Citrus Sinensis ID: 031588

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------
MASTGQPPSLKRRDVPVSREGDQLTIIPLGAGNEVGRSCVYMSYKGKTILFDCGIHPAYSGMAALPYFDEIDPSAIDVLLITHFHLDHAASLPYFLEKTTFSGRVFMTHATKAIYKLLLTDYVKVSKVSVEDMLFDEQDINRSMDRIEVCFLSCCLF
ccccccccccccccccccccccEEEEEEEcccccccccEEEEEEccEEEEEEcccccccccccccccccccccccccEEEEEcccccccccccccccccccccEEEccHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHcccEEEEccEEEc
ccccccHHHHHcccccccccccEEEEEEcccccccccEEEEEEEcccEEEEEccccccccccccccccccccHccccEEEEEcccHHHHHHHHHHHHHccccccEEcccHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHccEEEEEcccccc
mastgqppslkrrdvpvsregdqltiiplgagnevgrSCVYmsykgktilfdcgihpaysgmaalpyfdeidpsaIDVLLITHFHldhaaslpyflekttfsgrvfMTHATKAIYKLLLTDYVKVSKVSVEDMLFDEQDINRSMDRIEVCFLSCCLF
mastgqppslkrrdvpvsregdqltiiplgagnevgRSCVYMSYKGKTILFDCGIHPAYSGMAALPYFDEIDPSAIDVLLITHFHLDHAASLPYFLEKTTFSGRVFMTHATKAIYKLLLTDYVKVSKVSVEDMLFDEQDINRSMDRIEVCFLSCCLF
MASTGQPPSLKRRDVPVSREGDQLTIIPLGAGNEVGRSCVYMSYKGKTILFDCGIHPAYSGMAALPYFDEIDPSAIDVLLITHFHLDHAASLPYFLEKTTFSGRVFMTHATKAIYKLLLTDYVKVSKVSVEDMLFDEQDINRSMDRIEVCFLSCCLF
***********************LTIIPLGAGNEVGRSCVYMSYKGKTILFDCGIHPAYSGMAALPYFDEIDPSAIDVLLITHFHLDHAASLPYFLEKTTFSGRVFMTHATKAIYKLLLTDYVKVSKVSVEDMLFDEQDINRSMDRIEVCFLSCCL*
***********************LTIIPLGAGNEVGRSCVYMSYKGKTILFDCGIHPAYSGMAALPYFDEIDPSAIDVLLITHFHLDHAASLPYFLEKTTFSGRVFMTHATKAIYKLLLTDYVKVSKVSVEDMLFDEQDINRSMDRIEVCFLSCCLF
*******************EGDQLTIIPLGAGNEVGRSCVYMSYKGKTILFDCGIHPAYSGMAALPYFDEIDPSAIDVLLITHFHLDHAASLPYFLEKTTFSGRVFMTHATKAIYKLLLTDYVKVSKVSVEDMLFDEQDINRSMDRIEVCFLSCCLF
*******************EGDQLTIIPLGAGNEVGRSCVYMSYKGKTILFDCGIHPAYSGMAALPYFDEIDPSAIDVLLITHFHLDHAASLPYFLEKTTFSGRVFMTHATKAIYKLLLTDYVKVSKVSVEDMLFDEQDINRSMDRIEVCFLSCCLF
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASTGQPPSLKRRDVPVSREGDQLTIIPLGAGNEVGRSCVYMSYKGKTILFDCGIHPAYSGMAALPYFDEIDPSAIDVLLITHFHLDHAASLPYFLEKTTFSGRVFMTHATKAIYKLLLTDYVKVSKVSVEDMLFDEQDINRSMDRIEVCFLSCCLF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query157 2.2.26 [Sep-21-2011]
Q9C952 693 Cleavage and polyadenylat yes no 0.936 0.212 0.859 6e-73
P79101 684 Cleavage and polyadenylat yes no 0.834 0.191 0.641 6e-49
Q9QXK7 684 Cleavage and polyadenylat yes no 0.834 0.191 0.641 7e-49
Q9UKF6 684 Cleavage and polyadenylat yes no 0.834 0.191 0.641 7e-49
O13794 757 Endoribonuclease ysh1 OS= yes no 0.872 0.180 0.623 7e-47
Q86A79 774 Cleavage and polyadenylat yes no 0.885 0.179 0.591 2e-45
Q6CUI5 764 Endoribonuclease YSH1 OS= yes no 0.808 0.166 0.574 1e-41
Q6FUA5 771 Endoribonuclease YSH1 OS= yes no 0.840 0.171 0.550 3e-41
Q6C2Z7 827 Endoribonuclease YSH1 OS= yes no 0.821 0.155 0.561 3e-40
Q4PEJ3 880 Endoribonuclease YSH1 OS= N/A no 0.821 0.146 0.553 1e-39
>sp|Q9C952|CPSF3_ARATH Cleavage and polyadenylation specificity factor subunit 3-I OS=Arabidopsis thaliana GN=CPSF73-I PE=1 SV=1 Back     alignment and function desciption
 Score =  272 bits (696), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 128/149 (85%), Positives = 141/149 (94%), Gaps = 2/149 (1%)

Query: 1   MASTGQPPSLKRRDVPVSREGDQLTIIPLGAGNEVGRSCVYMSYKGKTILFDCGIHPAYS 60
           MAS+    SLKRR+ P+SR+GDQL + PLGAG+EVGRSCVYMS++GK ILFDCGIHPAYS
Sbjct: 1   MASSST--SLKRREQPISRDGDQLIVTPLGAGSEVGRSCVYMSFRGKNILFDCGIHPAYS 58

Query: 61  GMAALPYFDEIDPSAIDVLLITHFHLDHAASLPYFLEKTTFSGRVFMTHATKAIYKLLLT 120
           GMAALPYFDEIDPS+IDVLLITHFH+DHAASLPYFLEKTTF+GRVFMTHATKAIYKLLLT
Sbjct: 59  GMAALPYFDEIDPSSIDVLLITHFHIDHAASLPYFLEKTTFNGRVFMTHATKAIYKLLLT 118

Query: 121 DYVKVSKVSVEDMLFDEQDINRSMDRIEV 149
           DYVKVSKVSVEDMLFDEQDIN+SMD+IEV
Sbjct: 119 DYVKVSKVSVEDMLFDEQDINKSMDKIEV 147
Component of the cleavage and polyadenylation specificity factor (CPSF) complex that play a key role in pre-mRNA 3'-end formation, recognizing the AAUAAA signal sequence and interacting with poly(A) polymerase and other factors to bring about cleavage and poly(A) addition. May function as mRNA 3'-end-processing endonuclease and also be involved in the histone 3'-end pre-mRNA processing.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 1EC: .EC: 2EC: 7EC: .EC: -
>sp|P79101|CPSF3_BOVIN Cleavage and polyadenylation specificity factor subunit 3 OS=Bos taurus GN=CPSF3 PE=2 SV=1 Back     alignment and function description
>sp|Q9QXK7|CPSF3_MOUSE Cleavage and polyadenylation specificity factor subunit 3 OS=Mus musculus GN=Cpsf3 PE=1 SV=2 Back     alignment and function description
>sp|Q9UKF6|CPSF3_HUMAN Cleavage and polyadenylation specificity factor subunit 3 OS=Homo sapiens GN=CPSF3 PE=1 SV=1 Back     alignment and function description
>sp|O13794|YSH1_SCHPO Endoribonuclease ysh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ysh1 PE=3 SV=2 Back     alignment and function description
>sp|Q86A79|CPSF3_DICDI Cleavage and polyadenylation specificity factor subunit 3 OS=Dictyostelium discoideum GN=cpsf3 PE=3 SV=1 Back     alignment and function description
>sp|Q6CUI5|YSH1_KLULA Endoribonuclease YSH1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=YSH1 PE=3 SV=1 Back     alignment and function description
>sp|Q6FUA5|YSH1_CANGA Endoribonuclease YSH1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=YSH1 PE=3 SV=1 Back     alignment and function description
>sp|Q6C2Z7|YSH1_YARLI Endoribonuclease YSH1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YSH1 PE=3 SV=2 Back     alignment and function description
>sp|Q4PEJ3|YSH1_USTMA Endoribonuclease YSH1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=YSH1 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query157
255542245 361 Cleavage and polyadenylation specificity 0.949 0.412 0.906 2e-75
224140919 699 predicted protein [Populus trichocarpa] 0.949 0.213 0.906 3e-75
359486185 694 PREDICTED: cleavage and polyadenylation 0.949 0.214 0.892 3e-73
224140921 696 predicted protein [Populus trichocarpa] 0.949 0.214 0.886 4e-73
297739590 680 unnamed protein product [Vitis vinifera] 0.949 0.219 0.892 7e-73
449435478 481 PREDICTED: LOW QUALITY PROTEIN: cleavage 0.949 0.309 0.872 3e-72
449435476 392 PREDICTED: cleavage and polyadenylation 0.949 0.380 0.872 4e-72
18377654 693 putative cleavage and polyadenylation sp 0.936 0.212 0.859 3e-71
297837375 693 hypothetical protein ARALYDRAFT_475225 [ 0.936 0.212 0.859 3e-71
15219848 693 cleavage and polyadenylation specificity 0.936 0.212 0.859 3e-71
>gi|255542245|ref|XP_002512186.1| Cleavage and polyadenylation specificity factor 73 kDa subunit, putative [Ricinus communis] gi|223548730|gb|EEF50220.1| Cleavage and polyadenylation specificity factor 73 kDa subunit, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  286 bits (732), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 135/149 (90%), Positives = 140/149 (93%)

Query: 1   MASTGQPPSLKRRDVPVSREGDQLTIIPLGAGNEVGRSCVYMSYKGKTILFDCGIHPAYS 60
           M ST Q PSLKRRD PV+REGD LT+ PLGAGNEVGRSCVYMSYKGK +LFDCGIHPAYS
Sbjct: 1   MGSTAQSPSLKRRDAPVTREGDVLTVTPLGAGNEVGRSCVYMSYKGKIVLFDCGIHPAYS 60

Query: 61  GMAALPYFDEIDPSAIDVLLITHFHLDHAASLPYFLEKTTFSGRVFMTHATKAIYKLLLT 120
           GMAALPYFDEIDPS IDVLLITHFHLDHAASLPYFLEKTTF GRVFMTHATKAIYKLLLT
Sbjct: 61  GMAALPYFDEIDPSTIDVLLITHFHLDHAASLPYFLEKTTFKGRVFMTHATKAIYKLLLT 120

Query: 121 DYVKVSKVSVEDMLFDEQDINRSMDRIEV 149
           DYVKVSKVS+EDMLFDEQDINRSMD+IEV
Sbjct: 121 DYVKVSKVSIEDMLFDEQDINRSMDKIEV 149

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224140919|ref|XP_002323824.1| predicted protein [Populus trichocarpa] gi|222866826|gb|EEF03957.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359486185|ref|XP_003633408.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 3-I-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224140921|ref|XP_002323825.1| predicted protein [Populus trichocarpa] gi|222866827|gb|EEF03958.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297739590|emb|CBI29772.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449435478|ref|XP_004135522.1| PREDICTED: LOW QUALITY PROTEIN: cleavage and polyadenylation specificity factor subunit 3-I-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449435476|ref|XP_004135521.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 3-I-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|18377654|gb|AAL66977.1| putative cleavage and polyadenylation specificity factor [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297837375|ref|XP_002886569.1| hypothetical protein ARALYDRAFT_475225 [Arabidopsis lyrata subsp. lyrata] gi|297332410|gb|EFH62828.1| hypothetical protein ARALYDRAFT_475225 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15219848|ref|NP_176297.1| cleavage and polyadenylation specificity factor subunit 3-I [Arabidopsis thaliana] gi|30696512|ref|NP_849835.1| cleavage and polyadenylation specificity factor subunit 3-I [Arabidopsis thaliana] gi|79320389|ref|NP_001031215.1| cleavage and polyadenylation specificity factor subunit 3-I [Arabidopsis thaliana] gi|75262219|sp|Q9C952.1|CPSF3_ARATH RecName: Full=Cleavage and polyadenylation specificity factor subunit 3-I; AltName: Full=Cleavage and polyadenylation specificity factor 73 kDa subunit I; Short=AtCPSF73-I; Short=CPSF 73 kDa subunit I gi|12323330|gb|AAG51638.1|AC018908_4 putative cleavage and polyadenylation specificity factor; 72745-70039 [Arabidopsis thaliana] gi|23297661|gb|AAN13003.1| putative cleavage and polyadenylation specificity factor [Arabidopsis thaliana] gi|24415578|gb|AAN41458.1| putative cleavage and polyadenylation specificity factor 73 kDa subunit [Arabidopsis thaliana] gi|222422865|dbj|BAH19419.1| AT1G61010 [Arabidopsis thaliana] gi|222423059|dbj|BAH19511.1| AT1G61010 [Arabidopsis thaliana] gi|332195645|gb|AEE33766.1| cleavage and polyadenylation specificity factor subunit 3-I [Arabidopsis thaliana] gi|332195646|gb|AEE33767.1| cleavage and polyadenylation specificity factor subunit 3-I [Arabidopsis thaliana] gi|332195647|gb|AEE33768.1| cleavage and polyadenylation specificity factor subunit 3-I [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query157
TAIR|locus:2206076 693 CPSF73-I "cleavage and polyade 0.936 0.212 0.859 3.6e-66
ZFIN|ZDB-GENE-030131-3275 690 cpsf3 "cleavage and polyadenyl 0.878 0.2 0.633 3.8e-46
UNIPROTKB|E2R7R2 717 CPSF3 "Uncharacterized protein 0.929 0.203 0.596 9.7e-45
UNIPROTKB|P79101 684 CPSF3 "Cleavage and polyadenyl 0.847 0.194 0.634 1.2e-44
UNIPROTKB|Q9UKF6 684 CPSF3 "Cleavage and polyadenyl 0.847 0.194 0.634 1.2e-44
MGI|MGI:1859328 684 Cpsf3 "cleavage and polyadenyl 0.847 0.194 0.634 1.2e-44
UNIPROTKB|F1NKW5 685 CPSF3 "Uncharacterized protein 0.847 0.194 0.634 1.2e-44
RGD|1305767 685 Cpsf3 "cleavage and polyadenyl 0.847 0.194 0.634 1.2e-44
UNIPROTKB|G3V6W7 685 Cpsf3 "Protein Cpsf3" [Rattus 0.847 0.194 0.634 1.2e-44
POMBASE|SPAC17G6.16c 757 ysh1 "mRNA cleavage and polyad 0.853 0.177 0.637 2.5e-43
TAIR|locus:2206076 CPSF73-I "cleavage and polyadenylation specificity factor 73-I" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 673 (242.0 bits), Expect = 3.6e-66, P = 3.6e-66
 Identities = 128/149 (85%), Positives = 141/149 (94%)

Query:     1 MASTGQPPSLKRRDVPVSREGDQLTIIPLGAGNEVGRSCVYMSYKGKTILFDCGIHPAYS 60
             MAS+    SLKRR+ P+SR+GDQL + PLGAG+EVGRSCVYMS++GK ILFDCGIHPAYS
Sbjct:     1 MASSST--SLKRREQPISRDGDQLIVTPLGAGSEVGRSCVYMSFRGKNILFDCGIHPAYS 58

Query:    61 GMAALPYFDEIDPSAIDVLLITHFHLDHAASLPYFLEKTTFSGRVFMTHATKAIYKLLLT 120
             GMAALPYFDEIDPS+IDVLLITHFH+DHAASLPYFLEKTTF+GRVFMTHATKAIYKLLLT
Sbjct:    59 GMAALPYFDEIDPSSIDVLLITHFHIDHAASLPYFLEKTTFNGRVFMTHATKAIYKLLLT 118

Query:   121 DYVKVSKVSVEDMLFDEQDINRSMDRIEV 149
             DYVKVSKVSVEDMLFDEQDIN+SMD+IEV
Sbjct:   119 DYVKVSKVSVEDMLFDEQDINKSMDKIEV 147
GO:0005634 "nucleus" evidence=ISM;IDA
GO:0005847 "mRNA cleavage and polyadenylation specificity factor complex" evidence=ISS
GO:0006378 "mRNA polyadenylation" evidence=ISS
GO:0016787 "hydrolase activity" evidence=IEA
GO:0005515 "protein binding" evidence=IPI
GO:0000278 "mitotic cell cycle" evidence=RCA
GO:0006346 "methylation-dependent chromatin silencing" evidence=RCA
GO:0006396 "RNA processing" evidence=RCA
GO:0006397 "mRNA processing" evidence=RCA
GO:0009855 "determination of bilateral symmetry" evidence=RCA
GO:0010014 "meristem initiation" evidence=RCA
GO:0010073 "meristem maintenance" evidence=RCA
GO:0016246 "RNA interference" evidence=RCA
GO:0031507 "heterochromatin assembly" evidence=RCA
GO:0045787 "positive regulation of cell cycle" evidence=RCA
ZFIN|ZDB-GENE-030131-3275 cpsf3 "cleavage and polyadenylation specific factor 3" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E2R7R2 CPSF3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P79101 CPSF3 "Cleavage and polyadenylation specificity factor subunit 3" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q9UKF6 CPSF3 "Cleavage and polyadenylation specificity factor subunit 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1859328 Cpsf3 "cleavage and polyadenylation specificity factor 3" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1NKW5 CPSF3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
RGD|1305767 Cpsf3 "cleavage and polyadenylation specific factor 3, 73kDa" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|G3V6W7 Cpsf3 "Protein Cpsf3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
POMBASE|SPAC17G6.16c ysh1 "mRNA cleavage and polyadenylation specificity factor complex endoribonuclease subunit Ysh1" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9C952CPSF3_ARATH3, ., 1, ., 2, 7, ., -0.85900.93630.2121yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.00170303
hypothetical protein (700 aa)
(Populus trichocarpa)
Predicted Functional Partners:
eugene3.01480064
hypothetical protein (740 aa)
   •••••0.528
fgenesh4_pg.C_LG_XV000388
hypothetical protein (193 aa)
    • • 0.469
estExt_Genewise1_v1.C_LG_XVII0873
hypothetical protein (438 aa)
    ••• 0.457

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query157
COG1236 427 COG1236, YSH1, Predicted exonuclease of the beta-l 5e-33
TIGR03675 630 TIGR03675, arCOG00543, arCOG00543 universal archae 3e-27
COG1782 637 COG1782, COG1782, Predicted metal-dependent RNase, 1e-24
pfam00753148 pfam00753, Lactamase_B, Metallo-beta-lactamase sup 6e-13
smart00849177 smart00849, Lactamase_B, Metallo-beta-lactamase su 1e-11
COG0595 555 COG0595, COG0595, mRNA degradation ribonucleases J 3e-10
COG1234 292 COG1234, ElaC, Metal-dependent hydrolases of the b 3e-08
pfam12706197 pfam12706, Lactamase_B_2, Beta-lactamase superfami 3e-07
TIGR02651 299 TIGR02651, RNase_Z, ribonuclease Z 7e-07
COG2220 258 COG2220, COG2220, Predicted Zn-dependent hydrolase 8e-06
PRK00055 270 PRK00055, PRK00055, ribonuclease Z; Reviewed 1e-05
TIGR00649 422 TIGR00649, MG423, conserved hypothetical protein 1e-05
COG1235 269 COG1235, PhnP, Metal-dependent hydrolases of the b 3e-05
COG1237 259 COG1237, COG1237, Metal-dependent hydrolases of th 4e-05
COG2333 293 COG2333, ComEC, Predicted hydrolase (metallo-beta- 8e-05
COG0491 252 COG0491, GloB, Zn-dependent hydrolases, including 2e-04
COG0426 388 COG0426, FpaA, Uncharacterized flavoproteins [Ener 3e-04
>gnl|CDD|224157 COG1236, YSH1, Predicted exonuclease of the beta-lactamase fold involved in RNA processing [Translation, ribosomal structure and biogenesis] Back     alignment and domain information 
 Score =  120 bits (302), Expect = 5e-33
 Identities = 46/127 (36%), Positives = 66/127 (51%), Gaps = 5/127 (3%)

Query: 24  LTIIPLGAGNEVGRSCVYMSYKGKTILFDCGIHPAYSGMAALPYFDEIDPSAIDVLLITH 83
           +T+  LGA  EVGRSCV +   G  IL DCG+ P        P         +D +L+TH
Sbjct: 1   MTLRFLGAAREVGRSCVLLETGGTRILLDCGLFPGDPSP-ERPLLPPFPK--VDAVLLTH 57

Query: 84  FHLDHAASLPYFLEKTTFSGRVFMTHATKAIYKLLLTDYVKVSKVSVEDMLFDEQDINRS 143
            HLDH  +LPY +    F G V+ T  T A+ K+LL D +K+++   +   + E+D+ R 
Sbjct: 58  AHLDHIGALPYLVRN-GFEGPVYATPPTAALLKVLLGDSLKLAEGPDKP-PYSEEDVERV 115

Query: 144 MDRIEVC 150
            D I   
Sbjct: 116 PDLIRPL 122

Length = 427
>gnl|CDD|188365 TIGR03675, arCOG00543, arCOG00543 universal archaeal KH-domain/beta-lactamase-domain protein Back     alignment and domain information
>gnl|CDD|224696 COG1782, COG1782, Predicted metal-dependent RNase, consists of a metallo-beta-lactamase domain and an RNA-binding KH domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|216099 pfam00753, Lactamase_B, Metallo-beta-lactamase superfamily Back     alignment and domain information
>gnl|CDD|214854 smart00849, Lactamase_B, Metallo-beta-lactamase superfamily Back     alignment and domain information
>gnl|CDD|223668 COG0595, COG0595, mRNA degradation ribonucleases J1/J2 (metallo-beta-lactamase superfamily) [Translation, ribosomal structure and biogenesis; Replication, recombination and repair] Back     alignment and domain information
>gnl|CDD|224155 COG1234, ElaC, Metal-dependent hydrolases of the beta-lactamase superfamily III [General function prediction only] Back     alignment and domain information
>gnl|CDD|221727 pfam12706, Lactamase_B_2, Beta-lactamase superfamily domain Back     alignment and domain information
>gnl|CDD|233963 TIGR02651, RNase_Z, ribonuclease Z Back     alignment and domain information
>gnl|CDD|225130 COG2220, COG2220, Predicted Zn-dependent hydrolases of the beta-lactamase fold [General function prediction only] Back     alignment and domain information
>gnl|CDD|234602 PRK00055, PRK00055, ribonuclease Z; Reviewed Back     alignment and domain information
>gnl|CDD|233071 TIGR00649, MG423, conserved hypothetical protein Back     alignment and domain information
>gnl|CDD|224156 COG1235, PhnP, Metal-dependent hydrolases of the beta-lactamase superfamily I [General function prediction only] Back     alignment and domain information
>gnl|CDD|224158 COG1237, COG1237, Metal-dependent hydrolases of the beta-lactamase superfamily II [General function prediction only] Back     alignment and domain information
>gnl|CDD|225212 COG2333, ComEC, Predicted hydrolase (metallo-beta-lactamase superfamily) [General function prediction only] Back     alignment and domain information
>gnl|CDD|223565 COG0491, GloB, Zn-dependent hydrolases, including glyoxylases [General function prediction only] Back     alignment and domain information
>gnl|CDD|223503 COG0426, FpaA, Uncharacterized flavoproteins [Energy production and conversion] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 157
COG1782 637 Predicted metal-dependent RNase, consists of a met 99.89
TIGR03675 630 arCOG00543 arCOG00543 universal archaeal KH-domain 99.88
KOG1136 501 consensus Predicted cleavage and polyadenylation s 99.86
KOG1137 668 consensus mRNA cleavage and polyadenylation factor 99.85
COG1236 427 YSH1 Predicted exonuclease of the beta-lactamase f 99.79
KOG1135 764 consensus mRNA cleavage and polyadenylation factor 99.72
PRK00055 270 ribonuclease Z; Reviewed 99.66
TIGR00649 422 MG423 conserved hypothetical protein. Contains an 99.63
TIGR02651 299 RNase_Z ribonuclease Z. Processing of the 3-prime 99.56
COG0595 555 mRNA degradation ribonucleases J1/J2 (metallo-beta 99.55
TIGR02649 303 true_RNase_BN ribonuclease BN. Members of this pro 99.52
PRK05184 302 pyrroloquinoline quinone biosynthesis protein PqqB 99.51
PRK02113 252 putative hydrolase; Provisional 99.51
COG1234 292 ElaC Metal-dependent hydrolases of the beta-lactam 99.51
PRK11244 250 phnP carbon-phosphorus lyase complex accessory pro 99.5
TIGR02108 302 PQQ_syn_pqqB coenzyme PQQ biosynthesis protein B. 99.47
COG1237 259 Metal-dependent hydrolases of the beta-lactamase s 99.43
smart00849183 Lactamase_B Metallo-beta-lactamase superfamily. Ap 99.38
PF00753194 Lactamase_B: Metallo-beta-lactamase superfamily; I 99.37
PRK02126 334 ribonuclease Z; Provisional 99.34
PRK00685 228 metal-dependent hydrolase; Provisional 99.32
PRK04286 298 hypothetical protein; Provisional 99.26
TIGR03307238 PhnP phosphonate metabolism protein PhnP. This fam 99.21
PRK11921 394 metallo-beta-lactamase/flavodoxin domain-containin 99.21
PLN02469 258 hydroxyacylglutathione hydrolase 99.16
PRK05452 479 anaerobic nitric oxide reductase flavorubredoxin; 99.15
TIGR03413 248 GSH_gloB hydroxyacylglutathione hydrolase. Members 99.11
PRK10241 251 hydroxyacylglutathione hydrolase; Provisional 99.09
PLN02398 329 hydroxyacylglutathione hydrolase 99.06
PLN02962 251 hydroxyacylglutathione hydrolase 99.03
PRK11539 755 ComEC family competence protein; Provisional 99.03
TIGR00361662 ComEC_Rec2 DNA internalization-related competence 99.01
COG1235 269 PhnP Metal-dependent hydrolases of the beta-lactam 98.99
COG2333 293 ComEC Predicted hydrolase (metallo-beta-lactamase 98.97
COG0491 252 GloB Zn-dependent hydrolases, including glyoxylase 98.92
KOG1138 653 consensus Predicted cleavage and polyadenylation s 98.92
KOG2121 746 consensus Predicted metal-dependent hydrolase (bet 98.89
PF12706194 Lactamase_B_2: Beta-lactamase superfamily domain; 98.86
COG0426 388 FpaA Uncharacterized flavoproteins [Energy product 98.86
COG2220 258 Predicted Zn-dependent hydrolases of the beta-lact 98.76
PRK11709 355 putative L-ascorbate 6-phosphate lactonase; Provis 98.75
PF13483163 Lactamase_B_3: Beta-lactamase superfamily domain; 98.67
KOG0813 265 consensus Glyoxylase [General function prediction 98.67
TIGR02650 277 RNase_Z_T_toga ribonuclease Z, Thermotoga type. Me 98.5
COG2248 304 Predicted hydrolase (metallo-beta-lactamase superf 98.06
PF1369163 Lactamase_B_4: tRNase Z endonuclease 98.01
PF02112 335 PDEase_II: cAMP phosphodiesterases class-II; Inter 97.99
COG2015 655 Alkyl sulfatase and related hydrolases [Secondary 97.66
PF14597199 Lactamase_B_5: Metallo-beta-lactamase superfamily; 96.54
COG5212 356 PDE1 Low-affinity cAMP phosphodiesterase [Signal t 95.71
KOG3592 934 consensus Microtubule-associated proteins [Cytoske 95.53
KOG0814237 consensus Glyoxylase [General function prediction 95.51
KOG1137 668 consensus mRNA cleavage and polyadenylation factor 95.5
KOG4736302 consensus Uncharacterized conserved protein [Funct 94.99
KOG1361 481 consensus Predicted hydrolase involved in interstr 94.35
KOG3798 343 consensus Predicted Zn-dependent hydrolase (beta-l 90.49
KOG2121 746 consensus Predicted metal-dependent hydrolase (bet 80.84
>COG1782 Predicted metal-dependent RNase, consists of a metallo-beta-lactamase domain and an RNA-binding KH domain [General function prediction only] Back     alignment and domain information 
Probab=99.89  E-value=3e-22  Score=160.50  Aligned_cols=137  Identities=29%  Similarity=0.533  Sum_probs=120.1

Q ss_pred             CCCCCeEEEEEecCCCCccccEEEEEECCeEEEEecCCCCCcCCCCCCCCCC--CCCCCCccEEEecCCchhhhCChhHH
Q 031588           18 SREGDQLTIIPLGAGNEVGRSCVYMSYKGKTILFDCGIHPAYSGMAALPYFD--EIDPSAIDVLLITHFHLDHAASLPYF   95 (157)
Q Consensus        18 ~~~~~~~~i~~lg~~~~~~~~~~li~~~~~~iLiD~G~~~~~~~~~~~~~~~--~~~~~~i~~I~iTH~H~DH~gg~~~l   95 (157)
                      ...+.-++++.||+..++|.+|+++.+++..||+|||......+....+++.  ++....+|+|+|||+|.||+|-+|+|
T Consensus       175 ~~~~~wvRvt~LGg~~EVGRSa~lv~T~eSrVLlDcG~n~a~~~~~~~Pyl~vpE~~~~~lDAViiTHAHLDH~G~lP~L  254 (637)
T COG1782         175 LVKDRWVRVTALGGFREVGRSALLVSTPESRVLLDCGVNVAGNGEDAFPYLDVPEFQPDELDAVIITHAHLDHCGFLPLL  254 (637)
T ss_pred             cccCceEEEEeeccchhccceeEEEecCCceEEEeccccCCCCccccCcccccccccccccceEEEeecccccccchhhh
Confidence            3456679999999999999999999999999999999976554344444443  45555899999999999999999999


Q ss_pred             HhhcCCCceEEechHHHHHHHHhHHHHHHhhhcccCCCCCCHHHHHHHHhcceEecccee
Q 031588           96 LEKTTFSGRVFMTHATKAIYKLLLTDYVKVSKVSVEDMLFDEQDINRSMDRIEVCFLSCC  155 (157)
Q Consensus        96 ~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~i~~v~~~~~  155 (157)
                      .+ ++++.|||++++|.+++-.+..|++++....+..+.|+..+|++++.+-+++.|+..
T Consensus       255 fk-Ygy~GPVY~T~PTRDlm~LLq~Dyi~va~keg~~ppY~~k~v~~~lkhtItldYgev  313 (637)
T COG1782         255 FK-YGYDGPVYCTPPTRDLMVLLQLDYIEVAEKEGGEPPYESKDVRKVLKHTITLDYGEV  313 (637)
T ss_pred             hh-cCCCCCeeeCCCcHHHHHHHHHHHHHHHHhcCCCCCCCHHHHHHHHheeeeeccCcc
Confidence            85 678999999999999999999999999999999999999999999999999999864

>TIGR03675 arCOG00543 arCOG00543 universal archaeal KH-domain/beta-lactamase-domain protein Back     alignment and domain information
>KOG1136 consensus Predicted cleavage and polyadenylation specificity factor (CPSF subunit) [RNA processing and modification] Back     alignment and domain information
>KOG1137 consensus mRNA cleavage and polyadenylation factor II complex, BRR5 (CPSF subunit) [RNA processing and modification] Back     alignment and domain information
>COG1236 YSH1 Predicted exonuclease of the beta-lactamase fold involved in RNA processing [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1135 consensus mRNA cleavage and polyadenylation factor II complex, subunit CFT2 (CPSF subunit) [RNA processing and modification] Back     alignment and domain information
>PRK00055 ribonuclease Z; Reviewed Back     alignment and domain information
>TIGR00649 MG423 conserved hypothetical protein Back     alignment and domain information
>TIGR02651 RNase_Z ribonuclease Z Back     alignment and domain information
>COG0595 mRNA degradation ribonucleases J1/J2 (metallo-beta-lactamase superfamily) [Translation, ribosomal structure and biogenesis; Replication, recombination and repair] Back     alignment and domain information
>TIGR02649 true_RNase_BN ribonuclease BN Back     alignment and domain information
>PRK05184 pyrroloquinoline quinone biosynthesis protein PqqB; Provisional Back     alignment and domain information
>PRK02113 putative hydrolase; Provisional Back     alignment and domain information
>COG1234 ElaC Metal-dependent hydrolases of the beta-lactamase superfamily III [General function prediction only] Back     alignment and domain information
>PRK11244 phnP carbon-phosphorus lyase complex accessory protein; Provisional Back     alignment and domain information
>TIGR02108 PQQ_syn_pqqB coenzyme PQQ biosynthesis protein B Back     alignment and domain information
>COG1237 Metal-dependent hydrolases of the beta-lactamase superfamily II [General function prediction only] Back     alignment and domain information
>smart00849 Lactamase_B Metallo-beta-lactamase superfamily Back     alignment and domain information
>PF00753 Lactamase_B: Metallo-beta-lactamase superfamily; InterPro: IPR001279 Apart from the beta-lactamases and metallo-beta-lactamases, a number of other proteins contain this domain [] Back     alignment and domain information
>PRK02126 ribonuclease Z; Provisional Back     alignment and domain information
>PRK00685 metal-dependent hydrolase; Provisional Back     alignment and domain information
>PRK04286 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03307 PhnP phosphonate metabolism protein PhnP Back     alignment and domain information
>PRK11921 metallo-beta-lactamase/flavodoxin domain-containing protein; Provisional Back     alignment and domain information
>PLN02469 hydroxyacylglutathione hydrolase Back     alignment and domain information
>PRK05452 anaerobic nitric oxide reductase flavorubredoxin; Provisional Back     alignment and domain information
>TIGR03413 GSH_gloB hydroxyacylglutathione hydrolase Back     alignment and domain information
>PRK10241 hydroxyacylglutathione hydrolase; Provisional Back     alignment and domain information
>PLN02398 hydroxyacylglutathione hydrolase Back     alignment and domain information
>PLN02962 hydroxyacylglutathione hydrolase Back     alignment and domain information
>PRK11539 ComEC family competence protein; Provisional Back     alignment and domain information
>TIGR00361 ComEC_Rec2 DNA internalization-related competence protein ComEC/Rec2 Back     alignment and domain information
>COG1235 PhnP Metal-dependent hydrolases of the beta-lactamase superfamily I [General function prediction only] Back     alignment and domain information
>COG2333 ComEC Predicted hydrolase (metallo-beta-lactamase superfamily) [General function prediction only] Back     alignment and domain information
>COG0491 GloB Zn-dependent hydrolases, including glyoxylases [General function prediction only] Back     alignment and domain information
>KOG1138 consensus Predicted cleavage and polyadenylation specificity factor (CPSF subunit) [RNA processing and modification] Back     alignment and domain information
>KOG2121 consensus Predicted metal-dependent hydrolase (beta-lactamase superfamily) [General function prediction only] Back     alignment and domain information
>PF12706 Lactamase_B_2: Beta-lactamase superfamily domain; PDB: 3BV6_F 1WW1_A 2E7Y_A 3RPC_D 3ZWF_A 3JXP_A 1XTO_A 2CBN_A 3G1P_B 3P2U_A Back     alignment and domain information
>COG0426 FpaA Uncharacterized flavoproteins [Energy production and conversion] Back     alignment and domain information
>COG2220 Predicted Zn-dependent hydrolases of the beta-lactamase fold [General function prediction only] Back     alignment and domain information
>PRK11709 putative L-ascorbate 6-phosphate lactonase; Provisional Back     alignment and domain information
>PF13483 Lactamase_B_3: Beta-lactamase superfamily domain; PDB: 1VJN_B 3KL7_A Back     alignment and domain information
>KOG0813 consensus Glyoxylase [General function prediction only] Back     alignment and domain information
>TIGR02650 RNase_Z_T_toga ribonuclease Z, Thermotoga type Back     alignment and domain information
>COG2248 Predicted hydrolase (metallo-beta-lactamase superfamily) [General function prediction only] Back     alignment and domain information
>PF13691 Lactamase_B_4: tRNase Z endonuclease Back     alignment and domain information
>PF02112 PDEase_II: cAMP phosphodiesterases class-II; InterPro: IPR000396 Cyclic-AMP phosphodiesterase (3 Back     alignment and domain information
>COG2015 Alkyl sulfatase and related hydrolases [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF14597 Lactamase_B_5: Metallo-beta-lactamase superfamily; PDB: 2P97_B Back     alignment and domain information
>COG5212 PDE1 Low-affinity cAMP phosphodiesterase [Signal transduction mechanisms] Back     alignment and domain information
>KOG3592 consensus Microtubule-associated proteins [Cytoskeleton] Back     alignment and domain information
>KOG0814 consensus Glyoxylase [General function prediction only] Back     alignment and domain information
>KOG1137 consensus mRNA cleavage and polyadenylation factor II complex, BRR5 (CPSF subunit) [RNA processing and modification] Back     alignment and domain information
>KOG4736 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1361 consensus Predicted hydrolase involved in interstrand cross-link repair [Replication, recombination and repair] Back     alignment and domain information
>KOG3798 consensus Predicted Zn-dependent hydrolase (beta-lactamase superfamily) [General function prediction only] Back     alignment and domain information
>KOG2121 consensus Predicted metal-dependent hydrolase (beta-lactamase superfamily) [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query157
2i7t_A 459 Structure Of Human Cpsf-73 Length = 459 1e-49
2ycb_A 636 Structure Of The Archaeal Beta-Casp Protein With N- 1e-12
3af5_A 651 The Crystal Structure Of An Archaeal Cpsf Subunit, 3e-12
3idz_A 431 Crystal Structure Of S378q Mutant Ttha0252 From The 3e-11
3iek_A 431 Crystal Structure Of Native Ttha0252 From Thermus T 4e-11
3ie1_A 431 Crystal Structure Of H380a Mutant Ttha0252 From The 4e-11
3ie2_A 431 Crystal Structure Of H400v Mutant Ttha0252 From The 4e-11
3ie0_A 431 Crystal Structure Of S378y Mutant Ttha0252 From The 4e-11
2xr1_A 640 Dimeric Archaeal Cleavage And Polyadenylation Speci 1e-10
2dkf_A 431 Crystal Structure Of Ttha0252 From Thermus Thermoph 1e-10
3a4y_A 431 Crystal Structure Of H61a Mutant Ttha0252 From Ther 5e-10
1e5d_A 402 Rubredoxin Oxygen:oxidoreductase (Roo) From Anaerob 1e-04
3zq4_A 555 Unusual, Dual Endo- And Exo-Nuclease Activity In Th 3e-04
>pdb|2I7T|A Chain A, Structure Of Human Cpsf-73 Length = 459 Back     alignment and structure 
Iteration: 1

 Score =  191 bits (485), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 84/131 (64%), Positives = 104/131 (79%)
Query: 18  SREGDQLTIIPLGAGNEVGRSCVYMSYKGKTILFDCGIHPAYSGMAALPYFDEIDPSAID 77
           + E DQL I PLGAG EVGRSC+ + +KG+ I+ DCGIHP   GM ALPY D IDP+ ID
Sbjct: 6   AEESDQLLIRPLGAGQEVGRSCIILEFKGRKIMLDCGIHPGLEGMDALPYIDLIDPAEID 65
Query: 78  VLLITHFHLDHAASLPYFLEKTTFSGRVFMTHATKAIYKLLLTDYVKVSKVSVEDMLFDE 137
           +LLI+HFHLDH  +LP+FL+KT+F GR FMTHATKAIY+ LL+DYVKVS +S +DML+ E
Sbjct: 66  LLLISHFHLDHCGALPWFLQKTSFKGRTFMTHATKAIYRWLLSDYVKVSNISADDMLYTE 125
Query: 138 QDINRSMDRIE 148
            D+  SMD+IE
Sbjct: 126 TDLEESMDKIE 136
>pdb|2YCB|A Chain A, Structure Of The Archaeal Beta-Casp Protein With N-Terminal Kh Domains From Methanothermobacter Thermautotrophicus Length = 636 Back     alignment and structure
>pdb|3AF5|A Chain A, The Crystal Structure Of An Archaeal Cpsf Subunit, Ph1404 From Pyrococcus Horikoshii Length = 651 Back     alignment and structure
>pdb|3IDZ|A Chain A, Crystal Structure Of S378q Mutant Ttha0252 From Thermus Thermophilus Hb8 Length = 431 Back     alignment and structure
>pdb|3IEK|A Chain A, Crystal Structure Of Native Ttha0252 From Thermus Thermophilus Hb8 Length = 431 Back     alignment and structure
>pdb|3IE1|A Chain A, Crystal Structure Of H380a Mutant Ttha0252 From Thermus Thermophilus Hb8 Complexed With Rna Length = 431 Back     alignment and structure
>pdb|3IE2|A Chain A, Crystal Structure Of H400v Mutant Ttha0252 From Thermus Thermophilus Hb8 Length = 431 Back     alignment and structure
>pdb|3IE0|A Chain A, Crystal Structure Of S378y Mutant Ttha0252 From Thermus Thermophilus Hb8 Length = 431 Back     alignment and structure
>pdb|2XR1|A Chain A, Dimeric Archaeal Cleavage And Polyadenylation Specificity Factor With N-Terminal Kh Domains (Kh-Cpsf) From Methanosarcina Mazei Length = 640 Back     alignment and structure
>pdb|2DKF|A Chain A, Crystal Structure Of Ttha0252 From Thermus Thermophilus Hb8, A Rna Degradation Protein Of The Metallo-Beta-Lactamase Superfamily Length = 431 Back     alignment and structure
>pdb|3A4Y|A Chain A, Crystal Structure Of H61a Mutant Ttha0252 From Thermus Thermophilus Hb8 Length = 431 Back     alignment and structure
>pdb|1E5D|A Chain A, Rubredoxin Oxygen:oxidoreductase (Roo) From Anaerobe Desulfovibrio Gigas Length = 402 Back     alignment and structure
>pdb|3ZQ4|A Chain A, Unusual, Dual Endo- And Exo-Nuclease Activity In The Degradosome Explained By Crystal Structure Analysis Of Rnase J1 Length = 555 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query157
2i7t_A 459 Cleavage and polyadenylation specificity factor 73 3e-59
3af5_A 651 Putative uncharacterized protein PH1404; archaeal 1e-55
2ycb_A 636 Beta-CAsp RNAse, cleavage and polyadenylation spec 1e-54
3iek_A 431 Ribonuclease TTHA0252; metallo beta lactamase fold 2e-52
2xr1_A 640 Cleavage and polyadenylation specificity factor 1 7e-52
2i7x_A 717 Protein CFT2; polyadenylation, metallo-B-lactamase 3e-34
2az4_A 429 Hypothetical protein EF2904; structural genomics, 9e-12
1ztc_A221 Hypothetical protein TM0894; structural genomics, 6e-10
1zkp_A 268 Hypothetical protein BA1088; zinc binding protein, 5e-09
2p4z_A 284 Metal-dependent hydrolases of the beta-lactamase s 9e-09
3zq4_A 555 Ribonuclease J 1, RNAse J1; hydrolase, RNA maturat 3e-07
3zwf_A 368 Zinc phosphodiesterase ELAC protein 1; beta-lactam 4e-07
3bk2_A 562 RNAse J, metal dependent hydrolase; endoribonuclea 5e-07
2vw8_A 303 PA1000, PQSE; quinolone signal response protein, s 5e-07
4ax1_B 303 Metallo-beta-lactamase AIM-1; hydrolase, antibioti 8e-07
2r2d_A276 AGR_PTI_140P, Zn-dependent hydrolases; lactonase, 1e-06
3aj3_A 274 MLR6805 protein, 4-pyridoxolactonase; Zn-protein, 1e-06
3kl7_A235 Putative metal-dependent hydrolase; structural gen 1e-06
1sml_A 269 Protein (penicillinase); metallo-beta-lactamase, a 2e-06
2e7y_A 280 TRNAse Z; tRNA maturation, metallo-beta-lactaMSe, 2e-06
1vme_A 410 Flavoprotein; TM0755, structural genomics, JCSG, p 6e-06
1y44_A 320 Ribonuclease Z; zinc-dependent metal hydrolase, hy 8e-06
2ohh_A 404 Type A flavoprotein FPRA; beta-lactamase like doma 1e-05
3m8t_A 294 'BLR6230 protein; subclass B3 beta-lactamase, zinc 2e-05
3dha_A254 N-acyl homoserine lactone hydrolase; zinc bimetall 2e-05
1k07_A 263 FEZ-1 beta-lactamase; monomer with alpha-beta/BETA 2e-05
2q9u_A 414 A-type flavoprotein; flavodoxin like, beta lactama 3e-05
1p9e_A 331 Methyl parathion hydrolase; Zn containing; 2.40A { 4e-05
3adr_A 261 Putative uncharacterized protein ST1585; quorum se 6e-05
3g1p_A 258 Protein PHNP; C-P lyase, phosphodiesterase, phosph 8e-05
3esh_A280 Protein similar to metal-dependent hydrolase; stru 1e-04
3rpc_A 264 Possible metal-dependent hydrolase; structural gen 2e-04
2cbn_A 306 Ribonuclease Z; phosphodiesterase beta lactamase t 2e-04
1ycg_A 398 Nitric oxide reductase; DIIRON site, oxidoreductas 2e-04
3h3e_A 267 Uncharacterized protein TM1679; structural genomic 3e-04
1e5d_A 402 Rubredoxin\:oxygen oxidoreductase; oxygenreductase 3e-04
3hnn_A 262 Putative diflavin flavoprotein A 5; PSI-2, protein 4e-04
2zo4_A 317 Metallo-beta-lactamase family protein; hydrolase; 6e-04
1vjn_A220 Zn-dependent hydrolase of metallo-beta-lactamase s 7e-04
>2i7t_A Cleavage and polyadenylation specificity factor 73 kDa subunit; metallo-B-lactamase, PRE-mRNA processing, artemis, V(D)J recombination; 2.10A {Homo sapiens} SCOP: d.157.1.10 PDB: 2i7v_A Length = 459 Back     alignment and structure
 Score =  189 bits (482), Expect = 3e-59
 Identities = 85/137 (62%), Positives = 105/137 (76%), Gaps = 1/137 (0%)

Query: 14  DVPVSREGDQLTIIPLGAGNEVGRSCVYMSYKGKTILFDCGIHPAYSGMAALPYFDEIDP 73
            +P   E DQL I PLGAG EVGRSC+ + +KG+ I+ DCGIHP   GM ALPY D IDP
Sbjct: 3   AIPAE-ESDQLLIRPLGAGQEVGRSCIILEFKGRKIMLDCGIHPGLEGMDALPYIDLIDP 61

Query: 74  SAIDVLLITHFHLDHAASLPYFLEKTTFSGRVFMTHATKAIYKLLLTDYVKVSKVSVEDM 133
           + ID+LLI+HFHLDH  +LP+FL+KT+F GR FMTHATKAIY+ LL+DYVKVS +S +DM
Sbjct: 62  AEIDLLLISHFHLDHCGALPWFLQKTSFKGRTFMTHATKAIYRWLLSDYVKVSNISADDM 121

Query: 134 LFDEQDINRSMDRIEVC 150
           L+ E D+  SMD+IE  
Sbjct: 122 LYTETDLEESMDKIETI 138
>3af5_A Putative uncharacterized protein PH1404; archaeal CPSF, beta-CAsp family, KH domain, ribonuclease, ME beta-lactamase superfamily, archaea; 2.60A {Pyrococcus horikoshii} PDB: 3af6_A* Length = 651 Back     alignment and structure
>2ycb_A Beta-CAsp RNAse, cleavage and polyadenylation specificity factor; hydrolase, KH, metallo-beta-lactamase; 3.10A {Methanothermobacter thermautotrophicusorganism_taxid} Length = 636 Back     alignment and structure
>3iek_A Ribonuclease TTHA0252; metallo beta lactamase fold, endonuclease, hydrolase, metal- nuclease, RNA-binding, rRNA processing; HET: FLC; 2.05A {Thermus thermophilus} PDB: 2dkf_A* 3iel_A* 3iem_A* 2zdf_A* 3idz_A* 2zdd_A* 3ie0_A* 2zde_A* 3ie1_A* 2zdw_A* 3a4y_A* 2yvd_A* 3ie2_A* Length = 431 Back     alignment and structure
>2xr1_A Cleavage and polyadenylation specificity factor 1 subunit; hydrolase, metallo-beta-lactamase, beta-CAsp, RNA processing; 2.59A {Methanosarcina mazei} Length = 640 Back     alignment and structure
>2i7x_A Protein CFT2; polyadenylation, metallo-B-lactamase, PRE-mRNA processing, artemis, V(D)J recombination, double-strand break repair; 2.50A {Saccharomyces cerevisiae} SCOP: d.157.1.10 Length = 717 Back     alignment and structure
>2az4_A Hypothetical protein EF2904; structural genomics, PSI, protein STR initiative, midwest center for structural genomics, MCSG, U function; 2.00A {Enterococcus faecalis} SCOP: d.157.1.10 Length = 429 Back     alignment and structure
>1ztc_A Hypothetical protein TM0894; structural genomics, joint center for structural genomics, J protein structure initiative, PSI, hydrolase; HET: MSE; 2.10A {Thermotoga maritima} SCOP: d.157.1.11 Length = 221 Back     alignment and structure
>1zkp_A Hypothetical protein BA1088; zinc binding protein, structural genomics, PSI, protein STRU initiative; 1.50A {Bacillus anthracis str} SCOP: d.157.1.9 Length = 268 Back     alignment and structure
>2p4z_A Metal-dependent hydrolases of the beta-lactamase superfamily II; metal-dependent hydrolases of the beta-lactamase superfamily hydrolase; 2.10A {Thermoanaerobacter tengcongensis} Length = 284 Back     alignment and structure
>3zq4_A Ribonuclease J 1, RNAse J1; hydrolase, RNA maturation; 3.00A {Bacillus subtilis} Length = 555 Back     alignment and structure
>3zwf_A Zinc phosphodiesterase ELAC protein 1; beta-lactamase, hydrolase, metal-binding, tRNA processing, zinc-binding, catabolism; 1.70A {Homo sapiens} Length = 368 Back     alignment and structure
>3bk2_A RNAse J, metal dependent hydrolase; endoribonuclease, exoribonuclease, metallo-beta-lactamase; HET: U5P; 2.10A {Thermus thermophilus} PDB: 3bk1_A* 3t3o_A* 3t3n_A* Length = 562 Back     alignment and structure
>2vw8_A PA1000, PQSE; quinolone signal response protein, signaling protein, SSPF; 1.45A {Pseudomonas aeruginosa PAO1} PDB: 2q0j_A 2q0i_A 3dh8_A* Length = 303 Back     alignment and structure
>4ax1_B Metallo-beta-lactamase AIM-1; hydrolase, antibiotic resistance, acquired B3, drug binding; 1.40A {Pseudomonas aeruginosa} PDB: 4awy_B 4awz_A 4ax0_B Length = 303 Back     alignment and structure
>2r2d_A AGR_PTI_140P, Zn-dependent hydrolases; lactonase, N-acyl hompserine lactone, DI-nuclear zinc center quenching, AIIB, phosphate; HET: PO4; 1.75A {Agrobacterium tumefaciens} Length = 276 Back     alignment and structure
>3aj3_A MLR6805 protein, 4-pyridoxolactonase; Zn-protein, metallo-beta-lactamase, hydrolase; 1.58A {Mesorhizobium loti} PDB: 3aj0_A Length = 274 Back     alignment and structure
>3kl7_A Putative metal-dependent hydrolase; structural genomics, JOI for structural genomics, JCSG; 2.30A {Parabacteroides distasonis atcc 8503} Length = 235 Back     alignment and structure
>1sml_A Protein (penicillinase); metallo-beta-lactamase, antibiotic resistance, binuclear zinc, hydrolase; 1.70A {Stenotrophomonas maltophilia} SCOP: d.157.1.1 PDB: 2aio_A* 2fm6_A 2fu6_A 2fu7_A* 2fu8_A* 2fu9_A* 2gfj_A* 2gfk_A* 2h6a_A 2hb9_A* 2qdt_A* 2qjs_A 2qin_A Length = 269 Back     alignment and structure
>2e7y_A TRNAse Z; tRNA maturation, metallo-beta-lactaMSe, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.97A {Thermotoga maritima} SCOP: d.157.1.7 PDB: 1ww1_A Length = 280 Back     alignment and structure
>1vme_A Flavoprotein; TM0755, structural genomics, JCSG, protein STR initiative, PSI, joint center for structural genomics, ELEC transport; HET: MSE; 1.80A {Thermotoga maritima} SCOP: c.23.5.1 d.157.1.3 Length = 410 Back     alignment and structure
>1y44_A Ribonuclease Z; zinc-dependent metal hydrolase, hydrolase; HET: MES; 2.10A {Bacillus subtilis} SCOP: d.157.1.7 PDB: 2fk6_A* Length = 320 Back     alignment and structure
>2ohh_A Type A flavoprotein FPRA; beta-lactamase like domain, flavodoxine like domain, oxidore; HET: FMN; 1.70A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 2ohi_A* 2ohj_A* Length = 404 Back     alignment and structure
>3m8t_A 'BLR6230 protein; subclass B3 beta-lactamase, zinc enzyme, sulfonamide complex hydrolase-hydrolase inhibitor complex; HET: 4NZ; 1.33A {Bradyrhizobium japonicum} PDB: 3lvz_A* 2gmn_A Length = 294 Back     alignment and structure
>3dha_A N-acyl homoserine lactone hydrolase; zinc bimetallohydrolase, quorum quenching; HET: C6L GOL; 0.95A {Bacillus thuringiensis serovar kurstakorganism_taxid} PDB: 3dhb_A* 3dhc_A* 2a7m_A* 2br6_A 2btn_A Length = 254 Back     alignment and structure
>1k07_A FEZ-1 beta-lactamase; monomer with alpha-beta/BETA-alpha fold. two monomers PER AS UNIT., hydrolase; HET: GOL; 1.65A {Fluoribacter gormanii} SCOP: d.157.1.1 PDB: 1jt1_A* 1l9y_A Length = 263 Back     alignment and structure
>2q9u_A A-type flavoprotein; flavodoxin like, beta lactamase like, oxidoreductase; HET: FMN; 1.90A {Giardia intestinalis} Length = 414 Back     alignment and structure
>1p9e_A Methyl parathion hydrolase; Zn containing; 2.40A {Pseudomonas SP} SCOP: d.157.1.5 Length = 331 Back     alignment and structure
>3adr_A Putative uncharacterized protein ST1585; quorum sensing, quinolone signal, metallo-beta-lactamase FOL conserved hypothetical protein; HET: EPE; 1.80A {Sulfolobus tokodaii} Length = 261 Back     alignment and structure
>3g1p_A Protein PHNP; C-P lyase, phosphodiesterase, phosphonate utilization, alkylphosphonate uptake; 1.40A {Escherichia coli} PDB: 3p2u_A Length = 258 Back     alignment and structure
>3esh_A Protein similar to metal-dependent hydrolase; structural genomics, PSI-2, protein structure initiative; 2.50A {Staphylococcus aureus subsp} Length = 280 Back     alignment and structure
>3rpc_A Possible metal-dependent hydrolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics; 1.49A {Veillonella parvula} Length = 264 Back     alignment and structure
>2cbn_A Ribonuclease Z; phosphodiesterase beta lactamase tRNAse Z, hydrolase, metal- binding, endonuclease, tRNA processing, zinc; 2.9A {Escherichia coli} SCOP: d.157.1.7 Length = 306 Back     alignment and structure
>1ycg_A Nitric oxide reductase; DIIRON site, oxidoreductase; HET: FMN; 2.80A {Moorella thermoacetica} SCOP: c.23.5.1 d.157.1.3 PDB: 1ycf_A* 1ych_A* Length = 398 Back     alignment and structure
>3h3e_A Uncharacterized protein TM1679; structural genomics, surface entropy reduction, ISFI, beta- lactamase superfamily, PSI-2; 2.75A {Thermotoga maritima} Length = 267 Back     alignment and structure
>1e5d_A Rubredoxin\:oxygen oxidoreductase; oxygenreductase, DIIRON-centre, flavoproteins, lactamase-fold; HET: FMN; 2.5A {Desulfovibrio gigas} SCOP: c.23.5.1 d.157.1.3 Length = 402 Back     alignment and structure
>2zo4_A Metallo-beta-lactamase family protein; hydrolase; 2.10A {Thermus thermophilus} Length = 317 Back     alignment and structure
>1vjn_A Zn-dependent hydrolase of metallo-beta-lactamase superfamily TM0207; metallo-hydrolase/oxidoreductase fold, structural genomics; 2.00A {Thermotoga maritima} SCOP: d.157.1.4 Length = 220 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query157
2i7t_A 459 Cleavage and polyadenylation specificity factor 73 99.88
3iek_A 431 Ribonuclease TTHA0252; metallo beta lactamase fold 99.85
2ycb_A 636 Beta-CAsp RNAse, cleavage and polyadenylation spec 99.82
2xr1_A 640 Cleavage and polyadenylation specificity factor 1 99.82
3af5_A 651 Putative uncharacterized protein PH1404; archaeal 99.79
2i7x_A 717 Protein CFT2; polyadenylation, metallo-B-lactamase 99.76
2az4_A 429 Hypothetical protein EF2904; structural genomics, 99.68
3zq4_A 555 Ribonuclease J 1, RNAse J1; hydrolase, RNA maturat 99.67
2cbn_A 306 Ribonuclease Z; phosphodiesterase beta lactamase t 99.66
3bk2_A 562 RNAse J, metal dependent hydrolase; endoribonuclea 99.65
3zwf_A 368 Zinc phosphodiesterase ELAC protein 1; beta-lactam 99.62
1zkp_A 268 Hypothetical protein BA1088; zinc binding protein, 99.62
1y44_A 320 Ribonuclease Z; zinc-dependent metal hydrolase, hy 99.62
3md7_A 293 Beta-lactamase-like; ssgcid, hydrolase, structural 99.59
3jxp_A 321 Coenzyme PQQ synthesis protein B; alpha-beta prote 99.54
3g1p_A 258 Protein PHNP; C-P lyase, phosphodiesterase, phosph 99.54
4ax1_B 303 Metallo-beta-lactamase AIM-1; hydrolase, antibioti 99.51
2zwr_A207 Metallo-beta-lactamase superfamily protein; hydrol 99.5
3m8t_A 294 'BLR6230 protein; subclass B3 beta-lactamase, zinc 99.49
1k07_A 263 FEZ-1 beta-lactamase; monomer with alpha-beta/BETA 99.48
3adr_A 261 Putative uncharacterized protein ST1585; quorum se 99.47
3dha_A254 N-acyl homoserine lactone hydrolase; zinc bimetall 99.47
3iog_A227 Beta-lactamase; hydrolase, antibiotic resistance, 99.46
1sml_A 269 Protein (penicillinase); metallo-beta-lactamase, a 99.46
3esh_A280 Protein similar to metal-dependent hydrolase; stru 99.46
3aj3_A 274 MLR6805 protein, 4-pyridoxolactonase; Zn-protein, 99.44
3kl7_A235 Putative metal-dependent hydrolase; structural gen 99.44
3q6v_A233 Beta-lactamase; metalloenzyme, alpha-beta, hydrola 99.43
1ztc_A221 Hypothetical protein TM0894; structural genomics, 99.4
2r2d_A276 AGR_PTI_140P, Zn-dependent hydrolases; lactonase, 99.4
2xf4_A210 Hydroxyacylglutathione hydrolase; HET: PG4; 2.30A 99.39
3rpc_A 264 Possible metal-dependent hydrolase; structural gen 99.39
3l6n_A219 Metallo-beta-lactamase; zinc, hydolase, antibiotic 99.37
4eyb_A270 Beta-lactamase NDM-1; metallo beta lactamase, anti 99.35
2p4z_A 284 Metal-dependent hydrolases of the beta-lactamase s 99.34
1e5d_A 402 Rubredoxin\:oxygen oxidoreductase; oxygenreductase 99.34
2qed_A 258 Hydroxyacylglutathione hydrolase; metallo-B- super 99.33
4hl2_A243 Beta-lactamase NDM-1; structural genomics, PSI-bio 99.33
2vw8_A 303 PA1000, PQSE; quinolone signal response protein, s 99.32
3hnn_A 262 Putative diflavin flavoprotein A 5; PSI-2, protein 99.32
1p9e_A 331 Methyl parathion hydrolase; Zn containing; 2.40A { 99.31
4dik_A 410 Flavoprotein; TM0755, electron transport, DI-iron 99.31
2zo4_A 317 Metallo-beta-lactamase family protein; hydrolase; 99.31
2bib_A 547 CBPE, teichoic acid phosphorylcholine esterase/ ch 99.28
1m2x_A223 Class B carbapenemase BLAB-1; alpha-beta/BETA-alph 99.26
2wyl_A 360 L-ascorbate-6-phosphate lactonase ULAG; hydrolase; 99.26
2ohh_A 404 Type A flavoprotein FPRA; beta-lactamase like doma 99.26
4efz_A 298 Metallo-beta-lactamase family protein; structural 99.26
3bv6_A 379 Metal-dependent hydrolase; metallo protein, beta-l 99.25
1a7t_A232 Metallo-beta-lactamase; hydrolase (beta-lactamase) 99.25
1mqo_A227 Beta-lactamase II; alpha-beta/BETA-alpha fold, hyd 99.25
1ycg_A 398 Nitric oxide reductase; DIIRON site, oxidoreductas 99.24
1jjt_A228 IMP-1 metallo beta-lactamase; metallo-beta-lactama 99.24
1qh5_A 260 Glyoxalase II, protein (hydroxyacylglutathione hyd 99.24
3tp9_A 474 Beta-lactamase and rhodanese domain protein; struc 99.22
2p18_A 311 Glyoxalase II; metalloprotein, beta sandwich, alph 99.22
2e7y_A 280 TRNAse Z; tRNA maturation, metallo-beta-lactaMSe, 99.21
2y8b_A265 Metallo-B-lactamase; hydrolase, cephalosporins, an 99.2
2q9u_A 414 A-type flavoprotein; flavodoxin like, beta lactama 99.2
1xm8_A 254 Glyoxalase II; structural genomics, protein struct 99.2
4ad9_A 289 Lactb2, beta-lactamase-like protein 2; hydrolase, 99.2
2gcu_A 245 Putative hydroxyacylglutathione hydrolase 3; ethyl 99.2
2fhx_A246 SPM-1; metallo-beta-lactamase, dinuclear zinc, ant 99.19
3r2u_A 466 Metallo-beta-lactamase family protein; structural 99.17
2cfu_A 658 SDSA1; SDS-hydrolase, lactamase, hydrolase; HET: 1 99.04
2p97_A201 Hypothetical protein; putative metal-dependent hyd 98.97
2yhe_A 668 SEC-alkyl sulfatase; hydrolase, inversion, metallo 98.51
3h3e_A 267 Uncharacterized protein TM1679; structural genomic 98.9
1vjn_A220 Zn-dependent hydrolase of metallo-beta-lactamase s 98.86
4b87_A 367 DNA cross-LINK repair 1A protein; dclre1A, DCLRE, 98.7
3zdk_A 336 5' exonuclease apollo; hydrolase; HET: TLA; 2.16A 98.48
>2i7t_A Cleavage and polyadenylation specificity factor 73 kDa subunit; metallo-B-lactamase, PRE-mRNA processing, artemis, V(D)J recombination; 2.10A {Homo sapiens} SCOP: d.157.1.10 PDB: 2i7v_A Back     alignment and structure
Probab=99.88  E-value=3.8e-22  Score=162.00  Aligned_cols=137  Identities=61%  Similarity=1.092  Sum_probs=104.5

Q ss_pred             CCCCeEEEEEecCCCCccccEEEEEECCeEEEEecCCCCCcCCCCCCCCCCCCCCCCccEEEecCCchhhhCChhHHHhh
Q 031588           19 REGDQLTIIPLGAGNEVGRSCVYMSYKGKTILFDCGIHPAYSGMAALPYFDEIDPSAIDVLLITHFHLDHAASLPYFLEK   98 (157)
Q Consensus        19 ~~~~~~~i~~lg~~~~~~~~~~li~~~~~~iLiD~G~~~~~~~~~~~~~~~~~~~~~i~~I~iTH~H~DH~gg~~~l~~~   98 (157)
                      ..+++|+|++||+++++++||++|+.++..||||||..........+..+...++.+||+|||||.|.||+||++.+...
T Consensus         7 ~~~~~m~i~~LG~~~~vg~s~~li~~~~~~iLID~G~~~~~~~~~~~~~l~~~~~~~Id~VllTH~H~DH~ggl~~l~~~   86 (459)
T 2i7t_A            7 EESDQLLIRPLGAGQEVGRSCIILEFKGRKIMLDCGIHPGLEGMDALPYIDLIDPAEIDLLLISHFHLDHCGALPWFLQK   86 (459)
T ss_dssp             --CEEEEEEEEESSSSSSSCEEEEEETTEEEEECCCCCTTSCGGGGSCCGGGSCGGGCCEEECCCSSHHHHTTHHHHHHH
T ss_pred             CCCCeEEEEEEecCCCCCCCEEEEEECCeEEEEeCCCCcCcccccccCcccccCcccCcEEEECCCChhhhhhhHHHHHh
Confidence            34568999999999999999999999999999999986432222333333456778999999999999999999999877


Q ss_pred             cCCCceEEechHHHHHHHHhHHHHHHhhhcccCCCCCCHHHHHHHHhcceEecccee
Q 031588           99 TTFSGRVFMTHATKAIYKLLLTDYVKVSKVSVEDMLFDEQDINRSMDRIEVCFLSCC  155 (157)
Q Consensus        99 ~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~i~~v~~~~~  155 (157)
                      .+++.++|++..+.++++.++.+..+......+...|+.+++.....++..++|++.
T Consensus        87 ~~~~~~iy~t~~t~~l~~~~l~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  143 (459)
T 2i7t_A           87 TSFKGRTFMTHATKAIYRWLLSDYVKVSNISADDMLYTETDLEESMDKIETINFHEV  143 (459)
T ss_dssp             SSCCSEEEEEHHHHHHHHHHHHHHCC---------CCCHHHHHHHGGGEEEECTTCC
T ss_pred             cCCCCCEEechHHHHHHHHHHHHHHHHhcccccccccCHHHHHHHHhccEEeCCCCE
Confidence            666789999999999888777665544433334567888889888888888888765
>3iek_A Ribonuclease TTHA0252; metallo beta lactamase fold, endonuclease, hydrolase, metal- nuclease, RNA-binding, rRNA processing; HET: FLC; 2.05A {Thermus thermophilus} SCOP: d.157.1.10 PDB: 2dkf_A* 3iel_A* 3iem_A* 2zdf_A* 3idz_A* 2zdd_A* 3ie0_A* 2zde_A* 3ie1_A* 2zdw_A* 3a4y_A* 2yvd_A* 3ie2_A* Back     alignment and structure
>2ycb_A Beta-CAsp RNAse, cleavage and polyadenylation specificity factor; hydrolase, KH, metallo-beta-lactamase; 3.10A {Methanothermobacter thermautotrophicusorganism_taxid} Back     alignment and structure
>2xr1_A Cleavage and polyadenylation specificity factor 1 subunit; hydrolase, metallo-beta-lactamase, beta-CAsp, RNA processing; 2.59A {Methanosarcina mazei} Back     alignment and structure
>3af5_A Putative uncharacterized protein PH1404; archaeal CPSF, beta-CAsp family, KH domain, ribonuclease, ME beta-lactamase superfamily, archaea; 2.60A {Pyrococcus horikoshii} PDB: 3af6_A* Back     alignment and structure
>2i7x_A Protein CFT2; polyadenylation, metallo-B-lactamase, PRE-mRNA processing, artemis, V(D)J recombination, double-strand break repair; 2.50A {Saccharomyces cerevisiae} SCOP: d.157.1.10 Back     alignment and structure
>2az4_A Hypothetical protein EF2904; structural genomics, PSI, protein STR initiative, midwest center for structural genomics, MCSG, U function; 2.00A {Enterococcus faecalis} SCOP: d.157.1.10 Back     alignment and structure
>3zq4_A Ribonuclease J 1, RNAse J1; hydrolase, RNA maturation; 3.00A {Bacillus subtilis} Back     alignment and structure
>2cbn_A Ribonuclease Z; phosphodiesterase beta lactamase tRNAse Z, hydrolase, metal- binding, endonuclease, tRNA processing, zinc; 2.9A {Escherichia coli} SCOP: d.157.1.7 Back     alignment and structure
>3bk2_A RNAse J, metal dependent hydrolase; endoribonuclease, exoribonuclease, metallo-beta-lactamase; HET: U5P; 2.10A {Thermus thermophilus} PDB: 3bk1_A* 3t3o_A* 3t3n_A* Back     alignment and structure
>3zwf_A Zinc phosphodiesterase ELAC protein 1; beta-lactamase, hydrolase, metal-binding, tRNA processing, zinc-binding, catabolism; 1.70A {Homo sapiens} Back     alignment and structure
>1zkp_A Hypothetical protein BA1088; zinc binding protein, structural genomics, PSI, protein STRU initiative; 1.50A {Bacillus anthracis str} SCOP: d.157.1.9 Back     alignment and structure
>1y44_A Ribonuclease Z; zinc-dependent metal hydrolase, hydrolase; HET: MES; 2.10A {Bacillus subtilis} SCOP: d.157.1.7 PDB: 2fk6_A* Back     alignment and structure
>3md7_A Beta-lactamase-like; ssgcid, hydrolase, structural genomics, structural genomics center for infectious disease; HET: 5GP TLA; 1.27A {Brucella melitensis biovar abortus} PDB: 3qh8_A* 3py6_A* 3py5_A* Back     alignment and structure
>3jxp_A Coenzyme PQQ synthesis protein B; alpha-beta protein, PQQ biosynthesis, transport, biosyntheti; 2.20A {Pseudomonas putida} SCOP: d.157.1.6 PDB: 1xto_A Back     alignment and structure
>3g1p_A Protein PHNP; C-P lyase, phosphodiesterase, phosphonate utilization, alkylphosphonate uptake; 1.40A {Escherichia coli} PDB: 3p2u_A Back     alignment and structure
>4ax1_B Metallo-beta-lactamase AIM-1; hydrolase, antibiotic resistance, acquired B3, drug binding; 1.40A {Pseudomonas aeruginosa} PDB: 4awy_B 4awz_A 4ax0_B Back     alignment and structure
>2zwr_A Metallo-beta-lactamase superfamily protein; hydrolase; 2.20A {Thermus thermophilus} PDB: 2zzi_A Back     alignment and structure
>3m8t_A 'BLR6230 protein; subclass B3 beta-lactamase, zinc enzyme, sulfonamide complex hydrolase-hydrolase inhibitor complex; HET: 4NZ; 1.33A {Bradyrhizobium japonicum} PDB: 3lvz_A* 2gmn_A Back     alignment and structure
>1k07_A FEZ-1 beta-lactamase; monomer with alpha-beta/BETA-alpha fold. two monomers PER AS UNIT., hydrolase; HET: GOL; 1.65A {Fluoribacter gormanii} SCOP: d.157.1.1 PDB: 1jt1_A* 1l9y_A Back     alignment and structure
>3adr_A Putative uncharacterized protein ST1585; quorum sensing, quinolone signal, metallo-beta-lactamase FOL conserved hypothetical protein; HET: EPE; 1.80A {Sulfolobus tokodaii} Back     alignment and structure
>3dha_A N-acyl homoserine lactone hydrolase; zinc bimetallohydrolase, quorum quenching; HET: C6L GOL; 0.95A {Bacillus thuringiensis serovar kurstakorganism_taxid} PDB: 3dhb_A* 3dhc_A* 2a7m_A* 2br6_A 2btn_A Back     alignment and structure
>3iog_A Beta-lactamase; hydrolase, antibiotic resistance, metal-binding; HET: SDF; 1.41A {Aeromonas hydrophila} SCOP: d.157.1.1 PDB: 1x8i_A 3fai_A* 3iof_A* 1x8h_A 2qds_A* 2gkl_A* 1x8g_A* 3f9o_A 3t9m_A 3sw3_A Back     alignment and structure
>1sml_A Protein (penicillinase); metallo-beta-lactamase, antibiotic resistance, binuclear zinc, hydrolase; 1.70A {Stenotrophomonas maltophilia} SCOP: d.157.1.1 PDB: 2aio_A* 2fm6_A 2fu6_A 2fu7_A* 2fu8_A* 2fu9_A* 2gfj_A* 2gfk_A* 2h6a_A 2hb9_A* 2qdt_A* 2qjs_A 2qin_A Back     alignment and structure
>3esh_A Protein similar to metal-dependent hydrolase; structural genomics, PSI-2, protein structure initiative; 2.50A {Staphylococcus aureus subsp} Back     alignment and structure
>3aj3_A MLR6805 protein, 4-pyridoxolactonase; Zn-protein, metallo-beta-lactamase, hydrolase; 1.58A {Mesorhizobium loti} PDB: 3aj0_A Back     alignment and structure
>3kl7_A Putative metal-dependent hydrolase; structural genomics, JOI for structural genomics, JCSG; 2.30A {Parabacteroides distasonis atcc 8503} Back     alignment and structure
>3q6v_A Beta-lactamase; metalloenzyme, alpha-beta, hydrolase; 1.37A {Serratia fonticola} PDB: 3sd9_A Back     alignment and structure
>1ztc_A Hypothetical protein TM0894; structural genomics, joint center for structural genomics, J protein structure initiative, PSI, hydrolase; HET: MSE; 2.10A {Thermotoga maritima} SCOP: d.157.1.11 Back     alignment and structure
>2r2d_A AGR_PTI_140P, Zn-dependent hydrolases; lactonase, N-acyl hompserine lactone, DI-nuclear zinc center quenching, AIIB, phosphate; HET: PO4; 1.75A {Agrobacterium tumefaciens} Back     alignment and structure
>2xf4_A Hydroxyacylglutathione hydrolase; HET: PG4; 2.30A {Salmonella enterica} Back     alignment and structure
>3rpc_A Possible metal-dependent hydrolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics; 1.49A {Veillonella parvula} Back     alignment and structure
>3l6n_A Metallo-beta-lactamase; zinc, hydolase, antibiotics resistance, hydrolase; 1.65A {Chryseobacterium indologenes} SCOP: d.157.1.0 Back     alignment and structure
>4eyb_A Beta-lactamase NDM-1; metallo beta lactamase, antibiotic, hydrolase-antibiotic COM; HET: 0WO; 1.16A {Klebsiella pneumoniae} PDB: 4ey2_A* 4eyf_A* 4exy_A 4exs_B 4eyl_A* 3spu_A 3q6x_A* 3rkj_A 3sfp_A* 3rkk_A* 3sbl_A* 3srx_A 3zr9_A 3s0z_A 3pg4_A Back     alignment and structure
>2p4z_A Metal-dependent hydrolases of the beta-lactamase superfamily II; metal-dependent hydrolases of the beta-lactamase superfamily hydrolase; 2.10A {Thermoanaerobacter tengcongensis} Back     alignment and structure
>1e5d_A Rubredoxin\:oxygen oxidoreductase; oxygenreductase, DIIRON-centre, flavoproteins, lactamase-fold; HET: FMN; 2.5A {Desulfovibrio gigas} SCOP: c.23.5.1 d.157.1.3 Back     alignment and structure
>2qed_A Hydroxyacylglutathione hydrolase; metallo-B- superfamily, salmonella typhimurium LT2; 1.45A {Salmonella typhimurium} SCOP: d.157.1.2 Back     alignment and structure
>4hl2_A Beta-lactamase NDM-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: ZZ7; 1.05A {Klebsiella pneumoniae} PDB: 4hl1_A* 4h0d_A* 4gyu_A* 4gyq_A 3q6x_A* 3spu_A 3rkj_A 3sfp_A* 3rkk_A* 3sbl_A* 3srx_A 3zr9_A 3s0z_A 3pg4_A Back     alignment and structure
>2vw8_A PA1000, PQSE; quinolone signal response protein, signaling protein, SSPF; 1.45A {Pseudomonas aeruginosa PAO1} PDB: 2q0j_A 2q0i_A 3dh8_A* Back     alignment and structure
>1p9e_A Methyl parathion hydrolase; Zn containing; 2.40A {Pseudomonas SP} SCOP: d.157.1.5 Back     alignment and structure
>4dik_A Flavoprotein; TM0755, electron transport, DI-iron protein; 1.75A {Thermotoga maritima} PDB: 4dil_A 1vme_A* Back     alignment and structure
>2zo4_A Metallo-beta-lactamase family protein; hydrolase; 2.10A {Thermus thermophilus} Back     alignment and structure
>2bib_A CBPE, teichoic acid phosphorylcholine esterase/ choline protein; choline-binding protein, PCE, phosphorylcholine estera hydrolase; HET: PC BTB; 1.92A {Streptococcus pneumoniae} SCOP: b.109.1.1 d.157.1.8 PDB: 1wra_A* Back     alignment and structure
>1m2x_A Class B carbapenemase BLAB-1; alpha-beta/BETA-alpha fold., hydrolase; HET: MCO; 1.50A {Elizabethkingia meningoseptica} SCOP: d.157.1.1 Back     alignment and structure
>2wyl_A L-ascorbate-6-phosphate lactonase ULAG; hydrolase; 2.59A {Escherichia coli} PDB: 2wym_A* Back     alignment and structure
>2ohh_A Type A flavoprotein FPRA; beta-lactamase like domain, flavodoxine like domain, oxidore; HET: FMN; 1.70A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 2ohi_A* 2ohj_A* Back     alignment and structure
>4efz_A Metallo-beta-lactamase family protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.60A {Burkholderia pseudomallei} Back     alignment and structure
>3bv6_A Metal-dependent hydrolase; metallo protein, beta-lactamase like fold, MCSG, structural PSI-2, protein structure initiative; 1.80A {Vibrio cholerae o1 biovar eltor} Back     alignment and structure
>1a7t_A Metallo-beta-lactamase; hydrolase (beta-lactamase), zinc; HET: MES; 1.85A {Bacteroides fragilis} SCOP: d.157.1.1 PDB: 1a8t_A* 2bmi_A 1kr3_A 1znb_A 2znb_A 3znb_A 4znb_A 1hlk_A* Back     alignment and structure
>1mqo_A Beta-lactamase II; alpha-beta/BETA-alpha fold, hydrolase; HET: CIT; 1.35A {Bacillus cereus} SCOP: d.157.1.1 PDB: 1bc2_A 1bvt_A* 3i0v_A 3i11_A 3i13_A 3i14_A 3i15_A 2uyx_A 2bc2_A 3bc2_A 2bfl_A 2bfk_A 2bfz_B 2bg2_A 2bg7_A 2bg8_A 1dxk_A 3kns_A 3knr_A 2bfz_A ... Back     alignment and structure
>1ycg_A Nitric oxide reductase; DIIRON site, oxidoreductase; HET: FMN; 2.80A {Moorella thermoacetica} SCOP: c.23.5.1 d.157.1.3 PDB: 1ycf_A* 1ych_A* Back     alignment and structure
>1jjt_A IMP-1 metallo beta-lactamase; metallo-beta-lactamase inhibitor, succinic acid inhibitor, I metallo-beta-lactamase, hydrolase; HET: BDS; 1.80A {Pseudomonas aeruginosa} SCOP: d.157.1.1 PDB: 1dd6_A* 1vgn_A* 2doo_A* 1wup_A 1wuo_A 1jje_A* 1ddk_A Back     alignment and structure
>1qh5_A Glyoxalase II, protein (hydroxyacylglutathione hydrolase); metallo-hydrolase; HET: GSH GBP; 1.45A {Homo sapiens} SCOP: d.157.1.2 PDB: 1qh3_A* Back     alignment and structure
>3tp9_A Beta-lactamase and rhodanese domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.70A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>2p18_A Glyoxalase II; metalloprotein, beta sandwich, alpha-helical domain, hydrola; HET: SPD; 1.80A {Leishmania infantum} PDB: 2p1e_A* Back     alignment and structure
>2e7y_A TRNAse Z; tRNA maturation, metallo-beta-lactaMSe, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.97A {Thermotoga maritima} SCOP: d.157.1.7 PDB: 1ww1_A Back     alignment and structure
>2y8b_A Metallo-B-lactamase; hydrolase, cephalosporins, antibiotic recognition; 1.70A {Pseudomonas aeruginosa} PDB: 2y8a_A 2y87_A 2yz3_A* 2whg_A* 2wrs_A* 1ko3_A 1ko2_A Back     alignment and structure
>2q9u_A A-type flavoprotein; flavodoxin like, beta lactamase like, oxidoreductase; HET: FMN; 1.90A {Giardia intestinalis} Back     alignment and structure
>1xm8_A Glyoxalase II; structural genomics, protein structure initiative, CESG, AT2G31350, metallo-hydrolase, zinc/iron binuclear center; 1.74A {Arabidopsis thaliana} SCOP: d.157.1.2 PDB: 2q42_A Back     alignment and structure
>4ad9_A Lactb2, beta-lactamase-like protein 2; hydrolase, metallo-beta lactamase, mitochondria; 2.60A {Homo sapiens} Back     alignment and structure
>2gcu_A Putative hydroxyacylglutathione hydrolase 3; ethylmalonic encephalopathy, ETHE1, structural genomics, protein structure initiative; 1.48A {Arabidopsis thaliana} Back     alignment and structure
>2fhx_A SPM-1; metallo-beta-lactamase, dinuclear zinc, antibiotic resistanc hydrolase, metal binding protein; 1.90A {Pseudomonas aeruginosa} Back     alignment and structure
>3r2u_A Metallo-beta-lactamase family protein; structural genomics, for structural genomics of infectious diseases, csgid, HYDR; 2.10A {Staphylococcus aureus} Back     alignment and structure
>2cfu_A SDSA1; SDS-hydrolase, lactamase, hydrolase; HET: 1DB; 1.9A {Pseudomonas aeruginosa} SCOP: d.106.1.3 d.157.1.13 PDB: 2cfz_A* 2cg2_A 2cg3_A* Back     alignment and structure
>2p97_A Hypothetical protein; putative metal-dependent hydrolase, structural genomics, JOI for structural genomics, JCSG; HET: MSE; 1.65A {Anabaena variabilis atcc 29413} SCOP: d.157.1.12 Back     alignment and structure
>2yhe_A SEC-alkyl sulfatase; hydrolase, inversion, metallo-beta-lactamase fold; 2.70A {Pseudomonas SP} Back     alignment and structure
>3h3e_A Uncharacterized protein TM1679; structural genomics, surface entropy reduction, ISFI, beta- lactamase superfamily, PSI-2; 2.75A {Thermotoga maritima} Back     alignment and structure
>1vjn_A Zn-dependent hydrolase of metallo-beta-lactamase superfamily TM0207; metallo-hydrolase/oxidoreductase fold, structural genomics; 2.00A {Thermotoga maritima} SCOP: d.157.1.4 Back     alignment and structure
>4b87_A DNA cross-LINK repair 1A protein; dclre1A, DCLRE, interstrand crosslink repair, hydrolase, NIT mustard, cancer, chemotherapy, PSO2 homolog,; HET: DNA; 2.16A {Homo sapiens} Back     alignment and structure
>3zdk_A 5' exonuclease apollo; hydrolase; HET: TLA; 2.16A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 157
d2i7ta1 451 d.157.1.10 (A:9-459) Cleavage and polyadenylation 6e-40
d2i7xa1 514 d.157.1.10 (A:1-422,A:626-717) Cleavage factor two 3e-33
d2dkfa1 431 d.157.1.10 (A:1-431) Putative RNA-degradation prot 5e-30
d1wraa1 305 d.157.1.8 (A:30-334) Teichoic acid phosphorylcholi 3e-13
d1ztca1207 d.157.1.11 (A:1-207) Hypothetical protein TM0894 { 2e-06
d2e7ya1 280 d.157.1.7 (A:1-280) Ribonuclease Z (RNase Z) {Ther 1e-05
d1xtoa_ 304 d.157.1.6 (A:) Coenzyme PQQ synthesis protein B, P 3e-05
d1p9ea_ 294 d.157.1.5 (A:) Methyl parathion hydrolase {Pseudom 3e-05
d1zkpa1 244 d.157.1.9 (A:1-244) Hypothetical protein BA1088 (B 4e-05
d1vmea2250 d.157.1.3 (A:1-250) ROO-like flavoprotein TM0755, 4e-05
d2gmna1 264 d.157.1.1 (A:29-292) Zn metallo-beta-lactamase {Br 5e-05
d2cfua2 505 d.157.1.13 (A:20-524) Alkylsulfatase SdsA1 {Pseudo 8e-05
d2q0ia1 298 d.157.1.14 (A:1-298) Quinolone signal response pro 1e-04
d2az4a1183 d.157.1.10 (A:56-238) Hypothetical protein EF2904 2e-04
d1y44a1 307 d.157.1.7 (A:1-307) Ribonuclease Z (RNase Z) {Baci 2e-04
d2aioa1 266 d.157.1.1 (A:23-311) Zn metallo-beta-lactamase {Xa 3e-04
d2cbna1 305 d.157.1.7 (A:1-305) Ribonuclease Z (RNase Z) {Esch 4e-04
d1vjna_209 d.157.1.4 (A:) Hypothetical protein TM0207 {Thermo 0.002
d1e5da2249 d.157.1.3 (A:2-250) Rubredoxin oxygen:oxidoreducta 0.003
>d2i7ta1 d.157.1.10 (A:9-459) Cleavage and polyadenylation specificity factor subunit 3 {Human (Homo sapiens) [TaxId: 9606]} Length = 451 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Metallo-hydrolase/oxidoreductase
superfamily: Metallo-hydrolase/oxidoreductase
family: beta-CASP RNA-metabolising hydrolases
domain: Cleavage and polyadenylation specificity factor subunit 3
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  137 bits (345), Expect = 6e-40
 Identities = 82/126 (65%), Positives = 101/126 (80%)

Query: 22  DQLTIIPLGAGNEVGRSCVYMSYKGKTILFDCGIHPAYSGMAALPYFDEIDPSAIDVLLI 81
           DQL I PLGAG EVGRSC+ + +KG+ I+ DCGIHP   GM ALPY D IDP+ ID+LLI
Sbjct: 2   DQLLIRPLGAGQEVGRSCIILEFKGRKIMLDCGIHPGLEGMDALPYIDLIDPAEIDLLLI 61

Query: 82  THFHLDHAASLPYFLEKTTFSGRVFMTHATKAIYKLLLTDYVKVSKVSVEDMLFDEQDIN 141
           +HFHLDH  +LP+FL+KT+F GR FMTHATKAIY+ LL+DYVKVS +S +DML+ E D+ 
Sbjct: 62  SHFHLDHCGALPWFLQKTSFKGRTFMTHATKAIYRWLLSDYVKVSNISADDMLYTETDLE 121

Query: 142 RSMDRI 147
            SMD+I
Sbjct: 122 ESMDKI 127
>d2i7xa1 d.157.1.10 (A:1-422,A:626-717) Cleavage factor two protein 2, CFT2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 514 Back     information, alignment and structure
>d2dkfa1 d.157.1.10 (A:1-431) Putative RNA-degradation protein TTHA0252 {Thermus thermophilus [TaxId: 274]} Length = 431 Back     information, alignment and structure
>d1wraa1 d.157.1.8 (A:30-334) Teichoic acid phosphorylcholine esterase Pce (LytD), N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Length = 305 Back     information, alignment and structure
>d1ztca1 d.157.1.11 (A:1-207) Hypothetical protein TM0894 {Thermotoga maritima [TaxId: 2336]} Length = 207 Back     information, alignment and structure
>d2e7ya1 d.157.1.7 (A:1-280) Ribonuclease Z (RNase Z) {Thermotoga maritima [TaxId: 2336]} Length = 280 Back     information, alignment and structure
>d1xtoa_ d.157.1.6 (A:) Coenzyme PQQ synthesis protein B, PqqB {Pseudomonas putida [TaxId: 303]} Length = 304 Back     information, alignment and structure
>d1p9ea_ d.157.1.5 (A:) Methyl parathion hydrolase {Pseudomonas sp. WBC-3 [TaxId: 165468]} Length = 294 Back     information, alignment and structure
>d1zkpa1 d.157.1.9 (A:1-244) Hypothetical protein BA1088 (BAS1016) {Bacillus anthracis [TaxId: 1392]} Length = 244 Back     information, alignment and structure
>d1vmea2 d.157.1.3 (A:1-250) ROO-like flavoprotein TM0755, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Length = 250 Back     information, alignment and structure
>d2gmna1 d.157.1.1 (A:29-292) Zn metallo-beta-lactamase {Bradyrhizobium japonicum [TaxId: 375]} Length = 264 Back     information, alignment and structure
>d2cfua2 d.157.1.13 (A:20-524) Alkylsulfatase SdsA1 {Pseudomonas aeruginosa [TaxId: 287]} Length = 505 Back     information, alignment and structure
>d2q0ia1 d.157.1.14 (A:1-298) Quinolone signal response protein PqsE {Pseudomonas aeruginosa [TaxId: 287]} Length = 298 Back     information, alignment and structure
>d2az4a1 d.157.1.10 (A:56-238) Hypothetical protein EF2904 {Enterococcus faecalis [TaxId: 1351]} Length = 183 Back     information, alignment and structure
>d1y44a1 d.157.1.7 (A:1-307) Ribonuclease Z (RNase Z) {Bacillus subtilis [TaxId: 1423]} Length = 307 Back     information, alignment and structure
>d2aioa1 d.157.1.1 (A:23-311) Zn metallo-beta-lactamase {Xanthomonas maltophilia [TaxId: 40324]} Length = 266 Back     information, alignment and structure
>d2cbna1 d.157.1.7 (A:1-305) Ribonuclease Z (RNase Z) {Escherichia coli [TaxId: 562]} Length = 305 Back     information, alignment and structure
>d1vjna_ d.157.1.4 (A:) Hypothetical protein TM0207 {Thermotoga maritima [TaxId: 2336]} Length = 209 Back     information, alignment and structure
>d1e5da2 d.157.1.3 (A:2-250) Rubredoxin oxygen:oxidoreductase (ROO), N-terminal domain {Desulfovibrio gigas [TaxId: 879]} Length = 249 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query157
d2i7ta1 451 Cleavage and polyadenylation specificity factor su 99.9
d2dkfa1 431 Putative RNA-degradation protein TTHA0252 {Thermus 99.86
d2i7xa1 514 Cleavage factor two protein 2, CFT2 {Baker's yeast 99.86
d2cbna1 305 Ribonuclease Z (RNase Z) {Escherichia coli [TaxId: 99.64
d1zkpa1 244 Hypothetical protein BA1088 (BAS1016) {Bacillus an 99.6
d1y44a1 307 Ribonuclease Z (RNase Z) {Bacillus subtilis [TaxId 99.59
d1xtoa_ 304 Coenzyme PQQ synthesis protein B, PqqB {Pseudomona 99.54
d2aioa1 266 Zn metallo-beta-lactamase {Xanthomonas maltophilia 99.54
d2gmna1 264 Zn metallo-beta-lactamase {Bradyrhizobium japonicu 99.5
d1k07a_ 262 Zn metallo-beta-lactamase {Fluoribacter gormanii, 99.47
d1ztca1207 Hypothetical protein TM0894 {Thermotoga maritima [ 99.42
d1x8ha_228 Zn metallo-beta-lactamase {Aeromonas hydrophila, C 99.41
d2q0ia1 298 Quinolone signal response protein PqsE {Pseudomona 99.38
d1p9ea_ 294 Methyl parathion hydrolase {Pseudomonas sp. WBC-3 99.38
d1vmea2250 ROO-like flavoprotein TM0755, N-terminal domain {T 99.34
d1wraa1 305 Teichoic acid phosphorylcholine esterase Pce (LytD 99.32
d1e5da2249 Rubredoxin oxygen:oxidoreductase (ROO), N-terminal 99.23
d1ycga2249 Nitric oxide reductase N-terminal domain {Moorella 99.23
d1m2xa_219 Zn metallo-beta-lactamase {Chryseobacterium mening 99.23
d1ko3a_230 Zn metallo-beta-lactamase {Pseudomonas aeruginosa, 99.22
d2e7ya1 280 Ribonuclease Z (RNase Z) {Thermotoga maritima [Tax 99.18
d1jjta_220 Zn metallo-beta-lactamase {Pseudomonas aeruginosa, 99.13
d1znba_230 Zn metallo-beta-lactamase {Bacteroides fragilis [T 99.1
d1mqoa_221 Zn metallo-beta-lactamase {Bacillus cereus [TaxId: 99.1
d1xm8a_ 254 Glyoxalase II (hydroxyacylglutathione hydrolase) { 98.9
d2qeda1 251 Glyoxalase II (hydroxyacylglutathione hydrolase) { 98.9
d2cfua2 505 Alkylsulfatase SdsA1 {Pseudomonas aeruginosa [TaxI 98.9
d1qh5a_ 260 Glyoxalase II (hydroxyacylglutathione hydrolase) { 98.9
d2az4a1183 Hypothetical protein EF2904 {Enterococcus faecalis 98.89
d2p97a1200 Hypothetical protein Ava3068 {Anabaena variabilis 98.75
d1vjna_209 Hypothetical protein TM0207 {Thermotoga maritima [ 98.72
>d2i7ta1 d.157.1.10 (A:9-459) Cleavage and polyadenylation specificity factor subunit 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Metallo-hydrolase/oxidoreductase
superfamily: Metallo-hydrolase/oxidoreductase
family: beta-CASP RNA-metabolising hydrolases
domain: Cleavage and polyadenylation specificity factor subunit 3
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.90  E-value=1.1e-23  Score=166.84  Aligned_cols=134  Identities=62%  Similarity=1.105  Sum_probs=108.4

Q ss_pred             CeEEEEEecCCCCccccEEEEEECCeEEEEecCCCCCcCCCCCCCCCCCCCCCCccEEEecCCchhhhCChhHHHhhcCC
Q 031588           22 DQLTIIPLGAGNEVGRSCVYMSYKGKTILFDCGIHPAYSGMAALPYFDEIDPSAIDVLLITHFHLDHAASLPYFLEKTTF  101 (157)
Q Consensus        22 ~~~~i~~lg~~~~~~~~~~li~~~~~~iLiD~G~~~~~~~~~~~~~~~~~~~~~i~~I~iTH~H~DH~gg~~~l~~~~~~  101 (157)
                      +.|.|++||+.++.|+||++++.++.+||||||..........++.+..+.+.+||+|||||+|.||+||++++.....+
T Consensus         2 ~~~~~~plGG~~eIG~n~~lv~~~~~~il~D~G~~~~~~~~~~~p~~~~~~~~~id~i~lTH~H~DH~ggLp~l~~~~~~   81 (451)
T d2i7ta1           2 DQLLIRPLGAGQEVGRSCIILEFKGRKIMLDCGIHPGLEGMDALPYIDLIDPAEIDLLLISHFHLDHCGALPWFLQKTSF   81 (451)
T ss_dssp             EEEEEEEEESSSSSSSCEEEEEETTEEEEECCCCCTTSCGGGGSCCGGGSCGGGCCEEECCCSSHHHHTTHHHHHHHSSC
T ss_pred             CcEEEEEccCCCcccccEEEEEECCeEEEEeCCCCCCccccccCCCccCCCHhhCCEEEECCCcHHHhCchHHHHHhcCC
Confidence            57899999999999999999999999999999986544444444555556778999999999999999999999987767


Q ss_pred             CceEEechHHHHHHHHhHHHHHHhhhcccCCCCCCHHHHHHHHhcceEecccee
Q 031588          102 SGRVFMTHATKAIYKLLLTDYVKVSKVSVEDMLFDEQDINRSMDRIEVCFLSCC  155 (157)
Q Consensus       102 ~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~i~~v~~~~~  155 (157)
                      +.+||+++.|.++++..+...............++..+++..+..+..+.|.+.
T Consensus        82 ~~pIy~s~~T~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  135 (451)
T d2i7ta1          82 KGRTFMTHATKAIYRWLLSDYVKVSNISADDMLYTETDLEESMDKIETINFHEV  135 (451)
T ss_dssp             CSEEEEEHHHHHHHHHHHHHHCC---------CCCHHHHHHHGGGEEEECTTCC
T ss_pred             CCCEEechhHhhhhhhhhhhhhhhhhcccccccCcHHHHHHhhhhcceecCCce
Confidence            899999999999999887776666555556678999999999999999888764
>d2dkfa1 d.157.1.10 (A:1-431) Putative RNA-degradation protein TTHA0252 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2i7xa1 d.157.1.10 (A:1-422,A:626-717) Cleavage factor two protein 2, CFT2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cbna1 d.157.1.7 (A:1-305) Ribonuclease Z (RNase Z) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zkpa1 d.157.1.9 (A:1-244) Hypothetical protein BA1088 (BAS1016) {Bacillus anthracis [TaxId: 1392]} Back     information, alignment and structure
>d1y44a1 d.157.1.7 (A:1-307) Ribonuclease Z (RNase Z) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1xtoa_ d.157.1.6 (A:) Coenzyme PQQ synthesis protein B, PqqB {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2aioa1 d.157.1.1 (A:23-311) Zn metallo-beta-lactamase {Xanthomonas maltophilia [TaxId: 40324]} Back     information, alignment and structure
>d2gmna1 d.157.1.1 (A:29-292) Zn metallo-beta-lactamase {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d1k07a_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Fluoribacter gormanii, (Legionella gormanii) FEZ-1 [TaxId: 464]} Back     information, alignment and structure
>d1ztca1 d.157.1.11 (A:1-207) Hypothetical protein TM0894 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1x8ha_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Aeromonas hydrophila, CphA [TaxId: 644]} Back     information, alignment and structure
>d2q0ia1 d.157.1.14 (A:1-298) Quinolone signal response protein PqsE {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1p9ea_ d.157.1.5 (A:) Methyl parathion hydrolase {Pseudomonas sp. WBC-3 [TaxId: 165468]} Back     information, alignment and structure
>d1vmea2 d.157.1.3 (A:1-250) ROO-like flavoprotein TM0755, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wraa1 d.157.1.8 (A:30-334) Teichoic acid phosphorylcholine esterase Pce (LytD), N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1e5da2 d.157.1.3 (A:2-250) Rubredoxin oxygen:oxidoreductase (ROO), N-terminal domain {Desulfovibrio gigas [TaxId: 879]} Back     information, alignment and structure
>d1ycga2 d.157.1.3 (A:2-250) Nitric oxide reductase N-terminal domain {Moorella thermoacetica [TaxId: 1525]} Back     information, alignment and structure
>d1m2xa_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Chryseobacterium meningosepticum, carbapenemase BLAB-1 [TaxId: 238]} Back     information, alignment and structure
>d1ko3a_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Pseudomonas aeruginosa, VIM-2 [TaxId: 287]} Back     information, alignment and structure
>d2e7ya1 d.157.1.7 (A:1-280) Ribonuclease Z (RNase Z) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jjta_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Pseudomonas aeruginosa, IMP-1 [TaxId: 287]} Back     information, alignment and structure
>d1znba_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Bacteroides fragilis [TaxId: 817]} Back     information, alignment and structure
>d1mqoa_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1xm8a_ d.157.1.2 (A:) Glyoxalase II (hydroxyacylglutathione hydrolase) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2qeda1 d.157.1.2 (A:1-251) Glyoxalase II (hydroxyacylglutathione hydrolase) {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2cfua2 d.157.1.13 (A:20-524) Alkylsulfatase SdsA1 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qh5a_ d.157.1.2 (A:) Glyoxalase II (hydroxyacylglutathione hydrolase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2az4a1 d.157.1.10 (A:56-238) Hypothetical protein EF2904 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2p97a1 d.157.1.12 (A:1-200) Hypothetical protein Ava3068 {Anabaena variabilis [TaxId: 1172]} Back     information, alignment and structure
>d1vjna_ d.157.1.4 (A:) Hypothetical protein TM0207 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure