Citrus Sinensis ID: 031532

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------16
MAISTLQKLSSQIHRLPSLSPLSKSLTHRSSATAAPSAKVADRIVHLFAIDPDGQKRPIIGLAGQTLLKALTNSGLIDPASHRLEEIDACSAECEVNIAQEWLDRLPPRSYEEEYVLKRNSRARVLNLHSRLGCQVVLTHDLEGMVVAVPEPRPWDTP
ccHHHHHHHHHHHHccccccccccccccccccccccccccccccEEEEEEcccccEEEEEcccccHHHHHHHHcccccccccccccccccccccEEEEccccccccccccHHHHHHHHcccccccccccccccccEEEcccccccEEEcccccccccc
cHHHHHHHHHHHHcccccccccccccEccccccccccccccccEEEEEEEcccccEEEEEccccHHHHHHHHHcccccccccccccccccccEEEEEEcHHHHHHcccccHHHHHHHHHHHcccccccccccEEEEEEccHcccEEEEcccccccccc
MAISTLQKLSSqihrlpslsplskslthrssataapsakVADRIVHLFaidpdgqkrpiigLAGQTLLKALtnsglidpashrleeIDACSAECEVNIAQEwldrlpprsyeeEYVLKRNSRARVLNLHSRLGCQVVLTHDLEgmvvavpeprpwdtp
MAISTLQKLSSQIHRLPSLSPLSKSLTHRSSAtaapsakvaDRIVHLFAidpdgqkrPIIGLAGQTLLKALTNSGLIDPASHRLEEIDACSAECEVNIAqewldrlpprsYEEEYVLKRNSRARVLNLHSRLGCQVvlthdlegmvvavpeprpwdtp
MAISTLQKLSSQIHRlpslsplskslTHRSSATAAPSAKVADRIVHLFAIDPDGQKRPIIGLAGQTLLKALTNSGLIDPASHRLEEIDACSAECEVNIAQEWLDRLPPRSYEEEYVLKRNSRARVLNLHSRLGCQVVLTHDLEGMVVAVPEPRPWDTP
***************************************VADRIVHLFAIDPDGQKRPIIGLAGQTLLKALTNSGLIDPASHRLEEIDACSAECEVNIAQEWLDRLPPRSYEEEYVLKRNSRARVLNLHSRLGCQVVLTHDLEGMVVAV*********
*********************************************HLFAIDPDGQKRPIIGLAGQTLLKALTNSGLIDPASHRLEEIDACSAECEVNIAQEWLDRLPPRSYEEEYVLKRNSRARVLNLHSRLGCQVVLTHDLEGMVVAVPEPRP****
***********QIHRLPSLSPL****************KVADRIVHLFAIDPDGQKRPIIGLAGQTLLKALTNSGLIDPASHRLEEIDACSAECEVNIAQEWLDRLPPRSYEEEYVLKRNSRARVLNLHSRLGCQVVLTHDLEGMVVAVPEPRPWDTP
********L**QIHRLPSLS*********************DRIVHLFAIDPDGQKRPIIGLAGQTLLKALTNSGLIDPASHRLEEIDACSAECEVNIAQEWLDRLPPRSYEEEYVLKRNSRARVLNLHSRLGCQVVLTHDLEGMVVAVPEPRP****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAISTLQKLSSQIHRLPSLSPLSKSLTHRSSATAAPSAKVADRIVHLFAIDPDGQKRPIIGLAGQTLLKALTNSGLIDPASHRLEEIDACSAECEVNIAQEWLDRLPPRSYEEEYVLKRNSRARVLNLHSRLGCQVVLTHDLEGMVVAVPEPRPWDTP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query158 2.2.26 [Sep-21-2011]
Q9CPW2174 Adrenodoxin-like protein, yes no 0.740 0.672 0.333 7e-08
Q05B51186 Adrenodoxin-like protein, yes no 0.645 0.548 0.351 3e-07
Q6P4F2183 Adrenodoxin-like protein, yes no 0.645 0.557 0.342 5e-07
P37193172 Adrenodoxin-like protein, yes no 0.867 0.796 0.267 3e-06
Q08C57195 Adrenodoxin-like protein, no no 0.740 0.6 0.312 7e-06
P43493107 Rhodocoxin OS=Rhodococcus yes no 0.620 0.915 0.294 1e-05
Q5FWQ0193 Adrenodoxin-like protein, N/A no 0.683 0.559 0.307 3e-05
P00259107 Putidaredoxin OS=Pseudomo yes no 0.620 0.915 0.300 0.0002
P00257186 Adrenodoxin, mitochondria no no 0.670 0.569 0.315 0.0005
>sp|Q9CPW2|ADXL_MOUSE Adrenodoxin-like protein, mitochondrial OS=Mus musculus GN=Fdx1l PE=2 SV=1 Back     alignment and function desciption
 Score = 56.2 bits (134), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 41/123 (33%), Positives = 66/123 (53%), Gaps = 6/123 (4%)

Query: 29  RSSATAAPSAKVADRIVHLFAIDPDGQKRPIIGLAGQTLLKALTNSGLIDPASHRLEEID 88
           R+   AA S ++   +V++  +D  G++ P+ G  G  +L      G+    +   E   
Sbjct: 43  RAGEEAADSPELPRDVVNVVFVDRSGKRIPVRGKVGDNVLYLAQRHGVDLEGA--CEASL 100

Query: 89  ACSAECEVNIAQEWLDRLPPRSYEEEYVLKRNSRARVLNLHSRLGCQVVLTHDLEGMVVA 148
           ACS  C V +++  LD LPP    E+ +L     A +L  +SRLGCQ+VLT +LEG+  A
Sbjct: 101 ACST-CHVYVSEAHLDLLPPPEEREDDML---DMAPLLQENSRLGCQIVLTPELEGVEFA 156

Query: 149 VPE 151
           +P+
Sbjct: 157 LPK 159

Mus musculus (taxid: 10090)
>sp|Q05B51|ADXL_BOVIN Adrenodoxin-like protein, mitochondrial OS=Bos taurus GN=FDX1L PE=2 SV=1 Back     alignment and function description
>sp|Q6P4F2|ADXL_HUMAN Adrenodoxin-like protein, mitochondrial OS=Homo sapiens GN=FDX1L PE=1 SV=1 Back     alignment and function description
>sp|P37193|ADXH_DROME Adrenodoxin-like protein, mitochondrial OS=Drosophila melanogaster GN=Fdxh PE=2 SV=3 Back     alignment and function description
>sp|Q08C57|ADXL_DANRE Adrenodoxin-like protein, mitochondrial OS=Danio rerio GN=fdx1l PE=2 SV=1 Back     alignment and function description
>sp|P43493|THCC_RHOER Rhodocoxin OS=Rhodococcus erythropolis GN=thcC PE=1 SV=2 Back     alignment and function description
>sp|Q5FWQ0|ADXL_XENLA Adrenodoxin-like protein, mitochondrial OS=Xenopus laevis GN=fdx1l PE=2 SV=1 Back     alignment and function description
>sp|P00259|PUTX_PSEPU Putidaredoxin OS=Pseudomonas putida GN=camB PE=1 SV=3 Back     alignment and function description
>sp|P00257|ADX_BOVIN Adrenodoxin, mitochondrial OS=Bos taurus GN=FDX1 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query158
224065308158 predicted protein [Populus trichocarpa] 1.0 1.0 0.803 2e-69
224132022152 predicted protein [Populus trichocarpa] 0.962 1.0 0.810 2e-67
356527279158 PREDICTED: adrenodoxin-like protein, mit 0.993 0.993 0.745 1e-61
18397961159 2Fe-2S ferredoxin-like protein [Arabidop 0.962 0.955 0.712 2e-59
449462439164 PREDICTED: adrenodoxin-like protein, mit 0.987 0.951 0.638 1e-52
357504857154 Ferredoxin [Medicago truncatula] gi|3554 0.968 0.993 0.675 2e-52
388496842154 unknown [Medicago truncatula] 0.962 0.987 0.670 5e-52
359494751163 PREDICTED: adrenodoxin-like protein, mit 0.981 0.950 0.647 5e-52
359480389163 PREDICTED: adrenodoxin-like protein, mit 0.981 0.950 0.647 2e-51
147789508163 hypothetical protein VITISV_032269 [Viti 0.981 0.950 0.641 2e-51
>gi|224065308|ref|XP_002301767.1| predicted protein [Populus trichocarpa] gi|222843493|gb|EEE81040.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  266 bits (680), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 127/158 (80%), Positives = 143/158 (90%)

Query: 1   MAISTLQKLSSQIHRLPSLSPLSKSLTHRSSATAAPSAKVADRIVHLFAIDPDGQKRPII 60
           MA S+L +LSSQI+R+PSLSP +KS+  RSSAT   +AKVADRIV L AIDPDGQKR I+
Sbjct: 1   MATSSLHRLSSQINRIPSLSPFTKSILTRSSATTTSAAKVADRIVKLSAIDPDGQKREIV 60

Query: 61  GLAGQTLLKALTNSGLIDPASHRLEEIDACSAECEVNIAQEWLDRLPPRSYEEEYVLKRN 120
           GL+G TLLKALTN+GLIDPASHRLEEI+ACSAECEVNIAQEWL++LPPRSY+EEYVLKRN
Sbjct: 61  GLSGHTLLKALTNNGLIDPASHRLEEIEACSAECEVNIAQEWLEKLPPRSYDEEYVLKRN 120

Query: 121 SRARVLNLHSRLGCQVVLTHDLEGMVVAVPEPRPWDTP 158
           SRARVLN HSRLGCQVVLT DL+GMVVAVPEP+PWD P
Sbjct: 121 SRARVLNKHSRLGCQVVLTKDLQGMVVAVPEPKPWDIP 158

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224132022|ref|XP_002321236.1| predicted protein [Populus trichocarpa] gi|118484792|gb|ABK94264.1| unknown [Populus trichocarpa] gi|222862009|gb|EEE99551.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356527279|ref|XP_003532239.1| PREDICTED: adrenodoxin-like protein, mitochondrial-like [Glycine max] Back     alignment and taxonomy information
>gi|18397961|ref|NP_566309.1| 2Fe-2S ferredoxin-like protein [Arabidopsis thaliana] gi|297829298|ref|XP_002882531.1| electron carrier/ iron ion binding protein [Arabidopsis lyrata subsp. lyrata] gi|6041858|gb|AAF02167.1|AC009853_27 unknown protein [Arabidopsis thaliana] gi|14423424|gb|AAK62394.1|AF386949_1 Unknown protein [Arabidopsis thaliana] gi|20148369|gb|AAM10075.1| unknown protein [Arabidopsis thaliana] gi|21555779|gb|AAM63932.1| unknown [Arabidopsis thaliana] gi|297328371|gb|EFH58790.1| electron carrier/ iron ion binding protein [Arabidopsis lyrata subsp. lyrata] gi|332641027|gb|AEE74548.1| 2Fe-2S ferredoxin-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449462439|ref|XP_004148948.1| PREDICTED: adrenodoxin-like protein, mitochondrial-like [Cucumis sativus] gi|449522097|ref|XP_004168064.1| PREDICTED: adrenodoxin-like protein, mitochondrial-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|357504857|ref|XP_003622717.1| Ferredoxin [Medicago truncatula] gi|355497732|gb|AES78935.1| Ferredoxin [Medicago truncatula] Back     alignment and taxonomy information
>gi|388496842|gb|AFK36487.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|359494751|ref|XP_003634833.1| PREDICTED: adrenodoxin-like protein, mitochondrial-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359480389|ref|XP_003632445.1| PREDICTED: adrenodoxin-like protein, mitochondrial-like isoform 1 [Vitis vinifera] gi|359480391|ref|XP_003632446.1| PREDICTED: adrenodoxin-like protein, mitochondrial-like isoform 2 [Vitis vinifera] Back     alignment and taxonomy information
>gi|147789508|emb|CAN67590.1| hypothetical protein VITISV_032269 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query158
TAIR|locus:2079611159 AT3G07480 [Arabidopsis thalian 0.962 0.955 0.681 6.3e-53
MGI|MGI:1915415174 Fdx1l "ferredoxin 1-like" [Mus 0.835 0.758 0.311 2.2e-11
RGD|1561264174 Fdx1l "ferredoxin 1-like" [Rat 0.835 0.758 0.304 9.4e-11
UNIPROTKB|Q05B51186 FDX1L "Adrenodoxin-like protei 0.645 0.548 0.351 1.5e-10
UNIPROTKB|Q6P4F2183 FDX1L "Adrenodoxin-like protei 0.645 0.557 0.351 2e-10
UNIPROTKB|F1S3K4186 LOC100526209 "Uncharacterized 0.645 0.548 0.351 2e-10
UNIPROTKB|K7GN28183 LOC100526209 "Uncharacterized 0.645 0.557 0.351 2e-10
TIGR_CMR|NSE_0297111 NSE_0297 "iron-sulfur cluster 0.601 0.855 0.376 2.5e-10
UNIPROTKB|E2RM76186 FDX1L "Uncharacterized protein 0.645 0.548 0.361 5.2e-10
ZFIN|ZDB-GENE-060929-1046195 fdx1l "ferredoxin 1-like" [Dan 0.740 0.6 0.328 1.8e-09
TAIR|locus:2079611 AT3G07480 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 548 (198.0 bits), Expect = 6.3e-53, P = 6.3e-53
 Identities = 109/160 (68%), Positives = 132/160 (82%)

Query:     4 STLQKLSSQIHRXXXXXXXXXXXTHRSSATAAPSA-----KVADRIVHLFAIDPDGQKRP 58
             +TLQKLSSQIHR             R+SAT+APS      KV+DRIV L AIDPDG K+ 
Sbjct:     3 TTLQKLSSQIHRLSPFTRSLIV---RTSATSAPSPSLGSKKVSDRIVKLSAIDPDGYKQD 59

Query:    59 IIGLAGQTLLKALTNSGLIDPASHRLEEIDACSAECEVNIAQEWLDRLPPRSYEEEYVLK 118
             IIGL+GQTLL+ALT++GLIDPASHRL++I+ACSAECEV IA+EWL++LPPR+Y+EEYVLK
Sbjct:    60 IIGLSGQTLLRALTHTGLIDPASHRLDDIEACSAECEVQIAEEWLEKLPPRTYDEEYVLK 119

Query:   119 RNSRARVLNLHSRLGCQVVLTHDLEGMVVAVPEPRPWDTP 158
             R+SR+R+LN HSRLGCQVVLT +L+GMVVAVPE +PWD P
Sbjct:   120 RSSRSRILNKHSRLGCQVVLTQELQGMVVAVPEAKPWDIP 159
GO:0005739 "mitochondrion" evidence=ISM;IDA
GO:0009055 "electron carrier activity" evidence=IEA
GO:0051536 "iron-sulfur cluster binding" evidence=IEA
GO:0009507 "chloroplast" evidence=IDA
GO:0006511 "ubiquitin-dependent protein catabolic process" evidence=RCA
GO:0009853 "photorespiration" evidence=RCA
GO:0051788 "response to misfolded protein" evidence=RCA
GO:0080129 "proteasome core complex assembly" evidence=RCA
MGI|MGI:1915415 Fdx1l "ferredoxin 1-like" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1561264 Fdx1l "ferredoxin 1-like" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q05B51 FDX1L "Adrenodoxin-like protein, mitochondrial" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q6P4F2 FDX1L "Adrenodoxin-like protein, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1S3K4 LOC100526209 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|K7GN28 LOC100526209 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
TIGR_CMR|NSE_0297 NSE_0297 "iron-sulfur cluster binding protein" [Neorickettsia sennetsu str. Miyayama (taxid:222891)] Back     alignment and assigned GO terms
UNIPROTKB|E2RM76 FDX1L "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060929-1046 fdx1l "ferredoxin 1-like" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query158
PLN02593117 PLN02593, PLN02593, adrenodoxin-like ferredoxin pr 2e-10
COG0633102 COG0633, Fdx, Ferredoxin [Energy production and co 6e-04
PTZ00490143 PTZ00490, PTZ00490, Ferredoxin superfamily; Provis 0.001
TIGR02007110 TIGR02007, fdx_isc, ferredoxin, 2Fe-2S type, ISC s 0.003
>gnl|CDD|178203 PLN02593, PLN02593, adrenodoxin-like ferredoxin protein Back     alignment and domain information 
 Score = 54.3 bits (131), Expect = 2e-10
 Identities = 34/111 (30%), Positives = 55/111 (49%), Gaps = 25/111 (22%)

Query: 50  IDPDGQKRPIIGLAGQTLLKALTNSGLIDPASHRLEEID---------ACSAECEVNIA- 99
           +D DG++R +    G +LL+A          +H   +I+         ACS  C V +  
Sbjct: 6   VDKDGEERTVKAPVGMSLLEA----------AHE-NDIELEGACEGSLACST-CHVIVMD 53

Query: 100 QEWLDRLPPRSYEEEYVLKRNSRARVLNLHSRLGCQVVLTHDLEGMVVAVP 150
           ++  ++LP  + EE  +L     A  L   SRLGCQV+   +L+GM +A+P
Sbjct: 54  EKVYNKLPEPTDEENDML---DLAFGLTETSRLGCQVIAKPELDGMRLALP 101

Length = 117
>gnl|CDD|223706 COG0633, Fdx, Ferredoxin [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|185668 PTZ00490, PTZ00490, Ferredoxin superfamily; Provisional Back     alignment and domain information
>gnl|CDD|131062 TIGR02007, fdx_isc, ferredoxin, 2Fe-2S type, ISC system Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 158
KOG3309159 consensus Ferredoxin [Energy production and conver 99.97
PTZ00490143 Ferredoxin superfamily; Provisional 99.96
PLN02593117 adrenodoxin-like ferredoxin protein 99.95
COG0633102 Fdx Ferredoxin [Energy production and conversion] 99.86
TIGR02007110 fdx_isc ferredoxin, 2Fe-2S type, ISC system. This 99.85
TIGR0200897 fdx_plant ferredoxin [2Fe-2S]. This model represen 99.73
TIGR01941 405 nqrF NADH:ubiquinone oxidoreductase, Na(+)-translo 99.72
CHL0013499 petF ferredoxin; Validated 99.7
PLN03136148 Ferredoxin; Provisional 99.65
PTZ00038191 ferredoxin; Provisional 99.65
PRK05464 409 Na(+)-translocating NADH-quinone reductase subunit 99.61
PRK1071384 2Fe-2S ferredoxin YfaE; Provisional 99.55
COG2871 410 NqrF Na+-transporting NADH:ubiquinone oxidoreducta 99.54
PF0011178 Fer2: 2Fe-2S iron-sulfur cluster binding domain; I 99.54
cd0020784 fer2 2Fe-2S iron-sulfur cluster binding domain. Ir 99.53
PRK11872 340 antC anthranilate dioxygenase reductase; Provision 99.5
PRK07609 339 CDP-6-deoxy-delta-3,4-glucoseen reductase; Validat 99.48
PRK05713 312 hypothetical protein; Provisional 99.47
COG3894 614 Uncharacterized metal-binding protein [General fun 99.43
PRK10684332 HCP oxidoreductase, NADH-dependent; Provisional 99.27
TIGR02160352 PA_CoA_Oxy5 phenylacetate-CoA oxygenase/reductase, 99.24
PF1351082 Fer2_4: 2Fe-2S iron-sulfur cluster binding domain; 98.64
PRK07569 234 bidirectional hydrogenase complex protein HoxU; Va 98.42
PRK08166 847 NADH dehydrogenase subunit G; Validated 98.28
PTZ00305 297 NADH:ubiquinone oxidoreductase; Provisional 97.95
PRK08493 819 NADH dehydrogenase subunit G; Validated 97.87
PRK06259 486 succinate dehydrogenase/fumarate reductase iron-su 97.61
PRK09908159 xanthine dehydrogenase subunit XdhC; Provisional 97.53
PLN00129 276 succinate dehydrogenase [ubiquinone] iron-sulfur s 97.45
PRK07860 797 NADH dehydrogenase subunit G; Validated 97.43
PRK11433217 aldehyde oxidoreductase 2Fe-2S subunit; Provisiona 97.39
PRK09130 687 NADH dehydrogenase subunit G; Validated 97.35
PRK12814 652 putative NADPH-dependent glutamate synthase small 97.35
COG1034 693 NuoG NADH dehydrogenase/NADH:ubiquinone oxidoreduc 97.32
PRK12577 329 succinate dehydrogenase iron-sulfur subunit; Provi 97.18
PRK09129 776 NADH dehydrogenase subunit G; Validated 97.07
TIGR03193148 4hydroxCoAred 4-hydroxybenzoyl-CoA reductase, gamm 97.04
PF13085110 Fer2_3: 2Fe-2S iron-sulfur cluster binding domain; 96.96
COG2080156 CoxS Aerobic-type carbon monoxide dehydrogenase, s 96.9
PRK08640 249 sdhB succinate dehydrogenase iron-sulfur subunit; 96.86
TIGR01973 603 NuoG NADH-quinone oxidoreductase, chain G. This mo 96.79
PRK12385 244 fumarate reductase iron-sulfur subunit; Provisiona 96.7
PRK13552 239 frdB fumarate reductase iron-sulfur subunit; Provi 96.69
COG3383 978 Uncharacterized anaerobic dehydrogenase [General f 96.47
TIGR03198151 pucE xanthine dehydrogenase E subunit. This gene h 96.43
COG0479 234 FrdB Succinate dehydrogenase/fumarate reductase, F 96.04
PRK07570 250 succinate dehydrogenase/fumarate reductase iron-su 95.95
PRK12576 279 succinate dehydrogenase iron-sulfur subunit; Provi 95.92
PRK05950 232 sdhB succinate dehydrogenase iron-sulfur subunit; 95.45
PRK12386 251 fumarate reductase iron-sulfur subunit; Provisiona 95.22
PRK09800 956 putative hypoxanthine oxidase; Provisional 95.21
TIGR02963 467 xanthine_xdhA xanthine dehydrogenase, small subuni 95.01
TIGR00384220 dhsB succinate dehydrogenase and fumarate reductas 94.75
TIGR03313 951 Se_sel_red_Mo probable selenate reductase, molybde 94.35
PRK12575 235 succinate dehydrogenase iron-sulfur subunit; Provi 94.06
PLN00192 1344 aldehyde oxidase 92.31
TIGR02969 1330 mam_aldehyde_ox aldehyde oxidase. Members of this 91.76
TIGR03311 848 Se_dep_Molyb_1 selenium-dependent molybdenum hydro 91.32
TIGR01372 985 soxA sarcosine oxidase, alpha subunit family, hete 91.13
KOG2282 708 consensus NADH-ubiquinone oxidoreductase, NDUFS1/7 84.69
>KOG3309 consensus Ferredoxin [Energy production and conversion] Back     alignment and domain information 
Probab=99.97  E-value=2.6e-30  Score=196.60  Aligned_cols=141  Identities=40%  Similarity=0.565  Sum_probs=112.9

Q ss_pred             hHHHhhhccccCCCcccccccccccCccc--c-CCCCCCCCcceEEEEECCCCCEEEEEecCCchHHHHHHHCCCCCCCc
Q 031532            5 TLQKLSSQIHRLPSLSPLSKSLTHRSSAT--A-APSAKVADRIVHLFAIDPDGQKRPIIGLAGQTLLKALTNSGLIDPAS   81 (158)
Q Consensus         5 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~-~~~~~~~~~m~~Vt~v~~~G~~~~v~~~~G~tLlea~~~~gii~~~~   81 (158)
                      +++.|+++.+++...... ..|...+++.  + ....++.+  ++|+|+++||.+..+++..|+|||+++.+++|..  .
T Consensus         4 ~~~~~~~~~~~~a~~~~~-~~f~~~~t~~~~~~~~~~~~e~--i~Itfv~~dG~~~~i~g~vGdtlLd~ah~n~idl--e   78 (159)
T KOG3309|consen    4 ALQKLSSQISRLAPFTRN-HIFRTSSTSEFSPSKGPRKVED--IKITFVDPDGEEIKIKGKVGDTLLDAAHENNLDL--E   78 (159)
T ss_pred             ccchhhcchhhccccccc-eeeccCcccccccccCCCCCce--EEEEEECCCCCEEEeeeecchHHHHHHHHcCCCc--c
Confidence            355666666665543332 2333222111  1 23333333  9999999999999999999999999999999932  2


Q ss_pred             CCCCCcccCCCccEEEEcCCCccCCCCCCHHHHHhhhcccccccCCCCcEEeeceEEecCCCccEEEeCCCCC
Q 031532           82 HRLEEIDACSAECEVNIAQEWLDRLPPRSYEEEYVLKRNSRARVLNLHSRLGCQVVLTHDLEGMVVAVPEPRP  154 (158)
Q Consensus        82 ~~CgG~g~CGatC~V~V~~g~~~~l~~~t~~E~~~L~~~~~~~~~~~~sRLACQi~l~~dldG~vI~lp~~~~  154 (158)
                      +.|+|..+|+ ||||+|.+.++++|+++.++|.+||+.   +.+++++|||+||+.+++|||||+|+||+..+
T Consensus        79 GACEgslACS-TCHViv~~~~yekl~ep~DeE~DmLDl---A~gLt~tSRLGCQI~l~keldG~~v~vP~atr  147 (159)
T KOG3309|consen   79 GACEGSLACS-TCHVIVDEEYYEKLPEPEDEENDMLDL---AFGLTETSRLGCQIVLTKELDGMRVAVPEATR  147 (159)
T ss_pred             cccccccccc-ceEEEEcHHHHhcCCCCcchHHHHHHh---hhccccccccceEEEeccccCCcEEECccccc
Confidence            5899999999 999999999999999999999999997   57899999999999999999999999999765

>PTZ00490 Ferredoxin superfamily; Provisional Back     alignment and domain information
>PLN02593 adrenodoxin-like ferredoxin protein Back     alignment and domain information
>COG0633 Fdx Ferredoxin [Energy production and conversion] Back     alignment and domain information
>TIGR02007 fdx_isc ferredoxin, 2Fe-2S type, ISC system Back     alignment and domain information
>TIGR02008 fdx_plant ferredoxin [2Fe-2S] Back     alignment and domain information
>TIGR01941 nqrF NADH:ubiquinone oxidoreductase, Na(+)-translocating, F subunit Back     alignment and domain information
>CHL00134 petF ferredoxin; Validated Back     alignment and domain information
>PLN03136 Ferredoxin; Provisional Back     alignment and domain information
>PTZ00038 ferredoxin; Provisional Back     alignment and domain information
>PRK05464 Na(+)-translocating NADH-quinone reductase subunit F; Provisional Back     alignment and domain information
>PRK10713 2Fe-2S ferredoxin YfaE; Provisional Back     alignment and domain information
>COG2871 NqrF Na+-transporting NADH:ubiquinone oxidoreductase, subunit NqrF [Energy production and conversion] Back     alignment and domain information
>PF00111 Fer2: 2Fe-2S iron-sulfur cluster binding domain; InterPro: IPR001041 The ferredoxin protein family are electron carrier proteins with an iron-sulphur cofactor that act in a wide variety of metabolic reactions Back     alignment and domain information
>cd00207 fer2 2Fe-2S iron-sulfur cluster binding domain Back     alignment and domain information
>PRK11872 antC anthranilate dioxygenase reductase; Provisional Back     alignment and domain information
>PRK07609 CDP-6-deoxy-delta-3,4-glucoseen reductase; Validated Back     alignment and domain information
>PRK05713 hypothetical protein; Provisional Back     alignment and domain information
>COG3894 Uncharacterized metal-binding protein [General function prediction only] Back     alignment and domain information
>PRK10684 HCP oxidoreductase, NADH-dependent; Provisional Back     alignment and domain information
>TIGR02160 PA_CoA_Oxy5 phenylacetate-CoA oxygenase/reductase, PaaK subunit Back     alignment and domain information
>PF13510 Fer2_4: 2Fe-2S iron-sulfur cluster binding domain; PDB: 1Y56_A 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A Back     alignment and domain information
>PRK07569 bidirectional hydrogenase complex protein HoxU; Validated Back     alignment and domain information
>PRK08166 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>PTZ00305 NADH:ubiquinone oxidoreductase; Provisional Back     alignment and domain information
>PRK08493 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>PRK06259 succinate dehydrogenase/fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK09908 xanthine dehydrogenase subunit XdhC; Provisional Back     alignment and domain information
>PLN00129 succinate dehydrogenase [ubiquinone] iron-sulfur subunit Back     alignment and domain information
>PRK07860 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>PRK11433 aldehyde oxidoreductase 2Fe-2S subunit; Provisional Back     alignment and domain information
>PRK09130 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>COG1034 NuoG NADH dehydrogenase/NADH:ubiquinone oxidoreductase 75 kD subunit (chain G) [Energy production and conversion] Back     alignment and domain information
>PRK12577 succinate dehydrogenase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK09129 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>TIGR03193 4hydroxCoAred 4-hydroxybenzoyl-CoA reductase, gamma subunit Back     alignment and domain information
>PF13085 Fer2_3: 2Fe-2S iron-sulfur cluster binding domain; PDB: 3P4Q_N 1KFY_N 3CIR_N 3P4R_B 2B76_N 1KF6_B 3P4P_N 3P4S_B 1L0V_B 1ZOY_B Back     alignment and domain information
>COG2080 CoxS Aerobic-type carbon monoxide dehydrogenase, small subunit CoxS/CutS homologs [Energy production and conversion] Back     alignment and domain information
>PRK08640 sdhB succinate dehydrogenase iron-sulfur subunit; Reviewed Back     alignment and domain information
>TIGR01973 NuoG NADH-quinone oxidoreductase, chain G Back     alignment and domain information
>PRK12385 fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK13552 frdB fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>COG3383 Uncharacterized anaerobic dehydrogenase [General function prediction only] Back     alignment and domain information
>TIGR03198 pucE xanthine dehydrogenase E subunit Back     alignment and domain information
>COG0479 FrdB Succinate dehydrogenase/fumarate reductase, Fe-S protein subunit [Energy production and conversion] Back     alignment and domain information
>PRK07570 succinate dehydrogenase/fumarate reductase iron-sulfur subunit; Validated Back     alignment and domain information
>PRK12576 succinate dehydrogenase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK05950 sdhB succinate dehydrogenase iron-sulfur subunit; Reviewed Back     alignment and domain information
>PRK12386 fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK09800 putative hypoxanthine oxidase; Provisional Back     alignment and domain information
>TIGR02963 xanthine_xdhA xanthine dehydrogenase, small subunit Back     alignment and domain information
>TIGR00384 dhsB succinate dehydrogenase and fumarate reductase iron-sulfur protein Back     alignment and domain information
>TIGR03313 Se_sel_red_Mo probable selenate reductase, molybdenum-binding subunit Back     alignment and domain information
>PRK12575 succinate dehydrogenase iron-sulfur subunit; Provisional Back     alignment and domain information
>PLN00192 aldehyde oxidase Back     alignment and domain information
>TIGR02969 mam_aldehyde_ox aldehyde oxidase Back     alignment and domain information
>TIGR03311 Se_dep_Molyb_1 selenium-dependent molybdenum hydroxylase 1 Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>KOG2282 consensus NADH-ubiquinone oxidoreductase, NDUFS1/75 kDa subunit [Energy production and conversion] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query158
2y5c_A109 Structure Of Human Ferredoxin 2 (Fdx2)in Complex Wi 3e-08
1oqq_A106 Crystal Structure Of C73sC85S MUTANT OF PUTIDAREDOX 3e-06
1oqr_A106 Crystal Structure Of C73s Mutant Of Putidaredoxin, 5e-06
1gpx_A106 C85s Gapdx, Nmr, 20 Structures Length = 106 9e-06
1r7s_A106 Putidaredoxin (Fe2s2 Ferredoxin), C73g Mutant Lengt 1e-05
1put_A106 An Nmr-Derived Model For The Solution Structure Of 1e-05
1pdx_A106 Putidaredoxin Length = 106 1e-05
1l6v_A128 Structure Of Reduced Bovine Adrenodoxin Length = 12 6e-05
1cje_A127 Adrenodoxin From Bovine Length = 127 6e-05
1l6u_A128 Nmr Structure Of Oxidized Adrenodoxin Length = 128 6e-05
1e6e_B128 Adrenodoxin ReductaseADRENODOXIN COMPLEX OF MITOCHO 6e-05
3p1m_A132 Crystal Structure Of Human Ferredoxin-1 (Fdx1) In C 9e-05
2bt6_A108 Ru(Bpy)2(Mbpy)-Modified Bovine Adrenodoxin Length = 9e-05
3n9z_C123 Crystal Structure Of Human Cyp11a1 In Complex With 1e-04
3n9y_C114 Crystal Structure Of Human Cyp11a1 In Complex With 1e-04
1ayf_A105 Bovine Adrenodoxin (oxidized) Length = 105 1e-04
2wlb_A103 Adrenodoxin-Like Ferredoxin Etp1fd(516-618) Of Schi 1e-04
3lxf_A104 Crystal Structure Of [2fe-2s] Ferredoxin Arx From N 1e-04
2jqr_B105 Solution Model Of Crosslinked Complex Of Cytochrome 2e-04
>pdb|2Y5C|A Chain A, Structure Of Human Ferredoxin 2 (Fdx2)in Complex With 2fe2s Cluster Length = 109 Back     alignment and structure 
Iteration: 1

 Score = 54.3 bits (129), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 38/112 (33%), Positives = 59/112 (52%), Gaps = 6/112 (5%)
Query: 40  VADRIVHLFAIDPDGQKRPIIGLAGQTLLKALTNSGLIDPASHRLEEIDACSAECEVNIA 99
           +A  +V++  +D  GQ+ P+ G  G  +L      G+        E   ACS  C V ++
Sbjct: 1   MASDVVNVVFVDRSGQRIPVSGRVGDNVLHLAQRHGV--DLEGACEASLACST-CHVYVS 57
Query: 100 QEWLDRLPPRSYEEEYVLKRNSRARVLNLHSRLGCQVVLTHDLEGMVVAVPE 151
           ++ LD LPP    E+ +L     A +L  +SRLGCQ+VLT +LEG    +P+
Sbjct: 58  EDHLDLLPPPEEREDDMLDM---APLLQENSRLGCQIVLTPELEGAEFTLPK 106
>pdb|1OQQ|A Chain A, Crystal Structure Of C73sC85S MUTANT OF PUTIDAREDOXIN, A [2FE-2s] Ferredoxin From Pseudomonas Putida, At 1.47a Resolution Length = 106 Back     alignment and structure
>pdb|1OQR|A Chain A, Crystal Structure Of C73s Mutant Of Putidaredoxin, A [2fe- 2s] Ferredoxin From Pseudomonas Putida, At 1.65a Resolution Length = 106 Back     alignment and structure
>pdb|1GPX|A Chain A, C85s Gapdx, Nmr, 20 Structures Length = 106 Back     alignment and structure
>pdb|1R7S|A Chain A, Putidaredoxin (Fe2s2 Ferredoxin), C73g Mutant Length = 106 Back     alignment and structure
>pdb|1PUT|A Chain A, An Nmr-Derived Model For The Solution Structure Of Oxidized Putidaredoxin, A 2fe, 2-S Ferredoxin From Pseudomonas Length = 106 Back     alignment and structure
>pdb|1PDX|A Chain A, Putidaredoxin Length = 106 Back     alignment and structure
>pdb|1L6V|A Chain A, Structure Of Reduced Bovine Adrenodoxin Length = 128 Back     alignment and structure
>pdb|1CJE|A Chain A, Adrenodoxin From Bovine Length = 127 Back     alignment and structure
>pdb|1L6U|A Chain A, Nmr Structure Of Oxidized Adrenodoxin Length = 128 Back     alignment and structure
>pdb|1E6E|B Chain B, Adrenodoxin ReductaseADRENODOXIN COMPLEX OF MITOCHONDRIAL P450 Systems Length = 128 Back     alignment and structure
>pdb|3P1M|A Chain A, Crystal Structure Of Human Ferredoxin-1 (Fdx1) In Complex With Iron- Sulfur Cluster Length = 132 Back     alignment and structure
>pdb|2BT6|A Chain A, Ru(Bpy)2(Mbpy)-Modified Bovine Adrenodoxin Length = 108 Back     alignment and structure
>pdb|3N9Z|C Chain C, Crystal Structure Of Human Cyp11a1 In Complex With 22- Hydroxycholesterol Length = 123 Back     alignment and structure
>pdb|3N9Y|C Chain C, Crystal Structure Of Human Cyp11a1 In Complex With Cholesterol Length = 114 Back     alignment and structure
>pdb|1AYF|A Chain A, Bovine Adrenodoxin (oxidized) Length = 105 Back     alignment and structure
>pdb|2WLB|A Chain A, Adrenodoxin-Like Ferredoxin Etp1fd(516-618) Of Schizosaccharomyces Pombe Mitochondria Length = 103 Back     alignment and structure
>pdb|3LXF|A Chain A, Crystal Structure Of [2fe-2s] Ferredoxin Arx From Novosphingobium Aromaticivorans Length = 104 Back     alignment and structure
>pdb|2JQR|B Chain B, Solution Model Of Crosslinked Complex Of Cytochrome C And Adrenodoxin Length = 105 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query158
1uwm_A106 Ferredoxin VI, FDVI; electron transport, metal-bin 6e-20
3n9z_C123 Adrenodoxin; cytochrome P450, 22-hydroxycholestero 3e-19
2bt6_A108 Adrenodoxin 1; ruthenium(II) bipyridyl complex, in 4e-19
1xlq_A106 Putidaredoxin, PDX; [2Fe-2S], ferredoxin, oxidored 4e-19
1b9r_A105 Protein (terpredoxin); structure from molmol, ferr 7e-19
2y5c_A109 Adrenodoxin-like protein, mitochondrial; electron 1e-18
3lxf_A104 Ferredoxin; iron, iron-sulfur, metal-binding, meta 2e-18
2wlb_A103 ETP1-FD, electron transfer protein 1, mitochondria 3e-18
3hui_A126 Ferredoxin; cytochrome P450, electron transfer, ir 4e-18
1l5p_A93 Ferredoxin; [2Fe-2S] cluster, electron transfer, i 6e-12
3ah7_A113 [2Fe-2S]ferredoxin; [2Fe-2S] cluster, iron-sulfur 1e-09
1i7h_A111 Ferredoxin; 2Fe-2S,electron transport; 1.70A {Esch 3e-09
>1uwm_A Ferredoxin VI, FDVI; electron transport, metal-binding, iron-sulfur, iron, 2Fe-2S; 2.0A {Rhodobacter capsulatus} SCOP: d.15.4.1 PDB: 1e9m_A Length = 106 Back     alignment and structure
 Score = 78.4 bits (194), Expect = 6e-20
 Identities = 28/108 (25%), Positives = 50/108 (46%), Gaps = 16/108 (14%)

Query: 50  IDPDGQKRPIIGLAGQTLLKALTNSGLIDPASHRLEEIDA-----CS-AECEVNIAQEWL 103
           I+ +G +  +    G T+++A  ++G+          IDA     C+ + C   +   W+
Sbjct: 6   IEHNGTRHEVEAKPGLTVMEAARDNGV--------PGIDADCGGACACSTCHAYVDPAWV 57

Query: 104 DRLPPRSYEEEYVLKRNSRARVLNLHSRLGCQVVLTHDLEGMVVAVPE 151
           D+LP     E  ++            SRL CQ+ +T  L+G+VV +PE
Sbjct: 58  DKLPKALPTETDMIDFAYEPNPAT--SRLTCQIKVTSLLDGLVVHLPE 103
>3n9z_C Adrenodoxin; cytochrome P450, 22-hydroxycholesterol, cholesterol SIDE CHA cleavage, structural genomics; HET: HEM HC9; 2.17A {Homo sapiens} PDB: 3na1_C* 3p1m_A* 1l6u_A 1l6v_A 1e6e_B* 1cje_A Length = 123 Back     alignment and structure
>2bt6_A Adrenodoxin 1; ruthenium(II) bipyridyl complex, intramolecular electron TRA electron transport, metal-binding; HET: RUA; 1.50A {Bos taurus} SCOP: d.15.4.1 PDB: 1ayf_A 3n9y_C* 2jqr_B* 3na0_C* Length = 108 Back     alignment and structure
>1xlq_A Putidaredoxin, PDX; [2Fe-2S], ferredoxin, oxidoreductase; 1.45A {Pseudomonas putida} SCOP: d.15.4.1 PDB: 1xlp_A 1oqr_A 1r7s_A 1pdx_A 1yji_A 1yjj_A 1oqq_A 1xln_A 1xlo_A 3lb8_C* 1put_A 1gpx_A Length = 106 Back     alignment and structure
>1b9r_A Protein (terpredoxin); structure from molmol, ferredoxin; NMR {Pseudomonas SP} SCOP: d.15.4.1 Length = 105 Back     alignment and structure
>2y5c_A Adrenodoxin-like protein, mitochondrial; electron transport, iron-sulfur cluster biogenesis; 1.70A {Homo sapiens} Length = 109 Back     alignment and structure
>3lxf_A Ferredoxin; iron, iron-sulfur, metal-binding, metal protein; 2.30A {Novosphingobium aromaticivorans} Length = 104 Back     alignment and structure
>2wlb_A ETP1-FD, electron transfer protein 1, mitochondrial; iron-sulfur, iron, transport, ferredoxin, adrenodoxin-like, electron transport; 2.60A {Schizosaccharomyces pombe} Length = 103 Back     alignment and structure
>3hui_A Ferredoxin; cytochrome P450, electron transfer, iron, iron-sulfur, metal-binding, electron transport; 2.01A {Rhodopseudomonas palustris} Length = 126 Back     alignment and structure
>1l5p_A Ferredoxin; [2Fe-2S] cluster, electron transfer, iron-sulfur protein, metalloprotein, oxidoreductase; 2.20A {Trichomonas vaginalis} SCOP: d.15.4.1 Length = 93 Back     alignment and structure
>3ah7_A [2Fe-2S]ferredoxin; [2Fe-2S] cluster, iron-sulfur cluster biosynthes pseudomonas, metal binding protein; 1.90A {Pseudomonas putida} Length = 113 Back     alignment and structure
>1i7h_A Ferredoxin; 2Fe-2S,electron transport; 1.70A {Escherichia coli} SCOP: d.15.4.1 Length = 111 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query158
3hui_A126 Ferredoxin; cytochrome P450, electron transfer, ir 99.97
2bt6_A108 Adrenodoxin 1; ruthenium(II) bipyridyl complex, in 99.96
3lxf_A104 Ferredoxin; iron, iron-sulfur, metal-binding, meta 99.96
2y5c_A109 Adrenodoxin-like protein, mitochondrial; electron 99.96
3n9z_C123 Adrenodoxin; cytochrome P450, 22-hydroxycholestero 99.96
1xlq_A106 Putidaredoxin, PDX; [2Fe-2S], ferredoxin, oxidored 99.95
1uwm_A106 Ferredoxin VI, FDVI; electron transport, metal-bin 99.94
1b9r_A105 Protein (terpredoxin); structure from molmol, ferr 99.94
2wlb_A103 ETP1-FD, electron transfer protein 1, mitochondria 99.93
3ah7_A113 [2Fe-2S]ferredoxin; [2Fe-2S] cluster, iron-sulfur 99.91
1l5p_A93 Ferredoxin; [2Fe-2S] cluster, electron transfer, i 99.88
1i7h_A111 Ferredoxin; 2Fe-2S,electron transport; 1.70A {Esch 99.87
1jq4_A98 Methane monooxygenase component C; [2Fe-2S] ferred 99.79
1czp_A98 Ferredoxin I; [2Fe-2S] protein, crystal reduced wi 99.77
1frr_A95 Ferredoxin I; electron transfer(iron-sulfur protei 99.76
1a70_A97 Ferredoxin; iron-sulfur protein, photosynthesis, e 99.76
1awd_A94 Ferredoxin; electron transport, eukaryotic, green 99.75
1frd_A98 Heterocyst [2Fe-2S] ferredoxin; electron transport 99.75
1iue_A98 Ferredoxin; electron transport, iron-sulfur; 1.70A 99.74
1wri_A93 Ferredoxin II, ferredoxin; electron transport; 1.2 99.73
1krh_A 338 Benzoate 1,2-dioxygenase reductase; alpha-beta, FA 99.72
1doi_A128 2Fe-2S ferredoxin; halophilic protein, redox prote 99.64
3zyy_X 631 Iron-sulfur cluster binding protein; iron-sulfur-b 99.62
2pia_A321 Phthalate dioxygenase reductase; HET: FMN; 2.00A { 99.43
3i9v_3 783 NADH-quinone oxidoreductase subunit 3; electron tr 98.22
3c8y_A 574 Iron hydrogenase 1; dithiomethylether, H-cluster, 97.99
1kf6_B 243 Fumarate reductase iron-sulfur protein; respiratio 97.97
1t3q_A168 Quinoline 2-oxidoreductase small subunit; QOR, mol 97.94
1ffv_A163 CUTS, iron-sulfur protein of carbon monoxide dehyd 97.73
3hrd_D160 Nicotinate dehydrogenase small FES subunit; seleni 97.72
1n62_A166 Carbon monoxide dehydrogenase small chain; CODH, m 97.71
1rm6_C161 4-hydroxybenzoyl-COA reductase gamma subunit; xant 97.63
2bs2_B 241 Quinol-fumarate reductase iron-sulfur subunit B; 2 96.91
2h88_B 252 Succinate dehydrogenase IP subunit; complex II, me 96.76
3nvw_A164 Xanthine dehydrogenase/oxidase; hydroxylase, homod 96.51
2w3s_A 462 Xanthine dehydrogenase; XO, XDH, GOUT, iron, 2Fe-2 96.36
2wdq_B 238 Succinate dehydrogenase iron-sulfur subunit; succi 96.24
3vr8_B 282 Iron-sulfur subunit of succinate dehydrogenase; me 96.2
1vlb_A 907 Aldehyde oxidoreductase; iron-sulphur cluster; HET 96.16
1dgj_A 907 Aldehyde oxidoreductase; beta half-barrel, four-he 96.0
1y56_A 493 Hypothetical protein PH1363; dehydrogenase, protei 92.6
3unc_A 1332 Xanthine dehydrogenase/oxidase; oxidoreductase; HE 91.05
1uh6_A100 Ubiquitin-like 5; beta-grAsp fold, structural geno 89.56
3plu_A93 Ubiquitin-like modifier HUB1; ubiquitin-like, HUB- 86.17
3u7z_A101 Putative metal binding protein rumgna_00854; the b 84.2
2al3_A90 TUG long isoform; TUG UBL1 insulin, endocytosis/ex 83.34
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 81.33
>3hui_A Ferredoxin; cytochrome P450, electron transfer, iron, iron-sulfur, metal-binding, electron transport; 2.01A {Rhodopseudomonas palustris} Back     alignment and structure
Probab=99.97  E-value=1.8e-31  Score=198.11  Aligned_cols=114  Identities=22%  Similarity=0.406  Sum_probs=101.8

Q ss_pred             CCCCCCCCcceEEEEECCCCCEEEEEecCCchHHHHHHHCCCCCCCcCCCCCcccCCCccEEEEcCCCccCCCCCCHHHH
Q 031532           35 APSAKVADRIVHLFAIDPDGQKRPIIGLAGQTLLKALTNSGLIDPASHRLEEIDACSAECEVNIAQEWLDRLPPRSYEEE  114 (158)
Q Consensus        35 ~~~~~~~~~m~~Vt~v~~~G~~~~v~~~~G~tLlea~~~~gii~~~~~~CgG~g~CGatC~V~V~~g~~~~l~~~t~~E~  114 (158)
                      .....++++|++|+|++++|.+++|++.+|+|||++++++||. ...+.|+|.|.|| ||+|+|.+||++++++++..|.
T Consensus        12 ~~~~~~~~~M~~Vt~~~~~G~~~~v~~~~G~tLL~aa~~~gi~-gi~~~C~G~G~Cg-tC~v~v~~G~~~~l~~~~~~E~   89 (126)
T 3hui_A           12 SGLVPRGSHMAKINFVDHTGETRTVEVEEGATVMEAAIRNAIP-GVEAECGGACACA-TCHVYVDEAWREKVGGPSPMEE   89 (126)
T ss_dssp             ---CCTTCSEEEEEEECTTSCEEEEEEETTSBHHHHHHTTTCT-TCCCTTSSSSCCS-TTEEEECGGGHHHHCCCCHHHH
T ss_pred             ccccCCCCCceEEEEEeCCCCEEEEEECCCCcHHHHHHHcCCC-CCccCCCCCCCCC-CCEEEECCCcccccCCCCHHHh
Confidence            5778899999999999999998999999999999999999993 1457899999998 9999999998888899999999


Q ss_pred             HhhhcccccccCCCCcEEeeceEEecCCCccEEEeCCCC
Q 031532          115 YVLKRNSRARVLNLHSRLGCQVVLTHDLEGMVVAVPEPR  153 (158)
Q Consensus       115 ~~L~~~~~~~~~~~~sRLACQi~l~~dldG~vI~lp~~~  153 (158)
                      ++|+.   ..++.++||||||+++.+||||++|+||+.+
T Consensus        90 ~~L~~---~~e~~~g~RLaCQ~~~~~dldgl~V~lp~~~  125 (126)
T 3hui_A           90 DMLDF---GYDVRPNSRLSCQIKVSNELDGLIVTTPERQ  125 (126)
T ss_dssp             HHHTT---SSSCCTTEEEGGGCBCCGGGTTEEEECCSCC
T ss_pred             hhcCc---hhhccCCeEEeeeCEECcCCCcEEEEecCcC
Confidence            99984   2688899999999999999999999999864
>2bt6_A Adrenodoxin 1; ruthenium(II) bipyridyl complex, intramolecular electron TRA electron transport, metal-binding; HET: RUA; 1.50A {Bos taurus} SCOP: d.15.4.1 PDB: 1ayf_A 3n9y_C* 2jqr_B* 3na0_C* Back     alignment and structure
>3lxf_A Ferredoxin; iron, iron-sulfur, metal-binding, metal protein; 2.30A {Novosphingobium aromaticivorans} SCOP: d.15.4.0 Back     alignment and structure
>2y5c_A Adrenodoxin-like protein, mitochondrial; electron transport, iron-sulfur cluster biogenesis; 1.70A {Homo sapiens} Back     alignment and structure
>3n9z_C Adrenodoxin; cytochrome P450, 22-hydroxycholesterol, cholesterol SIDE CHA cleavage, structural genomics; HET: HEM HC9; 2.17A {Homo sapiens} SCOP: d.15.4.1 PDB: 3na1_C* 3p1m_A* 1l6u_A 1l6v_A 1e6e_B* 1cje_A Back     alignment and structure
>1xlq_A Putidaredoxin, PDX; [2Fe-2S], ferredoxin, oxidoreductase; 1.45A {Pseudomonas putida} SCOP: d.15.4.1 PDB: 1xlp_A 1oqr_A 1r7s_A 1pdx_A 1yji_A 1yjj_A 1oqq_A 1xln_A 1xlo_A 3lb8_C* 1put_A 1gpx_A Back     alignment and structure
>1uwm_A Ferredoxin VI, FDVI; electron transport, metal-binding, iron-sulfur, iron, 2Fe-2S; 2.0A {Rhodobacter capsulatus} SCOP: d.15.4.1 PDB: 1e9m_A Back     alignment and structure
>1b9r_A Protein (terpredoxin); structure from molmol, ferredoxin; NMR {Pseudomonas SP} SCOP: d.15.4.1 Back     alignment and structure
>2wlb_A ETP1-FD, electron transfer protein 1, mitochondrial; iron-sulfur, iron, transport, ferredoxin, adrenodoxin-like, electron transport; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>3ah7_A [2Fe-2S]ferredoxin; [2Fe-2S] cluster, iron-sulfur cluster biosynthes pseudomonas, metal binding protein; 1.90A {Pseudomonas putida} Back     alignment and structure
>1l5p_A Ferredoxin; [2Fe-2S] cluster, electron transfer, iron-sulfur protein, metalloprotein, oxidoreductase; 2.20A {Trichomonas vaginalis} SCOP: d.15.4.1 Back     alignment and structure
>1i7h_A Ferredoxin; 2Fe-2S,electron transport; 1.70A {Escherichia coli} SCOP: d.15.4.1 Back     alignment and structure
>1jq4_A Methane monooxygenase component C; [2Fe-2S] ferredoxin, oxidoreductase; NMR {Methylococcus capsulatus str} SCOP: d.15.4.2 Back     alignment and structure
>1czp_A Ferredoxin I; [2Fe-2S] protein, crystal reduced with dithionite, electron; 1.17A {Nostoc SP} SCOP: d.15.4.1 PDB: 1ewy_C* 1fxa_A 1qt9_A 1qog_A 1j7c_A 1j7b_A 1qof_A 1qob_A 1j7a_A 1qoa_A 1rfk_A 3p63_A 4fxc_A 3ab5_A 1roe_A 2cjn_A 2cjo_A 1off_A 1dox_A 1doy_A ... Back     alignment and structure
>1frr_A Ferredoxin I; electron transfer(iron-sulfur protein); 1.80A {Equisetum arvense} SCOP: d.15.4.1 Back     alignment and structure
>1a70_A Ferredoxin; iron-sulfur protein, photosynthesis, electron transport; 1.70A {Spinacia oleracea} SCOP: d.15.4.1 PDB: 1pfd_A Back     alignment and structure
>1awd_A Ferredoxin; electron transport, eukaryotic, green ALGA, electron transfer, metalloprotein; 1.40A {'chlorella' fusca} SCOP: d.15.4.1 Back     alignment and structure
>1frd_A Heterocyst [2Fe-2S] ferredoxin; electron transport; 1.70A {Nostoc SP} SCOP: d.15.4.1 Back     alignment and structure
>1iue_A Ferredoxin; electron transport, iron-sulfur; 1.70A {Plasmodium falciparum} SCOP: d.15.4.1 Back     alignment and structure
>1wri_A Ferredoxin II, ferredoxin; electron transport; 1.20A {Equisetum arvense} SCOP: d.15.4.1 Back     alignment and structure
>1krh_A Benzoate 1,2-dioxygenase reductase; alpha-beta, FAD-binding, ferredoxin, NADH-binding, oxidoreductase; HET: FAD; 1.50A {Acinetobacter SP} SCOP: b.43.4.2 c.25.1.2 d.15.4.2 Back     alignment and structure
>1doi_A 2Fe-2S ferredoxin; halophilic protein, redox protein, iron-sulfur, electron transport; 1.90A {Haloarcula marismortui} SCOP: d.15.4.1 PDB: 1e0z_A* 1e10_A Back     alignment and structure
>3zyy_X Iron-sulfur cluster binding protein; iron-sulfur-binding protein, ashka family, ATPase; 2.20A {Carboxydothermus hydrogenoformans} Back     alignment and structure
>2pia_A Phthalate dioxygenase reductase; HET: FMN; 2.00A {Burkholderia cepacia} SCOP: b.43.4.2 c.25.1.2 d.15.4.2 Back     alignment and structure
>3i9v_3 NADH-quinone oxidoreductase subunit 3; electron transport, respiratory chain, cell flavoprotein, FMN, iron, iron-sulfur, membrane; HET: FMN; 3.10A {Thermus thermophilus} PDB: 2ybb_3* 2fug_3* 3iam_3* 3ias_3* 3m9s_3* Back     alignment and structure
>3c8y_A Iron hydrogenase 1; dithiomethylether, H-cluster, iron-sulfur binding, oxidoreductase; HET: HCN; 1.39A {Clostridium pasteurianum} SCOP: c.96.1.1 d.15.4.2 d.58.1.5 PDB: 1c4c_A* 1c4a_A* 1feh_A* Back     alignment and structure
>1kf6_B Fumarate reductase iron-sulfur protein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.1.2.1 d.15.4.2 PDB: 1kfy_B* 1l0v_B* 2b76_B* 3cir_B* 3p4p_B* 3p4q_B* 3p4r_B* 3p4s_B* Back     alignment and structure
>1t3q_A Quinoline 2-oxidoreductase small subunit; QOR, molybdenum, MCD; HET: FAD MCN; 1.80A {Pseudomonas putida} SCOP: a.56.1.1 d.15.4.2 Back     alignment and structure
>1ffv_A CUTS, iron-sulfur protein of carbon monoxide dehydrogenase; hydrolase; HET: ARO PCD FAD; 2.25A {Hydrogenophaga pseudoflava} SCOP: a.56.1.1 d.15.4.2 PDB: 1ffu_A* Back     alignment and structure
>3hrd_D Nicotinate dehydrogenase small FES subunit; selenium ligand, iron, iron-sulfur, metal-binding, oxidoreductase; HET: MCN FAD; 2.20A {Eubacterium barkeri} Back     alignment and structure
>1n62_A Carbon monoxide dehydrogenase small chain; CODH, molybdenum, molybdopterin, oxidoreductase; HET: CUB MCN FAD; 1.09A {Oligotropha carboxidovorans} SCOP: a.56.1.1 d.15.4.2 PDB: 1n5w_A* 1n61_A* 1n60_A* 1n63_A* 1zxi_A* Back     alignment and structure
>1rm6_C 4-hydroxybenzoyl-COA reductase gamma subunit; xanthine oxidase family, dimer heterotrimers, oxidoreductase; HET: PCD FAD SF4 EPE; 1.60A {Thauera aromatica} SCOP: a.56.1.1 d.15.4.2 PDB: 1sb3_C* Back     alignment and structure
>2bs2_B Quinol-fumarate reductase iron-sulfur subunit B; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.1.2.1 d.15.4.2 PDB: 2bs3_B* 1e7p_B* 1qlb_B* 2bs4_B* Back     alignment and structure
>2h88_B Succinate dehydrogenase IP subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_B* 1yq3_B* 2fbw_B* 2h89_B* 2wqy_B* 3aef_B* 3abv_B* 3ae1_B* 3ae3_B* 3ae2_B* 3ae5_B* 3ae6_B* 3ae7_B* 3ae8_B* 3ae9_B* 3aea_B* 3aeb_B* 3aec_B* 3aed_B* 3aee_B* ... Back     alignment and structure
>3nvw_A Xanthine dehydrogenase/oxidase; hydroxylase, homodimer, xanthine oxidase, guanine, oxidoredu; HET: FAD MTE GUN; 1.60A {Bos taurus} PDB: 3etr_A* 3ns1_A* 3nvv_A* 3nrz_A* 3nvy_A* 3nvz_A* 3rca_A* 3sr6_A* 3eub_A* Back     alignment and structure
>2w3s_A Xanthine dehydrogenase; XO, XDH, GOUT, iron, 2Fe-2S, iron-sulfur, oxidoreductase, purine metabolism, molybdenum cofactor, hypoxanthine; HET: MPN FAD XAN; 2.60A {Rhodobacter capsulatus} PDB: 2w3r_A* 2w54_A* 2w55_A* 1jro_A* 1jrp_A* Back     alignment and structure
>2wdq_B Succinate dehydrogenase iron-sulfur subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_B* 2acz_B* 1nek_B* 2wdr_B* 2wdv_B* 2ws3_B* 2wu2_B* 2wu5_B* 2wp9_B* Back     alignment and structure
>3vr8_B Iron-sulfur subunit of succinate dehydrogenase; membrane protein, reductase, mitochondria MEMB oxidoreductase; HET: FAD HEM RQX EPH; 2.81A {Ascaris suum} PDB: 3vrb_B* Back     alignment and structure
>1vlb_A Aldehyde oxidoreductase; iron-sulphur cluster; HET: PCD; 1.28A {Desulfovibrio gigas} SCOP: a.56.1.1 d.15.4.2 d.41.1.1 d.133.1.1 PDB: 1sij_A* 1zcs_A* 3fah_A* 3fc4_A* 3l4p_A* Back     alignment and structure
>1dgj_A Aldehyde oxidoreductase; beta half-barrel, four-helix bundle, beta barrel; HET: MCN; 2.80A {Desulfovibrio desulfuricans} SCOP: a.56.1.1 d.15.4.2 d.41.1.1 d.133.1.1 Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>3unc_A Xanthine dehydrogenase/oxidase; oxidoreductase; HET: MTE FAD SAL; 1.65A {Bos taurus} PDB: 3una_A* 3uni_A* 1v97_A* 1fo4_A* 1vdv_A* 3am9_A* 3amz_A* 3ax7_A* 3ax9_A* 3bdj_A* 1n5x_A* 2ckj_A* 2e1q_A* 3an1_A* 2e3t_A* 1wyg_A* 3b9j_B* 1fiq_B* 3b9j_A* 1fiq_A* Back     alignment and structure
>1uh6_A Ubiquitin-like 5; beta-grAsp fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>3plu_A Ubiquitin-like modifier HUB1; ubiquitin-like, HUB-1, SNU66, peptide binding protein; 1.40A {Saccharomyces cerevisiae} PDB: 3plv_A 1m94_A 1p0r_A Back     alignment and structure
>3u7z_A Putative metal binding protein rumgna_00854; the binding protein, transport protein, structural genomics, center for structural genomics; 1.30A {Ruminococcus gnavus} Back     alignment and structure
>2al3_A TUG long isoform; TUG UBL1 insulin, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: d.15.1.2 Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 158
d1xlqa1106 d.15.4.1 (A:1-106) 2Fe-2S ferredoxin {Pseudomonas 2e-23
d2bt6a1104 d.15.4.1 (A:5-108) Adrenodoxin {Cow (Bos taurus) [ 7e-22
d1b9ra_105 d.15.4.1 (A:) 2Fe-2S ferredoxin {Pseudomonas sp., 2e-21
d1e9ma_106 d.15.4.1 (A:) 2Fe-2S ferredoxin {Rhodobacter capsu 1e-20
d1l5pa_93 d.15.4.1 (A:) 2Fe-2S ferredoxin {Trichomonas vagin 3e-12
d1i7ha_109 d.15.4.1 (A:) Adrenodoxin-like ferredoxin {Escheri 7e-12
d2fug3395 d.15.4.2 (3:1-95) Nadh-quinone oxidoreductase chai 4e-05
>d1xlqa1 d.15.4.1 (A:1-106) 2Fe-2S ferredoxin {Pseudomonas putida, putidaredoxin [TaxId: 303]} Length = 106 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-Grasp (ubiquitin-like)
superfamily: 2Fe-2S ferredoxin-like
family: 2Fe-2S ferredoxin-related
domain: 2Fe-2S ferredoxin
species: Pseudomonas putida, putidaredoxin [TaxId: 303]

 Score = 86.6 bits (214), Expect = 2e-23
 Identities = 29/102 (28%), Positives = 54/102 (52%), Gaps = 4/102 (3%)

Query: 50  IDPDGQKRPIIGLAGQTLLKALTNSGLIDPASHRLEEIDACSAECEVNIAQEWLDRLPPR 109
           +  DG +R +    G +L++A  ++G+ D          A  A C V + + + D++P  
Sbjct: 6   VSHDGTRRELDVADGVSLMQAAVSNGIYDIVGDC--GGSASCATCHVYVNEAFTDKVPAA 63

Query: 110 SYEEEYVLKRNSRARVLNLHSRLGCQVVLTHDLEGMVVAVPE 151
           +  E  +L+       L  +SRL CQ+++T +L+G+VV VP+
Sbjct: 64  NEREIGMLES--VTAELKPNSRLCCQIIMTPELDGIVVDVPD 103
>d2bt6a1 d.15.4.1 (A:5-108) Adrenodoxin {Cow (Bos taurus) [TaxId: 9913]} Length = 104 Back     information, alignment and structure
>d1b9ra_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Pseudomonas sp., terpredoxin [TaxId: 306]} Length = 105 Back     information, alignment and structure
>d1e9ma_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Rhodobacter capsulatus, ferredoxin VI [TaxId: 1061]} Length = 106 Back     information, alignment and structure
>d1l5pa_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Trichomonas vaginalis [TaxId: 5722]} Length = 93 Back     information, alignment and structure
>d1i7ha_ d.15.4.1 (A:) Adrenodoxin-like ferredoxin {Escherichia coli [TaxId: 562]} Length = 109 Back     information, alignment and structure
>d2fug33 d.15.4.2 (3:1-95) Nadh-quinone oxidoreductase chain 3, Nqo3, N-terminal domain {Thermus thermophilus [TaxId: 274]} Length = 95 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query158
d1xlqa1106 2Fe-2S ferredoxin {Pseudomonas putida, putidaredox 99.98
d1e9ma_106 2Fe-2S ferredoxin {Rhodobacter capsulatus, ferredo 99.97
d1b9ra_105 2Fe-2S ferredoxin {Pseudomonas sp., terpredoxin [T 99.97
d2bt6a1104 Adrenodoxin {Cow (Bos taurus) [TaxId: 9913]} 99.97
d1l5pa_93 2Fe-2S ferredoxin {Trichomonas vaginalis [TaxId: 5 99.94
d1i7ha_109 Adrenodoxin-like ferredoxin {Escherichia coli [Tax 99.92
d1jq4a_98 Methane monooxygenase reductase N-terminal domain 99.84
d1krha3104 Benzoate dioxygenase reductase, N-terminal domain 99.82
d1a70a_97 2Fe-2S ferredoxin {Spinach (Spinacia oleracea) [Ta 99.77
d1frra_95 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258] 99.77
d2fug3395 Nadh-quinone oxidoreductase chain 3, Nqo3, N-termi 99.76
d1czpa_98 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), 99.76
d1frda_98 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), 99.76
d1iuea_98 2Fe-2S ferredoxin {Malaria parasite (Plasmodium fa 99.75
d1awda_94 2Fe-2S ferredoxin {Chlorella fusca [TaxId: 3073]} 99.74
d1wria_93 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258] 99.6
d2piaa398 Phthalate dioxygenase reductase, C-terminal domain 99.58
d1doia_128 2Fe-2S ferredoxin {Archaeon Haloarcula marismortui 99.5
d3c8ya2126 Fe-only hydrogenase, N-terminal domain {Clostridiu 98.22
d1t3qa281 Quinoline 2-oxidoreductase small subunit QorS, N-d 98.11
d1vlba280 Aldehyde oxidoreductase, N-terminal domain {Desulf 98.04
d1dgja280 Aldehyde oxidoreductase, N-terminal domain {Desulf 97.8
d1ffva279 Carbone monoxide (CO) dehydrogenase iron-sulfur pr 97.77
d1rm6c281 4-hydroxybenzoyl-CoA reductase gamma subunit HrcC, 97.69
d1kf6b2105 Fumarate reductase iron-sulfur protein, N-terminal 97.6
d1n62a279 Carbone monoxide (CO) dehydrogenase iron-sulfur pr 97.4
d1jroa284 Xanthine dehydrogenase chain A, N-terminal domain 97.32
d2bs2b2106 Fumarate reductase iron-sulfur protein, N-terminal 96.97
d1v97a290 Xanthine oxidase, N-terminal domain {Cow (Bos taur 96.82
d1ep3b2160 Dihydroorotate dehydrogenase B, PyrK subunit {Lact 88.64
d1uh6a_100 Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculu 87.46
d2al3a176 Tether containing UBX domain for GLUT4 (Tug) {Mous 87.45
d1wgha_116 Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculu 85.05
d1nekb2106 Succinate dehydogenase iron-sulfur protein, N-term 84.53
>d1xlqa1 d.15.4.1 (A:1-106) 2Fe-2S ferredoxin {Pseudomonas putida, putidaredoxin [TaxId: 303]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-Grasp (ubiquitin-like)
superfamily: 2Fe-2S ferredoxin-like
family: 2Fe-2S ferredoxin-related
domain: 2Fe-2S ferredoxin
species: Pseudomonas putida, putidaredoxin [TaxId: 303]

Probab=99.98  E-value=1.3e-32  Score=196.66  Aligned_cols=104  Identities=26%  Similarity=0.506  Sum_probs=95.2

Q ss_pred             EEEEECCCCCEEEEEecCCchHHHHHHHCCCCCCCcCCCCCcccCCCccEEEEcCCCccCCCCCCHHHHHhhhccccccc
Q 031532           46 HLFAIDPDGQKRPIIGLAGQTLLKALTNSGLIDPASHRLEEIDACSAECEVNIAQEWLDRLPPRSYEEEYVLKRNSRARV  125 (158)
Q Consensus        46 ~Vt~v~~~G~~~~v~~~~G~tLlea~~~~gii~~~~~~CgG~g~CGatC~V~V~~g~~~~l~~~t~~E~~~L~~~~~~~~  125 (158)
                      ||||++++|.+++|++.+|+|||++++++||. ...+.|||.+.|| ||||+|.+||.+++++++++|.++|+..  ..+
T Consensus         2 KIt~i~~dG~~~~i~~~~G~tLl~aa~~~gi~-~i~~~CgG~~~C~-tC~V~v~~g~~~~l~~~~~~E~~~L~~~--~~~   77 (106)
T d1xlqa1           2 KVVYVSHDGTRRELDVADGVSLMQAAVSNGIY-DIVGDCGGSASCA-TCHVYVNEAFTDKVPAANEREIGMLESV--TAE   77 (106)
T ss_dssp             EEEEECTTSCEEEEECCTTCBHHHHHHHTTCT-TSCCTTCSSSSSC-TTEEEECTTTGGGSCCCCHHHHHHHTTC--SSC
T ss_pred             EEEEECCCCCEEEEEeCCCChHHHHHHHhCcC-Cchhhhhhccccc-cceEEecccchhcCCCCCHHHHHHHHhh--hcc
Confidence            79999999999999999999999999999993 2336799999998 9999999999999999999999999864  357


Q ss_pred             CCCCcEEeeceEEecCCCccEEEeCCCC
Q 031532          126 LNLHSRLGCQVVLTHDLEGMVVAVPEPR  153 (158)
Q Consensus       126 ~~~~sRLACQi~l~~dldG~vI~lp~~~  153 (158)
                      +.++||||||+++++||||++|+||+.+
T Consensus        78 ~~~~sRLaCQ~~v~~~~dgl~V~vPe~q  105 (106)
T d1xlqa1          78 LKPNSRLCCQIIMTPELDGIVVDVPDRQ  105 (106)
T ss_dssp             CCTTEEEGGGCBCCGGGTTEEEECCSCC
T ss_pred             CCCCcEeeeeeEecccCCCEEEECCCcc
Confidence            8899999999999999999999999976
>d1e9ma_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Rhodobacter capsulatus, ferredoxin VI [TaxId: 1061]} Back     information, alignment and structure
>d1b9ra_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Pseudomonas sp., terpredoxin [TaxId: 306]} Back     information, alignment and structure
>d2bt6a1 d.15.4.1 (A:5-108) Adrenodoxin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1l5pa_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Trichomonas vaginalis [TaxId: 5722]} Back     information, alignment and structure
>d1i7ha_ d.15.4.1 (A:) Adrenodoxin-like ferredoxin {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jq4a_ d.15.4.2 (A:) Methane monooxygenase reductase N-terminal domain {Methylococcus capsulatus [TaxId: 414]} Back     information, alignment and structure
>d1krha3 d.15.4.2 (A:2-105) Benzoate dioxygenase reductase, N-terminal domain {Acinetobacter sp. [TaxId: 472]} Back     information, alignment and structure
>d1a70a_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1frra_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258]} Back     information, alignment and structure
>d2fug33 d.15.4.2 (3:1-95) Nadh-quinone oxidoreductase chain 3, Nqo3, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1czpa_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), pcc 7119 and 7120 [TaxId: 1167]} Back     information, alignment and structure
>d1frda_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), pcc 7119 and 7120 [TaxId: 1167]} Back     information, alignment and structure
>d1iuea_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1awda_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Chlorella fusca [TaxId: 3073]} Back     information, alignment and structure
>d1wria_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258]} Back     information, alignment and structure
>d2piaa3 d.15.4.2 (A:224-321) Phthalate dioxygenase reductase, C-terminal domain {Pseudomonas cepacia, db01 [TaxId: 292]} Back     information, alignment and structure
>d1doia_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d3c8ya2 d.15.4.2 (A:1-126) Fe-only hydrogenase, N-terminal domain {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1t3qa2 d.15.4.2 (A:7-87) Quinoline 2-oxidoreductase small subunit QorS, N-domain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1vlba2 d.15.4.2 (A:1-80) Aldehyde oxidoreductase, N-terminal domain {Desulfovibrio gigas [TaxId: 879]} Back     information, alignment and structure
>d1dgja2 d.15.4.2 (A:1-80) Aldehyde oxidoreductase, N-terminal domain {Desulfovibrio desulfuricans [TaxId: 876]} Back     information, alignment and structure
>d1ffva2 d.15.4.2 (A:3-81) Carbone monoxide (CO) dehydrogenase iron-sulfur protein, N-domain {Hydrogenophaga pseudoflava [TaxId: 47421]} Back     information, alignment and structure
>d1rm6c2 d.15.4.2 (C:1-81) 4-hydroxybenzoyl-CoA reductase gamma subunit HrcC, N-terminal domain {Thauera aromatica [TaxId: 59405]} Back     information, alignment and structure
>d1kf6b2 d.15.4.2 (B:1-105) Fumarate reductase iron-sulfur protein, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n62a2 d.15.4.2 (A:3-81) Carbone monoxide (CO) dehydrogenase iron-sulfur protein, N-domain {Oligotropha carboxidovorans, formerly Pseudomonas carboxydovorans [TaxId: 40137]} Back     information, alignment and structure
>d1jroa2 d.15.4.2 (A:1-84) Xanthine dehydrogenase chain A, N-terminal domain {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d2bs2b2 d.15.4.2 (B:1-106) Fumarate reductase iron-sulfur protein, N-terminal domain {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1v97a2 d.15.4.2 (A:3-92) Xanthine oxidase, N-terminal domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ep3b2 c.25.1.3 (B:103-262) Dihydroorotate dehydrogenase B, PyrK subunit {Lactococcus lactis, isozyme B [TaxId: 1358]} Back     information, alignment and structure
>d1uh6a_ d.15.1.1 (A:) Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2al3a1 d.15.1.2 (A:10-85) Tether containing UBX domain for GLUT4 (Tug) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wgha_ d.15.1.1 (A:) Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nekb2 d.15.4.2 (B:1-106) Succinate dehydogenase iron-sulfur protein, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure