIRNWS******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVSREHKKAAALHEKLQLLRSITNSHALSKTSIxxxxxxxxxxxxxxxxxxxxxxxxxxxxSDPNALPIQVTVKTLEKGFMINVFSKKSCPGLLVSILETFEELALNVLEARVSCTDTFSLQAIGGENEEQGETIDAHVVKQALLQVIRNWSESNEQV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query158 2.2.26 [Sep-21-2011]
Q9LXA9315 Transcription factor bHLH no no 0.886 0.444 0.322 1e-08
Q9LSL1351 Transcription factor bHLH no no 0.898 0.404 0.293 1e-07
Q9LPW3450 Transcription factor SCRE no no 0.892 0.313 0.241 6e-07
Q9LSE2494 Transcription factor ICE1 no no 0.886 0.283 0.251 9e-07
>sp|Q9LXA9|BH061_ARATH Transcription factor bHLH61 OS=Arabidopsis thaliana GN=BHLH61 PE=2 SV=1 Back     alignment and function desciption
 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 51/158 (32%), Positives = 79/158 (50%), Gaps = 18/158 (11%)

Query: 5   EHKKAAALHEKLQLLRSITNS-HALSKTSIIVDASNYIEELKQKVERLNRDIENGQTSSD 63
           E ++   L+++L LLRSI      + +TSI+ DA +Y++EL  K+ +L  D +   ++S 
Sbjct: 156 ERRRRKRLNDRLSLLRSIVPKITKMDRTSILGDAIDYMKELLDKINKLQEDEQELGSNSH 215

Query: 64  -----------PNALPIQVTVKTLEKGFMINVFSKKSCPGLLVSILETFEELALNVLEAR 112
                       N+L  +V  + +     I   +K   PGL+VS + T E L L + +  
Sbjct: 216 LSTLITNESMVRNSLKFEVDQREVNTHIDICCPTK---PGLVVSTVSTLETLGLEIEQCV 272

Query: 113 VSCTDTFSLQAIGGENEEQGETIDAHVVKQALLQVIRN 150
           +SC   FSLQA   E  EQ   + +   KQAL   IRN
Sbjct: 273 ISCFSDFSLQASCFEVGEQRYMVTSEATKQAL---IRN 307

Arabidopsis thaliana (taxid: 3702)
>sp|Q9LSL1|BH093_ARATH Transcription factor bHLH93 OS=Arabidopsis thaliana GN=BHLH93 PE=1 SV=1 Back     alignment and function description
>sp|Q9LPW3|SCRM2_ARATH Transcription factor SCREAM2 OS=Arabidopsis thaliana GN=SCRM2 PE=1 SV=1 Back     alignment and function description
>sp|Q9LSE2|ICE1_ARATH Transcription factor ICE1 OS=Arabidopsis thaliana GN=SCRM PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query158
356540030157 PREDICTED: uncharacterized protein LOC10 0.981 0.987 0.740 1e-59
297736527159 unnamed protein product [Vitis vinifera] 0.993 0.987 0.729 1e-58
356567913157 PREDICTED: uncharacterized protein LOC10 0.981 0.987 0.721 7e-58
351725705156 uncharacterized protein LOC100306253 [Gl 0.974 0.987 0.745 4e-57
359481316156 PREDICTED: transcription factor bHLH61-l 0.981 0.993 0.707 8e-57
359486354158 PREDICTED: transcription factor bHLH61 [ 0.987 0.987 0.723 1e-56
356554638156 PREDICTED: uncharacterized protein LOC10 0.974 0.987 0.732 5e-56
388507236159 unknown [Lotus japonicus] 0.962 0.955 0.701 5e-53
357492909155 Transcription factor bHLH93 [Medicago tr 0.968 0.987 0.689 2e-52
255559611156 DNA binding protein, putative [Ricinus c 0.968 0.980 0.748 3e-52
>gi|356540030|ref|XP_003538494.1| PREDICTED: uncharacterized protein LOC100814138 [Glycine max] Back     alignment and taxonomy information
 Score =  234 bits (596), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 117/158 (74%), Positives = 136/158 (86%), Gaps = 3/158 (1%)

Query: 1   MVSREHKKAAALHEKLQLLRSITNSHALSKTSIIVDASNYIEELKQKVERLNRDIENGQT 60
           MVSRE K+AA LHEKLQLLRSITNSHAL+KTSII+DAS YIEELKQKVERLN+ + N QT
Sbjct: 1   MVSREQKRAA-LHEKLQLLRSITNSHALNKTSIIIDASKYIEELKQKVERLNQHVANAQT 59

Query: 61  SSDPNALPIQVTVKTLEKGFMINVFSKKSCPGLLVSILETFEELALNVLEARVSCTDTFS 120
           SSD N LP+ VTV+TLEKGF+INV+S K+CPGLLVSILE+FEE+ LNVLEARV+CTDTF 
Sbjct: 60  SSDQNTLPM-VTVETLEKGFLINVYSAKTCPGLLVSILESFEEIGLNVLEARVTCTDTFR 118

Query: 121 LQAIGGENEEQG-ETIDAHVVKQALLQVIRNWSESNEQ 157
             A+GG+NEEQG E IDA  VKQ L Q I+NWS++ +Q
Sbjct: 119 FHAVGGKNEEQGDEGIDAQTVKQELGQAIKNWSQNADQ 156

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|297736527|emb|CBI25398.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356567913|ref|XP_003552159.1| PREDICTED: uncharacterized protein LOC100813030 [Glycine max] Back     alignment and taxonomy information
>gi|351725705|ref|NP_001236078.1| uncharacterized protein LOC100306253 [Glycine max] gi|255628009|gb|ACU14349.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|359481316|ref|XP_002268100.2| PREDICTED: transcription factor bHLH61-like [Vitis vinifera] gi|297735573|emb|CBI18067.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359486354|ref|XP_002278871.2| PREDICTED: transcription factor bHLH61 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356554638|ref|XP_003545651.1| PREDICTED: uncharacterized protein LOC100797684 [Glycine max] Back     alignment and taxonomy information
>gi|388507236|gb|AFK41684.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|357492909|ref|XP_003616743.1| Transcription factor bHLH93 [Medicago truncatula] gi|355518078|gb|AES99701.1| Transcription factor bHLH93 [Medicago truncatula] gi|388504310|gb|AFK40221.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|255559611|ref|XP_002520825.1| DNA binding protein, putative [Ricinus communis] gi|223539956|gb|EEF41534.1| DNA binding protein, putative [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query158
UNIPROTKB|Q8LII5157 OJ1167_G06.116 "Putative uncha 0.943 0.949 0.645 1.2e-44
TAIR|locus:2078411156 AT3G56220 [Arabidopsis thalian 0.962 0.974 0.613 2.4e-44
TAIR|locus:2828302158 AT2G40435 [Arabidopsis thalian 0.968 0.968 0.626 5e-44
UNIPROTKB|Q10LR1163 Os03g0338400 "BHLH transcripti 0.936 0.907 0.649 4.5e-43
UNIPROTKB|Q5WMQ1153 OSJNBa0053E01.1 "Putative unch 0.924 0.954 0.529 5.7e-36
UNIPROTKB|Q2QYP296 LOC_Os12g02020 "Os12g0111400 p 0.379 0.625 0.564 2.2e-11
TAIR|locus:2142419315 AT5G10570 "AT5G10570" [Arabido 0.898 0.450 0.317 3.1e-11
TAIR|locus:2155725351 bHLH093 "AT5G65640" [Arabidops 0.354 0.159 0.428 4.7e-10
UNIPROTKB|Q336V8380 Os10g0544200 "Os10g0544200 pro 0.462 0.192 0.256 4.7e-06
UNIPROTKB|Q8LII5 OJ1167_G06.116 "Putative uncharacterized protein OJ1167_G06.116" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
 Score = 470 (170.5 bits), Expect = 1.2e-44, P = 1.2e-44
 Identities = 102/158 (64%), Positives = 123/158 (77%)

Query:     1 MVSREHKKAAALHEKLQLLRSITNSHALSKTSIIVDASNYIEELKQKVERLNRDIENGQT 60
             M+SRE KKAAALHEKLQ+LRSIT+SHALS TSII DAS YI+ELKQKV RLN++I   + 
Sbjct:     1 MMSRERKKAAALHEKLQILRSITHSHALSNTSIITDASEYIKELKQKVVRLNKEIACAEA 60

Query:    61 SS-DPNALPIQVTVKTLEKGFMINVFSKKSCPGLLVSILETFEELALNVLEARVSCTDTF 119
             ++   N++P  VTV+TL  GF+INVFS KSCPGLLVSILE F+EL LNVLEA  SC DTF
Sbjct:    61 AALRQNSIPT-VTVETLGHGFLINVFSDKSCPGLLVSILEAFDELGLNVLEATASCDDTF 119

Query:   120 SLQAIGGENEEQGETIDAHVVKQALLQVIRN--WSESN 155
              L+A+GGEN+     +D HV+KQ +LQ I N   SES+
Sbjct:   120 RLEAVGGENQ-----VDEHVIKQTVLQAISNSNCSESS 152
GO:0005634 "nucleus" evidence=IC
TAIR|locus:2078411 AT3G56220 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2828302 AT2G40435 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q10LR1 Os03g0338400 "BHLH transcription factor" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|Q5WMQ1 OSJNBa0053E01.1 "Putative uncharacterized protein OSJNBa0053E01.1" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|Q2QYP2 LOC_Os12g02020 "Os12g0111400 protein" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2142419 AT5G10570 "AT5G10570" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2155725 bHLH093 "AT5G65640" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q336V8 Os10g0544200 "Os10g0544200 protein" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 158
smart0035353 HLH helix loop helix domain. 99.44
cd0008360 HLH Helix-loop-helix domain, found in specific DNA 99.36
PF0001055 HLH: Helix-loop-helix DNA-binding domain only nucl 99.31
cd0489775 ACT_ACR_3 ACT domain-containing protein which is c 98.78
cd0489572 ACT_ACR_1 ACT domain-containing protein which is c 98.78
cd0492776 ACT_ACR-like_2 Second ACT domain, of a novel type 98.74
cd0490073 ACT_UUR-like_1 ACT domain family, ACT_UUR-like_1, 98.67
cd0489675 ACT_ACR-like_3 ACT domain-containing protein which 98.62
cd0492574 ACT_ACR_2 ACT domain-containing protein which is c 98.42
cd0492868 ACT_TyrKc Uncharacterized, N-terminal ACT domain o 98.41
KOG1318411 consensus Helix loop helix transcription factor EB 98.21
cd0489970 ACT_ACR-UUR-like_2 C-terminal ACT domains of the b 98.14
cd0492672 ACT_ACR_4 C-terminal ACT domain, of a novel type o 98.08
KOG1319229 consensus bHLHZip transcription factor BIGMAX [Tra 98.03
PRK05007884 PII uridylyl-transferase; Provisional 97.95
KOG4304250 consensus Transcriptional repressors of the hairy/ 97.9
PRK00275895 glnD PII uridylyl-transferase; Provisional 97.88
KOG3561 803 consensus Aryl-hydrocarbon receptor nuclear transl 97.8
PRK04374869 PII uridylyl-transferase; Provisional 97.77
PRK01759854 glnD PII uridylyl-transferase; Provisional 97.67
PRK03059856 PII uridylyl-transferase; Provisional 97.61
PRK03381774 PII uridylyl-transferase; Provisional 97.59
PRK05092931 PII uridylyl-transferase; Provisional 97.58
PF0184266 ACT: ACT domain; InterPro: IPR002912 The ACT domai 97.54
PRK03381774 PII uridylyl-transferase; Provisional 97.49
cd0487370 ACT_UUR-ACR-like ACT domains of the bacterial sign 97.49
KOG3960284 consensus Myogenic helix-loop-helix transcription 97.44
PF1374076 ACT_6: ACT domain; PDB: 1ZPV_A 3P96_A 1U8S_A. 97.43
TIGR01693850 UTase_glnD [Protein-PII] uridylyltransferase. This 97.36
KOG0561 373 consensus bHLH transcription factor [Transcription 97.34
TIGR01693850 UTase_glnD [Protein-PII] uridylyltransferase. This 97.34
PRK05007 884 PII uridylyl-transferase; Provisional 97.3
PRK01759854 glnD PII uridylyl-transferase; Provisional 97.29
KOG2483232 consensus Upstream transcription factor 2/L-myc-2 97.13
PRK00275 895 glnD PII uridylyl-transferase; Provisional 97.1
cd0489377 ACT_GcvR_1 ACT domains that comprise the Glycine C 97.08
cd0487574 ACT_F4HF-DF N-terminal ACT domain of formyltetrahy 97.07
PRK03059856 PII uridylyl-transferase; Provisional 97.03
COG2844867 GlnD UTP:GlnB (protein PII) uridylyltransferase [P 97.03
PRK04374869 PII uridylyl-transferase; Provisional 96.98
PRK0019490 hypothetical protein; Validated 96.94
cd0486981 ACT_GcvR_2 ACT domains that comprise the Glycine C 96.88
cd0487288 ACT_1ZPV ACT domain proteins similar to the yet un 96.85
PRK05092 931 PII uridylyl-transferase; Provisional 96.85
KOG4029228 consensus Transcription factor HAND2/Transcription 96.71
PF1329180 ACT_4: ACT domain; PDB: 2KO1_B 3IBW_A. 96.64
cd0487075 ACT_PSP_1 CT domains found N-terminal of phosphose 96.49
PLN0321793 transcription factor ATBS1; Provisional 96.0
cd0488774 ACT_MalLac-Enz ACT_MalLac-Enz CD includes the N-te 95.87
cd0488673 ACT_ThrD-II-like C-terminal ACT domain of biodegra 95.77
COG2844 867 GlnD UTP:GlnB (protein PII) uridylyltransferase [P 95.58
cd0489469 ACT_ACR-like_1 ACT domain-containing protein which 95.53
cd0211660 ACT ACT domains are commonly involved in specifica 95.38
cd0488075 ACT_AAAH-PDT-like ACT domain of the nonheme iron-d 95.27
cd0488179 ACT_HSDH-Hom ACT_HSDH_Hom CD includes the C-termin 95.24
cd0487671 ACT_RelA-SpoT ACT domain found C-terminal of the R 95.09
PRK13010 289 purU formyltetrahydrofolate deformylase; Reviewed 94.95
cd0488876 ACT_PheB-BS C-terminal ACT domain of a small (~147 94.82
PRK13011 286 formyltetrahydrofolate deformylase; Reviewed 94.63
PRK04435147 hypothetical protein; Provisional 94.61
TIGR00655 280 PurU formyltetrahydrofolate deformylase. This mode 94.56
PRK06027 286 purU formyltetrahydrofolate deformylase; Reviewed 94.28
cd0487774 ACT_TyrR N-terminal ACT domain of the TyrR protein 94.18
KOG3559 598 consensus Transcriptional regulator SIM1 [Transcri 93.98
cd0488372 ACT_AcuB C-terminal ACT domain of the Bacillus sub 93.97
PRK08577136 hypothetical protein; Provisional 93.88
KOG3558 768 consensus Hypoxia-inducible factor 1/Neuronal PAS 93.57
cd0490969 ACT_PDH-BS C-terminal ACT domain of the monofuncti 93.53
cd0488956 ACT_PDH-BS-like C-terminal ACT domain of the monof 93.22
cd0490580 ACT_CM-PDT C-terminal ACT domain of the bifunction 93.05
cd0487472 ACT_Af1403 N-terminal ACT domain of the yet unchar 93.04
KOG2588 953 consensus Predicted DNA-binding protein [Transcrip 92.9
cd0490371 ACT_LSD C-terminal ACT domain of the L-serine dehy 92.81
cd0488265 ACT_Bt0572_2 C-terminal ACT domain of a novel prot 92.59
cd0488472 ACT_CBS C-terminal ACT domain of the cystathionine 92.55
cd0487872 ACT_AHAS N-terminal ACT domain of the Escherichia 92.4
KOG3560 712 consensus Aryl-hydrocarbon receptor [Transcription 92.38
COG383090 ACT domain-containing protein [Signal transduction 92.11
cd0487971 ACT_3PGDH-like ACT_3PGDH-like CD includes the C-te 92.04
PRK00227693 glnD PII uridylyl-transferase; Provisional 91.48
cd0490866 ACT_Bt0572_1 N-terminal ACT domain of a novel prot 91.13
cd0490474 ACT_AAAH ACT domain of the nonheme iron-dependent, 91.02
PRK1115276 ilvM acetolactate synthase 2 regulatory subunit; P 89.62
cd0493190 ACT_PAH ACT domain of the nonheme iron-dependent a 89.59
TIGR00119157 acolac_sm acetolactate synthase, small subunit. ac 89.28
COG0788 287 PurU Formyltetrahydrofolate hydrolase [Nucleotide 89.26
PRK11589 190 gcvR glycine cleavage system transcriptional repre 89.13
PRK07334403 threonine dehydratase; Provisional 89.1
PRK0673776 acetolactate synthase 1 regulatory subunit; Valida 88.71
PRK11895161 ilvH acetolactate synthase 3 regulatory subunit; R 88.16
PF05088 1528 Bac_GDH: Bacterial NAD-glutamate dehydrogenase 87.62
CHL00100174 ilvH acetohydroxyacid synthase small subunit 86.17
PF1371063 ACT_5: ACT domain; PDB: 2FGC_A 2PC6_A 2F1F_B. 86.03
PRK1356284 acetolactate synthase 1 regulatory subunit; Provis 85.37
cd0490169 ACT_3PGDH C-terminal ACT (regulatory) domain of D- 84.08
cd0492974 ACT_TPH ACT domain of the nonheme iron-dependent a 83.94
cd0490273 ACT_3PGDH-xct C-terminal ACT (regulatory) domain o 83.76
KOG4447173 consensus Transcription factor TWIST [Transcriptio 83.39
PRK11589190 gcvR glycine cleavage system transcriptional repre 80.68
>smart00353 HLH helix loop helix domain Back     alignment and domain information 
Probab=99.44  E-value=1.7e-13  Score=86.31  Aligned_cols=47  Identities=30%  Similarity=0.507  Sum_probs=43.6

Q ss_pred             hHHHHHHHHHHHhHHHhhcCCC----CCCCcccchHHHHHHHHHHHHHHHH
Q 031518            3 SREHKKAAALHEKLQLLRSITN----SHALSKTSIIVDASNYIEELKQKVE   49 (158)
Q Consensus         3 ~aER~RR~kln~~~~~LRslvP----~~K~DKaSil~dAI~YIk~Lq~~v~   49 (158)
                      .+||+||++||+.|..|++++|    ..|+||++||.+||+||+.|+.+++
T Consensus         2 ~~Er~RR~~~n~~~~~L~~lip~~~~~~k~~k~~iL~~ai~yi~~L~~~~~   52 (53)
T smart00353        2 ARERRRRRKINEAFDELRSLLPTLPNNKKLSKAEILRLAIEYIKSLQEELQ   52 (53)
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHh
Confidence            5799999999999999999988    4579999999999999999999876

>cd00083 HLH Helix-loop-helix domain, found in specific DNA- binding proteins that act as transcription factors; 60-100 amino acids long Back     alignment and domain information
>PF00010 HLH: Helix-loop-helix DNA-binding domain only nuclear translocator protein (Arnt) Back     alignment and domain information
>cd04897 ACT_ACR_3 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04895 ACT_ACR_1 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04927 ACT_ACR-like_2 Second ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04900 ACT_UUR-like_1 ACT domain family, ACT_UUR-like_1, includes the first of two C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains Back     alignment and domain information
>cd04896 ACT_ACR-like_3 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04925 ACT_ACR_2 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04928 ACT_TyrKc Uncharacterized, N-terminal ACT domain of an Arabidopsis/Oryza predicted tyrosine kinase and other related ACT domains Back     alignment and domain information
>KOG1318 consensus Helix loop helix transcription factor EB [Transcription] Back     alignment and domain information
>cd04899 ACT_ACR-UUR-like_2 C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains Back     alignment and domain information
>cd04926 ACT_ACR_4 C-terminal ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>KOG1319 consensus bHLHZip transcription factor BIGMAX [Transcription] Back     alignment and domain information
>PRK05007 PII uridylyl-transferase; Provisional Back     alignment and domain information
>KOG4304 consensus Transcriptional repressors of the hairy/E(spl) family (contains HLH) [Transcription] Back     alignment and domain information
>PRK00275 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>KOG3561 consensus Aryl-hydrocarbon receptor nuclear translocator [Transcription] Back     alignment and domain information
>PRK04374 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK01759 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK03059 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK03381 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK05092 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PF01842 ACT: ACT domain; InterPro: IPR002912 The ACT domain is found in a variety of contexts and is proposed to be a conserved regulatory binding fold Back     alignment and domain information
>PRK03381 PII uridylyl-transferase; Provisional Back     alignment and domain information
>cd04873 ACT_UUR-ACR-like ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD Back     alignment and domain information
>KOG3960 consensus Myogenic helix-loop-helix transcription factor [Transcription] Back     alignment and domain information
>PF13740 ACT_6: ACT domain; PDB: 1ZPV_A 3P96_A 1U8S_A Back     alignment and domain information
>TIGR01693 UTase_glnD [Protein-PII] uridylyltransferase Back     alignment and domain information
>KOG0561 consensus bHLH transcription factor [Transcription] Back     alignment and domain information
>TIGR01693 UTase_glnD [Protein-PII] uridylyltransferase Back     alignment and domain information
>PRK05007 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK01759 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>KOG2483 consensus Upstream transcription factor 2/L-myc-2 protein [Transcription] Back     alignment and domain information
>PRK00275 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>cd04893 ACT_GcvR_1 ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains Back     alignment and domain information
>cd04875 ACT_F4HF-DF N-terminal ACT domain of formyltetrahydrofolate deformylase (F4HF-DF; formyltetrahydrofolate hydrolase) Back     alignment and domain information
>PRK03059 PII uridylyl-transferase; Provisional Back     alignment and domain information
>COG2844 GlnD UTP:GlnB (protein PII) uridylyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK04374 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK00194 hypothetical protein; Validated Back     alignment and domain information
>cd04869 ACT_GcvR_2 ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains Back     alignment and domain information
>cd04872 ACT_1ZPV ACT domain proteins similar to the yet uncharacterized Streptococcus pneumoniae ACT domain protein Back     alignment and domain information
>PRK05092 PII uridylyl-transferase; Provisional Back     alignment and domain information
>KOG4029 consensus Transcription factor HAND2/Transcription factor TAL1/TAL2/LYL1 [Transcription] Back     alignment and domain information
>PF13291 ACT_4: ACT domain; PDB: 2KO1_B 3IBW_A Back     alignment and domain information
>cd04870 ACT_PSP_1 CT domains found N-terminal of phosphoserine phosphatase (PSP, SerB) Back     alignment and domain information
>PLN03217 transcription factor ATBS1; Provisional Back     alignment and domain information
>cd04887 ACT_MalLac-Enz ACT_MalLac-Enz CD includes the N-terminal ACT domain of putative NAD-dependent malic enzyme 1, Bacillus subtilis YqkI and related domains Back     alignment and domain information
>cd04886 ACT_ThrD-II-like C-terminal ACT domain of biodegradative (catabolic) threonine dehydratase II (ThrD-II) and other related ACT domains Back     alignment and domain information
>COG2844 GlnD UTP:GlnB (protein PII) uridylyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd04894 ACT_ACR-like_1 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd02116 ACT ACT domains are commonly involved in specifically binding an amino acid or other small ligand leading to regulation of the enzyme Back     alignment and domain information
>cd04880 ACT_AAAH-PDT-like ACT domain of the nonheme iron-dependent, aromatic amino acid hydroxylases (AAAH) Back     alignment and domain information
>cd04881 ACT_HSDH-Hom ACT_HSDH_Hom CD includes the C-terminal ACT domain of the NAD(P)H-dependent, homoserine dehydrogenase (HSDH) and related domains Back     alignment and domain information
>cd04876 ACT_RelA-SpoT ACT domain found C-terminal of the RelA/SpoT domains Back     alignment and domain information
>PRK13010 purU formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>cd04888 ACT_PheB-BS C-terminal ACT domain of a small (~147 a Back     alignment and domain information
>PRK13011 formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>PRK04435 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00655 PurU formyltetrahydrofolate deformylase Back     alignment and domain information
>PRK06027 purU formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>cd04877 ACT_TyrR N-terminal ACT domain of the TyrR protein Back     alignment and domain information
>KOG3559 consensus Transcriptional regulator SIM1 [Transcription] Back     alignment and domain information
>cd04883 ACT_AcuB C-terminal ACT domain of the Bacillus subtilis acetoin utilization protein, AcuB Back     alignment and domain information
>PRK08577 hypothetical protein; Provisional Back     alignment and domain information
>KOG3558 consensus Hypoxia-inducible factor 1/Neuronal PAS domain protein NPAS1 [Signal transduction mechanisms; Transcription] Back     alignment and domain information
>cd04909 ACT_PDH-BS C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH) Back     alignment and domain information
>cd04889 ACT_PDH-BS-like C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH) enzyme that catalyzes the formation of 4-hydroxyphenylpyruvate from prephenate Back     alignment and domain information
>cd04905 ACT_CM-PDT C-terminal ACT domain of the bifunctional chorismate mutase-prephenate dehydratase (CM-PDT) enzyme and the prephenate dehydratase (PDT) enzyme Back     alignment and domain information
>cd04874 ACT_Af1403 N-terminal ACT domain of the yet uncharacterized, small (~133 a Back     alignment and domain information
>KOG2588 consensus Predicted DNA-binding protein [Transcription] Back     alignment and domain information
>cd04903 ACT_LSD C-terminal ACT domain of the L-serine dehydratase (LSD), iron-sulfur-dependent, beta subunit Back     alignment and domain information
>cd04882 ACT_Bt0572_2 C-terminal ACT domain of a novel protein composed of just two ACT domains Back     alignment and domain information
>cd04884 ACT_CBS C-terminal ACT domain of the cystathionine beta-synthase (CBS) domain protein found in Thermotoga maritima, Tm0935, and delta proteobacteria Back     alignment and domain information
>cd04878 ACT_AHAS N-terminal ACT domain of the Escherichia coli IlvH-like regulatory subunit of acetohydroxyacid synthase (AHAS) Back     alignment and domain information
>KOG3560 consensus Aryl-hydrocarbon receptor [Transcription] Back     alignment and domain information
>COG3830 ACT domain-containing protein [Signal transduction mechanisms] Back     alignment and domain information
>cd04879 ACT_3PGDH-like ACT_3PGDH-like CD includes the C-terminal ACT (regulatory) domain of D-3-phosphoglycerate dehydrogenase (3PGDH) Back     alignment and domain information
>PRK00227 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>cd04908 ACT_Bt0572_1 N-terminal ACT domain of a novel protein composed almost entirely of two tandem ACT domains Back     alignment and domain information
>cd04904 ACT_AAAH ACT domain of the nonheme iron-dependent, aromatic amino acid hydroxylases (AAAH) Back     alignment and domain information
>PRK11152 ilvM acetolactate synthase 2 regulatory subunit; Provisional Back     alignment and domain information
>cd04931 ACT_PAH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, phenylalanine hydroxylases (PAH) Back     alignment and domain information
>TIGR00119 acolac_sm acetolactate synthase, small subunit Back     alignment and domain information
>COG0788 PurU Formyltetrahydrofolate hydrolase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK11589 gcvR glycine cleavage system transcriptional repressor; Provisional Back     alignment and domain information
>PRK07334 threonine dehydratase; Provisional Back     alignment and domain information
>PRK06737 acetolactate synthase 1 regulatory subunit; Validated Back     alignment and domain information
>PRK11895 ilvH acetolactate synthase 3 regulatory subunit; Reviewed Back     alignment and domain information
>PF05088 Bac_GDH: Bacterial NAD-glutamate dehydrogenase Back     alignment and domain information
>CHL00100 ilvH acetohydroxyacid synthase small subunit Back     alignment and domain information
>PF13710 ACT_5: ACT domain; PDB: 2FGC_A 2PC6_A 2F1F_B Back     alignment and domain information
>PRK13562 acetolactate synthase 1 regulatory subunit; Provisional Back     alignment and domain information
>cd04901 ACT_3PGDH C-terminal ACT (regulatory) domain of D-3-Phosphoglycerate Dehydrogenase (3PGDH) found in fungi and bacteria Back     alignment and domain information
>cd04929 ACT_TPH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, tryptophan hydroxylases (TPH), both peripheral (TPH1) and neuronal (TPH2) enzymes Back     alignment and domain information
>cd04902 ACT_3PGDH-xct C-terminal ACT (regulatory) domain of D-3-phosphoglycerate dehydrogenase (3PGDH) Back     alignment and domain information
>KOG4447 consensus Transcription factor TWIST [Transcription] Back     alignment and domain information
>PRK11589 gcvR glycine cleavage system transcriptional repressor; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query158
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-04
1qzv_F154 Plant photosystem I: subunit PSAF; photosynthesis, 8e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 38.3 bits (88), Expect = 6e-04
 Identities = 25/157 (15%), Positives = 47/157 (29%), Gaps = 38/157 (24%)

Query: 2   VSREHKKAAALHEKLQLLRSITNS--HALS---KTSIIVDASNYIEELKQKVERLNRDIE 56
           VSR       L + L  LR   N     +    KT + +D          KV+       
Sbjct: 131 VSRLQPYLK-LRQALLELRPAKNVLIDGVLGSGKTWVALDVCL-----SYKVQC------ 178

Query: 57  NGQTSSDPNALPIQVTVKTLEKGFMINVFSKKSCPGLLVSILETFEELALNVLEARVSCT 116
                     +  ++        F +N     + P  ++ +L+           +R   +
Sbjct: 179 ---------KMDFKI--------FWLN-LKNCNSPETVLEMLQKLLYQIDPNWTSRSDHS 220

Query: 117 DTFSLQAIGGENEEQGETIDAHVVKQALLQVIRN-WS 152
               L+ I     E    + +   +  LL V+ N  +
Sbjct: 221 SNIKLR-IHSIQAELRRLLKSKPYENCLL-VLLNVQN 255
>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query158
1am9_A82 Srebp-1A, protein (sterol regulatory element bindi 99.64
1nkp_B83 MAX protein, MYC proto-oncogene protein; transcrip 99.54
4h10_B71 Circadian locomoter output cycles protein kaput; B 99.53
1hlo_A80 Protein (transcription factor MAX); transcriptiona 99.52
1nkp_A88 C-MYC, MYC proto-oncogene protein; transcription, 99.49
1an4_A65 Protein (upstream stimulatory factor); protein-DNA 99.47
4ati_A118 MITF, microphthalmia-associated transcription fact 99.45
4h10_A73 ARYL hydrocarbon receptor nuclear translocator-LI 99.45
1a0a_A63 BHLH, protein (phosphate system positive regulator 99.41
1nlw_A80 MAD protein, MAX dimerizer; transcription factor, 99.39
3u5v_A76 Protein MAX, transcription factor E2-alpha chimer; 99.28
1mdy_A68 Protein (MYOD BHLH domain); protein-DNA complex, t 99.09
2ql2_B60 Neurod1, neurogenic differentiation factor 1; basi 99.05
4f3l_A 361 Mclock, circadian locomoter output cycles protein 98.92
4f3l_B 387 BMAL1B; BHLH, PAS, circadian rhythm proteins, tran 98.73
2lfh_A68 DNA-binding protein inhibitor ID-3; structural gen 98.72
4ath_A83 MITF, microphthalmia-associated transcription fact 98.15
4aya_A97 DNA-binding protein inhibitor ID-2; cell cycle; 2. 97.94
1zpv_A91 ACT domain protein; structural genomics, PSI, prot 97.47
1u8s_A 192 Glycine cleavage system transcriptional repressor, 96.96
2nyi_A 195 Unknown protein; protein structure initiative, PSI 96.63
2ko1_A88 CTR148A, GTP pyrophosphokinase; homodimer, alpha+b 96.33
2nyi_A195 Unknown protein; protein structure initiative, PSI 96.26
1u8s_A192 Glycine cleavage system transcriptional repressor, 96.23
3obi_A 288 Formyltetrahydrofolate deformylase; structural gen 94.9
3o1l_A 302 Formyltetrahydrofolate deformylase; structural gen 94.82
3p96_A 415 Phosphoserine phosphatase SERB; ssgcid, structural 94.8
3n0v_A 286 Formyltetrahydrofolate deformylase; formyl transfe 94.63
3lou_A 292 Formyltetrahydrofolate deformylase; structural gen 94.09
3nrb_A 287 Formyltetrahydrofolate deformylase; N-terminal ACT 92.56
2jhe_A 190 Transcription regulator TYRR; aromatic hydrocarbon 92.37
2f1f_A164 Acetolactate synthase isozyme III small subunit; f 92.33
2pc6_A165 Probable acetolactate synthase isozyme III (small; 90.89
1y7p_A 223 Hypothetical protein AF1403; structural genomics, 89.02
2fgc_A193 Acetolactate synthase, small subunit; regulatory s 88.99
>1am9_A Srebp-1A, protein (sterol regulatory element binding protein 1A); basic-helix-loop- helix-leucine zipper, transcription factor; HET: DNA; 2.30A {Homo sapiens} SCOP: a.38.1.1 PDB: 1ukl_C Back     alignment and structure
Probab=99.64  E-value=1.6e-16  Score=108.81  Aligned_cols=55  Identities=18%  Similarity=0.369  Sum_probs=51.2

Q ss_pred             hHHHHHHHHHHHhHHHhhcCCC-C-CCCcccchHHHHHHHHHHHHHHHHHHHHhhhc
Q 031518            3 SREHKKAAALHEKLQLLRSITN-S-HALSKTSIIVDASNYIEELKQKVERLNRDIEN   57 (158)
Q Consensus         3 ~aER~RR~kln~~~~~LRslvP-~-~K~DKaSil~dAI~YIk~Lq~~v~~Le~e~~~   57 (158)
                      .+||+||.+||+.|..||+++| . .|+||++||.+||+||++|+.+++.|+.+...
T Consensus        12 ~~ErrRR~~in~~f~~L~~lvP~~~~k~~Ka~IL~~Ai~YI~~Lq~~~~~L~~e~~~   68 (82)
T 1am9_A           12 AIEKRYRSSINDKIIELKDLVVGTEAKLNKSAVLRKAIDYIRFLQHSNQKLKQENLS   68 (82)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHTCSSCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             hHHHHHHHHHHHHHHHHHHhccCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            4799999999999999999988 4 89999999999999999999999999987654
>1nkp_B MAX protein, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 PDB: 1an2_A* 1r05_A 1nlw_B Back     alignment and structure
>4h10_B Circadian locomoter output cycles protein kaput; BHLH, circadian transcription, transcription-DNA complex; 2.40A {Homo sapiens} Back     alignment and structure
>1hlo_A Protein (transcription factor MAX); transcriptional regulation, DNA binding, complex (transcription factor MAX/DNA), transcription/DNA complex; HET: DNA; 2.80A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>1nkp_A C-MYC, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>1an4_A Protein (upstream stimulatory factor); protein-DNA complex, double helix, overhanging base, transcription/DNA complex; HET: DNA; 2.90A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>4ati_A MITF, microphthalmia-associated transcription factor; DNA-binding protein-DNA complex, melanoma; 2.60A {Mus musculus} PDB: 4atk_A Back     alignment and structure
>4h10_A ARYL hydrocarbon receptor nuclear translocator-LI 1; BHLH, circadian transcription, transcription-DNA complex; 2.40A {Homo sapiens} Back     alignment and structure
>1a0a_A BHLH, protein (phosphate system positive regulatory protein PHO4); transcription factor, basic helix loop helix; HET: DNA; 2.80A {Saccharomyces cerevisiae} SCOP: a.38.1.1 Back     alignment and structure
>1nlw_A MAD protein, MAX dimerizer; transcription factor, DNA, BHLHZ, transcription/DNA complex; 2.00A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>3u5v_A Protein MAX, transcription factor E2-alpha chimer; basic helix-loop-helix (BHLH); 1.70A {Mus musculus} PDB: 2ql2_A* Back     alignment and structure
>1mdy_A Protein (MYOD BHLH domain); protein-DNA complex, transcription/DNA complex; HET: DNA; 2.80A {Mus musculus} SCOP: a.38.1.1 PDB: 1mdy_B* Back     alignment and structure
>2ql2_B Neurod1, neurogenic differentiation factor 1; basic-helix-loop-helix; HET: DNA; 2.50A {Mus musculus} Back     alignment and structure
>4f3l_A Mclock, circadian locomoter output cycles protein kaput; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Back     alignment and structure
>4f3l_B BMAL1B; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Back     alignment and structure
>2lfh_A DNA-binding protein inhibitor ID-3; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>4ath_A MITF, microphthalmia-associated transcription factor; DNA binding protein, melanoma; HET: MSE; 1.95A {Mus musculus} Back     alignment and structure
>4aya_A DNA-binding protein inhibitor ID-2; cell cycle; 2.10A {Homo sapiens} Back     alignment and structure
>1zpv_A ACT domain protein; structural genomics, PSI, protein structure INIT midwest center for structural genomics, MCSG, unknown funct; 1.90A {Streptococcus pneumoniae} SCOP: d.58.18.7 Back     alignment and structure
>1u8s_A Glycine cleavage system transcriptional repressor, putative; structural genomics, protein structure initiative (PSI), domain swapping; 2.45A {Vibrio cholerae} SCOP: d.58.18.5 d.58.18.5 Back     alignment and structure
>2nyi_A Unknown protein; protein structure initiative, PSI, center for eukaryotic structural genomics, CESG, structural genomics; 1.80A {Galdieria sulphuraria} Back     alignment and structure
>2ko1_A CTR148A, GTP pyrophosphokinase; homodimer, alpha+beta, transferase, structural genomics, PSI-2, protein structure initiative; NMR {Chlorobaculum tepidum} PDB: 3ibw_A Back     alignment and structure
>2nyi_A Unknown protein; protein structure initiative, PSI, center for eukaryotic structural genomics, CESG, structural genomics; 1.80A {Galdieria sulphuraria} Back     alignment and structure
>1u8s_A Glycine cleavage system transcriptional repressor, putative; structural genomics, protein structure initiative (PSI), domain swapping; 2.45A {Vibrio cholerae} SCOP: d.58.18.5 d.58.18.5 Back     alignment and structure
>3obi_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 1.95A {Rhodopseudomonas palustris} Back     alignment and structure
>3o1l_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 2.20A {Pseudomonas syringae PV} Back     alignment and structure
>3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} Back     alignment and structure
>3n0v_A Formyltetrahydrofolate deformylase; formyl transferase, ACT domain, structural genomics, joint C structural genomics, JCSG; HET: MSE; 2.25A {Pseudomonas putida} Back     alignment and structure
>3lou_A Formyltetrahydrofolate deformylase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative hydrolase; HET: MSE; 1.90A {Burkholderia mallei} Back     alignment and structure
>3nrb_A Formyltetrahydrofolate deformylase; N-terminal ACT domain, structural genomics, joint center for structural genomics, JCSG; HET: MSE FLC; 2.05A {Pseudomonas putida} Back     alignment and structure
>2jhe_A Transcription regulator TYRR; aromatic hydrocarbons catabolism, TYRR protei nucleotide-binding, transcription regulation, activator; HET: PG4; 2.30A {Escherichia coli} Back     alignment and structure
>2f1f_A Acetolactate synthase isozyme III small subunit; ferredoxin fold, ACT domain, transferase; HET: P33 1PE; 1.75A {Escherichia coli} SCOP: d.58.18.6 d.58.18.6 Back     alignment and structure
>2pc6_A Probable acetolactate synthase isozyme III (small; regulatory subunit, structural genomi protein structure initiative; HET: MSE; 2.50A {Nitrosomonas europaea atcc 19718} SCOP: d.58.18.6 d.58.18.6 Back     alignment and structure
>1y7p_A Hypothetical protein AF1403; structural genomics, protein structure initiative, PSI, alpha-beta-alpha sandwich; HET: RIP; 1.90A {Archaeoglobus fulgidus} SCOP: c.23.1.7 d.58.18.12 Back     alignment and structure
>2fgc_A Acetolactate synthase, small subunit; regulatory subunit, structural genomi protein structure initiative; 2.30A {Thermotoga maritima} SCOP: d.58.18.6 d.58.18.6 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 158
d1uklc_61 a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens) [TaxId 0.003
d1nkpb_83 a.38.1.1 (B:) Max protein {Human (Homo sapiens) [T 0.003
>d1uklc_ a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 61 Back     information, alignment and structure

class: All alpha proteins
fold: HLH-like
superfamily: HLH, helix-loop-helix DNA-binding domain
family: HLH, helix-loop-helix DNA-binding domain
domain: SREBP-2
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 32.4 bits (74), Expect = 0.003
 Identities = 11/58 (18%), Positives = 30/58 (51%), Gaps = 2/58 (3%)

Query: 12 LHEKLQLLRSI--TNSHALSKTSIIVDASNYIEELKQKVERLNRDIENGQTSSDPNAL 67
          +++K+  L+ +       + K+ ++  A +YI+ L+Q   +L ++    + ++  N L
Sbjct: 4  INDKIIELKDLVMGTDAKMHKSGVLRKAIDYIKYLQQVNHKLRQENMVLKLANQKNKL 61
>d1nkpb_ a.38.1.1 (B:) Max protein {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query158
d1am9a_80 SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} 99.54
d1uklc_61 SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} 99.51
d1nkpb_83 Max protein {Human (Homo sapiens) [TaxId: 9606]} 99.5
d1nlwa_79 Mad protein {Human (Homo sapiens) [TaxId: 9606]} 99.5
d1a0aa_63 Pho4 B/HLH domain {Baker's yeast (Saccharomyces ce 99.47
d1mdya_68 Myod B/HLH domain {Mouse (Mus musculus) [TaxId: 10 99.47
d1nkpa_88 Myc proto-oncogene protein {Human (Homo sapiens) [ 99.46
d1an4a_65 Usf B/HLH domain {Human (Homo sapiens) [TaxId: 960 99.33
d1zpva183 UPF0237 protein SP0238 {Streptococcus pneumoniae [ 97.71
d1u8sa186 putative transcriptional repressor VC2159 {Vibrio 97.26
d1u8sa293 putative transcriptional repressor VC2159 {Vibrio 96.98
d1y7pa277 Hypothetical protein AF1403, N-terminal domain {Ar 95.52
d2f06a171 Hypothetical protein BT0572 {Bacteroides thetaiota 95.45
d2f06a270 Hypothetical protein BT0572 {Bacteroides thetaiota 95.44
d1sc6a384 Phosphoglycerate dehydrogenase, regulatory (C-term 93.49
d2fgca278 Acetolactate synthase small subunit, IlvH {Thermot 90.54
d1ygya378 Phosphoglycerate dehydrogenase, regulatory (C-term 88.45
d1phza197 Phenylalanine hydroxylase N-terminal domain {Rat ( 86.87
d2f1fa176 Acetolactate synthase small subunit, IlvH {Escheri 86.69
d2pc6a277 Acetolactate synthase small subunit, IlvH {Nitroso 83.79
d2qmwa280 Prephenate dehydratase C-terminal domain {Staphylo 80.78
>d1am9a_ a.38.1.1 (A:) SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: HLH-like
superfamily: HLH, helix-loop-helix DNA-binding domain
family: HLH, helix-loop-helix DNA-binding domain
domain: SREBP-1a
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.54  E-value=3.5e-15  Score=99.84  Aligned_cols=54  Identities=19%  Similarity=0.362  Sum_probs=50.3

Q ss_pred             hHHHHHHHHHHHhHHHhhcCCC--CCCCcccchHHHHHHHHHHHHHHHHHHHHhhh
Q 031518            3 SREHKKAAALHEKLQLLRSITN--SHALSKTSIIVDASNYIEELKQKVERLNRDIE   56 (158)
Q Consensus         3 ~aER~RR~kln~~~~~LRslvP--~~K~DKaSil~dAI~YIk~Lq~~v~~Le~e~~   56 (158)
                      .+||+||.+||+.|..|++++|  ..|+||++||..||+||++|+.+++.|..+..
T Consensus        12 ~~Er~RR~~in~~~~~L~~llP~~~~k~~K~~iL~~a~~yI~~L~~~~~~L~~e~~   67 (80)
T d1am9a_          12 AIEKRYRSSINDKIIELKDLVVGTEAKLNKSAVLRKAIDYIRFLQHSNQKLKQENL   67 (80)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHTCSSCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHhcCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            4799999999999999999988  67999999999999999999999999988754
>d1uklc_ a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nkpb_ a.38.1.1 (B:) Max protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nlwa_ a.38.1.1 (A:) Mad protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a0aa_ a.38.1.1 (A:) Pho4 B/HLH domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mdya_ a.38.1.1 (A:) Myod B/HLH domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nkpa_ a.38.1.1 (A:) Myc proto-oncogene protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1an4a_ a.38.1.1 (A:) Usf B/HLH domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zpva1 d.58.18.7 (A:1-83) UPF0237 protein SP0238 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1u8sa1 d.58.18.5 (A:2-87) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1u8sa2 d.58.18.5 (A:88-180) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1y7pa2 d.58.18.12 (A:2-78) Hypothetical protein AF1403, N-terminal domain {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2f06a1 d.58.18.11 (A:71-141) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d2f06a2 d.58.18.11 (A:1-70) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1sc6a3 d.58.18.1 (A:327-410) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fgca2 d.58.18.6 (A:27-104) Acetolactate synthase small subunit, IlvH {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ygya3 d.58.18.1 (A:452-529) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1phza1 d.58.18.3 (A:19-115) Phenylalanine hydroxylase N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2f1fa1 d.58.18.6 (A:2-77) Acetolactate synthase small subunit, IlvH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pc6a2 d.58.18.6 (A:1-77) Acetolactate synthase small subunit, IlvH {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d2qmwa2 d.58.18.3 (A:185-264) Prephenate dehydratase C-terminal domain {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure