Citrus Sinensis ID: 031820

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150--
MKLKWRPVSSYFTNQKAKDCVLENPFLLILENMIVSKNIVEQAIAQADSRPLLIVAEDVEDKLIGSLILGKTCLQNKVSIAKPHEDDYEKETKAIMDDLAILTGGQVLNGATNVSFMPLMLGSCKELLYQMTRWLSLVGLVASLLLKKDVHS
ccccccccccccccccccEEEccccEEEEEEccccHHHHHHHHHHHHccccEEEEEEcccccEEEEEEEcccccccEEEEEEEcccccccHHHHHHHHHHHHcccEEEEccccccccccccccccEEEEEcccEEEEEccccHHHHHHHHcc
ccccccccccccccccccEEEEcccEEEEEccHHHcHHHHHHHHHHHHcccEEEEEEcccHHHHHEEEEcccccccEEEEEEEEcccccHHHHHHHHHHHHHcccEEEEHHcccEEEEEEEcccEEEEEEccccEEEcccccHHHHHHHHcc
mklkwrpvssyftnqkakdcvlenpfLLILENMIVSKNIVEQAIAqadsrplliVAEDVEDKLIGSLILgktclqnkvsiakpheddyEKETKAIMDDLAiltggqvlngatnvsfmplmlGSCKELLYQMTRWLSLVGLVASLLLKKDVHS
mklkwrpvssyftnqkakdcVLENPFLLILENMIVSKNIVEQAIAQADSRPLLIVAEDVEDKLIGSlilgktclqnkVSIAKPHEDDYEKETKAIMDDLAILTGGQVLNGATNVSFMPLMLGSCKELLYQMTRWLSLVGLVASlllkkdvhs
MKLKWRPVSSYFTNQKAKDCVLENPFLLILENMIVSKNIVEQAIAQADSRPLLIVAEDVEDKLIGSLILGKTCLQNKVSIAKPHEDDYEKETKAIMDDLAILTGGQVLNGATNVSFMPLMLGSCKELLYQMTRWlslvglvaslllKKDVHS
******PVSSYFTNQKAKDCVLENPFLLILENMIVSKNIVEQAIAQADSRPLLIVAEDVEDKLIGSLILGKTCLQNKVSIAKPHEDDYEKETKAIMDDLAILTGGQVLNGATNVSFMPLMLGSCKELLYQMTRWLSLVGLVASLLLK*****
MKLKWRPVSSYFTNQKAKDCVLENPFLLILENMIVSKNIVEQAIAQADSRPLLIVAEDVEDKLIGSLILGKTCLQNKVSIAKPHEDDYEKETKAIMDDLAILTGGQVLNGATNVSFMPLMLGSCKELLYQMTRWLSLVGLVASLL**KDV**
MKLKWRPVSSYFTNQKAKDCVLENPFLLILENMIVSKNIVEQAIAQADSRPLLIVAEDVEDKLIGSLILGKTCLQNKVSIAKPHEDDYEKETKAIMDDLAILTGGQVLNGATNVSFMPLMLGSCKELLYQMTRWLSLVGLVASLLLKKDVHS
**L*WRPVSSYFTNQKAKDCVLENPFLLILENMIVSKNIVEQAIAQADSRPLLIVAEDVEDKLIGSLILGKTCLQNKVSIAKPHEDDYEKETKAIMDDLAILTGGQVLNGATNVSFMPLMLGSCKELLYQMTRWLSLVGLVASLLLK***H*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKLKWRPVSSYFTNQKAKDCVLENPFLLILENMIVSKNIVEQAIAQADSRPLLIVAEDVEDKLIGSLILGKTCLQNKVSIAKPHEDDYEKETKAIMDDLAILTGGQVLNGATNVSFMPLMLGSCKELLYQMTRWLSLVGLVASLLLKKDVHS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query152 2.2.26 [Sep-21-2011]
Q43298 576 Chaperonin CPN60-2, mitoc N/A no 0.809 0.213 0.407 2e-15
P29185 577 Chaperonin CPN60-1, mitoc N/A no 0.809 0.213 0.392 6e-15
Q05045 575 Chaperonin CPN60-1, mitoc N/A no 0.822 0.217 0.390 3e-14
Q05046 575 Chaperonin CPN60-2, mitoc N/A no 0.822 0.217 0.390 2e-13
Q93ZM7 572 Chaperonin CPN60-like 2, yes no 0.802 0.213 0.411 7e-13
P29197 577 Chaperonin CPN60, mitocho no no 0.822 0.216 0.375 2e-12
Q8L7B5 585 Chaperonin CPN60-like 1, no no 0.822 0.213 0.375 3e-11
Q9L7P5 547 60 kDa chaperonin 1 OS=Vi yes no 0.638 0.177 0.398 3e-10
P35480 587 Chaperonin CPN60, mitocho N/A no 0.822 0.212 0.360 4e-10
Q9TLZ1 530 60 kDa chaperonin, chloro N/A no 0.756 0.216 0.333 5e-10
>sp|Q43298|CH62_MAIZE Chaperonin CPN60-2, mitochondrial OS=Zea mays GN=CPN60II PE=2 SV=1 Back     alignment and function desciption
 Score = 81.3 bits (199), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 55/135 (40%), Positives = 79/135 (58%), Gaps = 12/135 (8%)

Query: 1   MKLKWRPVSSYF-TNQKAKDCVLENPFLLI----LENMIVSKNIVEQAIAQADSRPLLIV 55
           MKL    +S YF TN KA+ C LE+P +LI    + NM     ++E A+ +   RPLLIV
Sbjct: 226 MKLDRGYISPYFITNSKAQKCELEDPLILIHDKKVTNMHAVVKVLEMALKK--QRPLLIV 283

Query: 56  AEDVEDKLIGSLILGKTCLQNKVSIAKPHEDDYEKETKAIMDDLAILTGGQVLN---GAT 112
           AEDVE + +G+LI+ K  L+  + +       + +  KA + DLAILTGG+V+    G  
Sbjct: 284 AEDVESEALGTLIINK--LRAGIKVCAVKAPGFGENRKANLQDLAILTGGEVITEELGMN 341

Query: 113 NVSFMPLMLGSCKEL 127
             +  P MLGSCK++
Sbjct: 342 LENVEPHMLGSCKKV 356
Implicated in mitochondrial protein import and macromolecular assembly. May facilitate the correct folding of imported proteins. May also prevent misfolding and promote the refolding and proper assembly of unfolded polypeptides generated under stress conditions in the mitochondrial matrix.
Zea mays (taxid: 4577)
>sp|P29185|CH61_MAIZE Chaperonin CPN60-1, mitochondrial OS=Zea mays GN=CPN60I PE=1 SV=2 Back     alignment and function description
>sp|Q05045|CH61_CUCMA Chaperonin CPN60-1, mitochondrial OS=Cucurbita maxima GN=CPN60-1 PE=1 SV=1 Back     alignment and function description
>sp|Q05046|CH62_CUCMA Chaperonin CPN60-2, mitochondrial OS=Cucurbita maxima GN=CPN60-2 PE=1 SV=1 Back     alignment and function description
>sp|Q93ZM7|CH60C_ARATH Chaperonin CPN60-like 2, mitochondrial OS=Arabidopsis thaliana GN=At3g13860 PE=1 SV=2 Back     alignment and function description
>sp|P29197|CH60A_ARATH Chaperonin CPN60, mitochondrial OS=Arabidopsis thaliana GN=CPN60 PE=1 SV=2 Back     alignment and function description
>sp|Q8L7B5|CH60B_ARATH Chaperonin CPN60-like 1, mitochondrial OS=Arabidopsis thaliana GN=At2g33210 PE=1 SV=1 Back     alignment and function description
>sp|Q9L7P5|CH601_VIBPA 60 kDa chaperonin 1 OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=groL1 PE=3 SV=2 Back     alignment and function description
>sp|P35480|CH60_BRANA Chaperonin CPN60, mitochondrial OS=Brassica napus PE=2 SV=1 Back     alignment and function description
>sp|Q9TLZ1|CH60_CYACA 60 kDa chaperonin, chloroplastic OS=Cyanidium caldarium GN=groL PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query152
219884183 381 unknown [Zea mays] 0.822 0.328 0.398 1e-13
162460375 576 chaperonin CPN60-2, mitochondrial precur 0.809 0.213 0.407 1e-13
326491001 574 predicted protein [Hordeum vulgare subsp 0.809 0.214 0.4 1e-13
413934100 382 chaperonin 1, partial [Zea mays] 0.822 0.327 0.383 3e-13
115450675 577 Os03g0143400 [Oryza sativa Japonica Grou 0.809 0.213 0.392 3e-13
309557 577 chaperonin 60 [Zea mays] 0.809 0.213 0.392 3e-13
2506275 577 RecName: Full=Chaperonin CPN60-1, mitoch 0.809 0.213 0.392 4e-13
223974475 352 unknown [Zea mays] 0.822 0.355 0.383 4e-13
162458253 577 chaperonin CPN60-1, mitochondrial precur 0.809 0.213 0.392 5e-13
22242 577 chaperonin hsp60 [Zea mays] 0.809 0.213 0.385 8e-13
>gi|219884183|gb|ACL52466.1| unknown [Zea mays] Back     alignment and taxonomy information
 Score = 81.3 bits (199), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 53/133 (39%), Positives = 78/133 (58%), Gaps = 8/133 (6%)

Query: 1   MKLKWRPVSSYF-TNQKAKDCVLENPFLLILENMIVSKNIVEQAIAQA--DSRPLLIVAE 57
           MKL    +S YF TN KA+ C LE+P +LI +  + + + V + +  A    RPLLIVAE
Sbjct: 226 MKLDRGYISPYFITNSKAQKCELEDPLILIHDKKVTNMHAVVKVLEMALKKQRPLLIVAE 285

Query: 58  DVEDKLIGSLILGKTCLQNKVSIAKPHEDDYEKETKAIMDDLAILTGGQVLN---GATNV 114
           DVE + +G+LI+ K  L+  + +       + +  KA + DLAILTGG+V+    G    
Sbjct: 286 DVESEALGTLIINK--LRAGIKVCAVKAPGFGENRKANLQDLAILTGGEVITEELGMNLE 343

Query: 115 SFMPLMLGSCKEL 127
           +  P MLGSCK++
Sbjct: 344 NVEPHMLGSCKKV 356

Source: Zea mays

Species: Zea mays

Genus: Zea

Family: Poaceae

Order: Poales

Class: Liliopsida

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|162460375|ref|NP_001105690.1| chaperonin CPN60-2, mitochondrial precursor [Zea mays] gi|2493646|sp|Q43298.1|CH62_MAIZE RecName: Full=Chaperonin CPN60-2, mitochondrial; AltName: Full=HSP60-2; Flags: Precursor gi|309559|gb|AAA33451.1| chaperonin 60 [Zea mays] gi|309561|gb|AAA33452.1| mitochondrial chaperonin 60 [Zea mays] gi|414871207|tpg|DAA49764.1| TPA: putative TCP-1/cpn60 chaperonin family protein [Zea mays] Back     alignment and taxonomy information
>gi|326491001|dbj|BAK05600.1| predicted protein [Hordeum vulgare subsp. vulgare] Back     alignment and taxonomy information
>gi|413934100|gb|AFW68651.1| chaperonin 1, partial [Zea mays] Back     alignment and taxonomy information
>gi|115450675|ref|NP_001048938.1| Os03g0143400 [Oryza sativa Japonica Group] gi|108706134|gb|ABF93929.1| Chaperonin CPN60-1, mitochondrial precursor, putative, expressed [Oryza sativa Japonica Group] gi|113547409|dbj|BAF10852.1| Os03g0143400 [Oryza sativa Japonica Group] gi|215704319|dbj|BAG93753.1| unnamed protein product [Oryza sativa Japonica Group] gi|218192069|gb|EEC74496.1| hypothetical protein OsI_09970 [Oryza sativa Indica Group] gi|222624174|gb|EEE58306.1| hypothetical protein OsJ_09368 [Oryza sativa Japonica Group] gi|284431758|gb|ADB84620.1| chaperonin [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|309557|gb|AAA33450.1| chaperonin 60 [Zea mays] Back     alignment and taxonomy information
>gi|2506275|sp|P29185.2|CH61_MAIZE RecName: Full=Chaperonin CPN60-1, mitochondrial; AltName: Full=HSP60-1; Flags: Precursor Back     alignment and taxonomy information
>gi|223974475|gb|ACN31425.1| unknown [Zea mays] Back     alignment and taxonomy information
>gi|162458253|ref|NP_001105716.1| chaperonin CPN60-1, mitochondrial precursor [Zea mays] gi|22248|emb|CAA78100.1| mitochondrial chaperonin-60 [Zea mays] Back     alignment and taxonomy information
>gi|22242|emb|CAA77645.1| chaperonin hsp60 [Zea mays] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query152
TAIR|locus:2076081 577 HSP60 "heat shock protein 60" 0.822 0.216 0.390 8.5e-14
TAIR|locus:2087959 572 HSP60-3A "heat shock protein 6 0.822 0.218 0.398 2.3e-13
TAIR|locus:2046590 585 HSP60-2 "heat shock protein 60 0.822 0.213 0.375 6.4e-13
UNIPROTKB|Q9KNR7 544 groL1 "60 kDa chaperonin 1" [V 0.651 0.181 0.367 2.2e-10
TIGR_CMR|VC_2664 544 VC_2664 "chaperonin, 60 Kd sub 0.651 0.181 0.367 2.2e-10
TIGR_CMR|CBU_1718 552 CBU_1718 "chaperonin, 60 kDa" 0.776 0.213 0.296 2.8e-10
UNIPROTKB|Q9KLC6 530 groL2 "60 kDa chaperonin 2" [V 0.769 0.220 0.299 9.2e-10
TIGR_CMR|VC_A0820 530 VC_A0820 "chaperonin, 60 Kd su 0.769 0.220 0.299 9.2e-10
TIGR_CMR|BA_0267 544 BA_0267 "chaperonin, 60 kDa" [ 0.631 0.176 0.333 2e-09
UNIPROTKB|P0A520 540 groEL2 "60 kDa chaperonin 2" [ 0.638 0.179 0.351 2.6e-09
TAIR|locus:2076081 HSP60 "heat shock protein 60" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 188 (71.2 bits), Expect = 8.5e-14, P = 8.5e-14
 Identities = 52/133 (39%), Positives = 75/133 (56%)

Query:     1 MKLKWRPVSSYF-TNQKAKDCVLENPFLLILENMIVSKNIVEQAIAQA--DSRPLLIVAE 57
             MKL     S YF TNQK + C L++P +LI E  I S N + + +  A    RPLLIV+E
Sbjct:   223 MKLDRGYTSPYFITNQKTQKCELDDPLILIHEKKISSINSIVKVLELALKRQRPLLIVSE 282

Query:    58 DVEDKLIGSLILGKTCLQNKVSIAKPHEDDYEKETKAIMDDLAILTGGQVLNG--ATNVS 115
             DVE   + +LIL K  L+  + +       + +  KA + DLA LTGG+V+      N+ 
Sbjct:   283 DVESDALATLILNK--LRAGIKVCAIKAPGFGENRKANLQDLAALTGGEVITDELGMNLE 340

Query:   116 FMPL-MLGSCKEL 127
              + L MLG+CK++
Sbjct:   341 KVDLSMLGTCKKV 353
GO:0005524 "ATP binding" evidence=IEA;IDA
GO:0005739 "mitochondrion" evidence=ISM;IDA
GO:0006457 "protein folding" evidence=IEA;RCA
GO:0042026 "protein refolding" evidence=IEA
GO:0044267 "cellular protein metabolic process" evidence=IEA
GO:0051131 "chaperone-mediated protein complex assembly" evidence=TAS
GO:0007005 "mitochondrion organization" evidence=TAS
GO:0009408 "response to heat" evidence=IEP;RCA
GO:0022626 "cytosolic ribosome" evidence=IDA
GO:0005759 "mitochondrial matrix" evidence=IDA
GO:0046686 "response to cadmium ion" evidence=IEP
GO:0005774 "vacuolar membrane" evidence=IDA
GO:0005829 "cytosol" evidence=RCA;IDA
GO:0005507 "copper ion binding" evidence=IDA
GO:0005794 "Golgi apparatus" evidence=RCA
GO:0006626 "protein targeting to mitochondrion" evidence=RCA
GO:0009644 "response to high light intensity" evidence=RCA
GO:0034976 "response to endoplasmic reticulum stress" evidence=RCA
GO:0042542 "response to hydrogen peroxide" evidence=RCA
TAIR|locus:2087959 HSP60-3A "heat shock protein 60-3A" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046590 HSP60-2 "heat shock protein 60-2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q9KNR7 groL1 "60 kDa chaperonin 1" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms
TIGR_CMR|VC_2664 VC_2664 "chaperonin, 60 Kd subunit" [Vibrio cholerae O1 biovar El Tor (taxid:686)] Back     alignment and assigned GO terms
TIGR_CMR|CBU_1718 CBU_1718 "chaperonin, 60 kDa" [Coxiella burnetii RSA 493 (taxid:227377)] Back     alignment and assigned GO terms
UNIPROTKB|Q9KLC6 groL2 "60 kDa chaperonin 2" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms
TIGR_CMR|VC_A0820 VC_A0820 "chaperonin, 60 Kd subunit" [Vibrio cholerae O1 biovar El Tor (taxid:686)] Back     alignment and assigned GO terms
TIGR_CMR|BA_0267 BA_0267 "chaperonin, 60 kDa" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
UNIPROTKB|P0A520 groEL2 "60 kDa chaperonin 2" [Mycobacterium tuberculosis (taxid:1773)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
4331590
T-complex protein, putative, expressed (577 aa)
(Oryza sativa Japonica)
Predicted Functional Partners:
LOC_Os03g25050.1
chaperonin, putative, expressed (98 aa)
•  •• • 0.790
4344071
chaperonin, putative, expressed (98 aa)
•  •• • 0.746
OsJ_01526
preprotein translocase subunit secA, chloroplast precursor, putative, expressed (1015 aa)
      • 0.668
B1172G12.2
chaperonin, putative (216 aa)
• • • • 0.567
4342497
polynucleotide phosphorylase, putative, expressed (902 aa)
      • 0.555
GYRB
DNA gyrase subunit B, chloroplast/mitochondrial precursor, putative, expressed; DNA gyrase nega [...] (729 aa)
      • 0.536
4345097
preprotein translocase subunit secY, putative, expressed; Involved in protein export. Probably [...] (556 aa)
      • 0.514
4347161
chaperonin, putative, expressed (245 aa)
• •   • 0.503
4340394
chaperonin, putative, expressed (252 aa)
• •   • 0.495
4338417
superoxide dismutase, mitochondrial precursor, putative, expressed; Destroys radicals which are [...] (231 aa)
      • 0.491

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query152
cd03344 520 cd03344, GroEL, GroEL_like type I chaperonin 3e-19
PRK12849 542 PRK12849, groEL, chaperonin GroEL; Reviewed 1e-17
PTZ00114 555 PTZ00114, PTZ00114, Heat shock protein 60; Provisi 4e-15
TIGR02348 524 TIGR02348, GroEL, chaperonin GroL 2e-14
PRK12850 544 PRK12850, groEL, chaperonin GroEL; Reviewed 3e-14
PRK00013 542 PRK00013, groEL, chaperonin GroEL; Reviewed 9e-13
CHL00093 529 CHL00093, groEL, chaperonin GroEL 3e-12
PRK12851 541 PRK12851, groEL, chaperonin GroEL; Reviewed 9e-12
PRK12852 545 PRK12852, groEL, chaperonin GroEL; Reviewed 3e-10
PRK14104 546 PRK14104, PRK14104, chaperonin GroEL; Provisional 4e-08
PLN03167 600 PLN03167, PLN03167, Chaperonin-60 beta subunit; Pr 2e-07
COG0459 524 COG0459, GroL, Chaperonin GroEL (HSP60 family) [Po 1e-05
cd00309 464 cd00309, chaperonin_type_I_II, chaperonin families 0.001
pfam00118 481 pfam00118, Cpn60_TCP1, TCP-1/cpn60 chaperonin fami 0.002
>gnl|CDD|239460 cd03344, GroEL, GroEL_like type I chaperonin Back     alignment and domain information 
 Score = 82.5 bits (205), Expect = 3e-19
 Identities = 39/126 (30%), Positives = 72/126 (57%), Gaps = 10/126 (7%)

Query: 8   VSSYF-TNQKAKDCVLENPFLLILENMIVS-KNIVE--QAIAQADSRPLLIVAEDVEDKL 63
           +S YF T+ +  +  LENP++L+ +  I S + ++   + +A+A  RPLLI+AEDVE + 
Sbjct: 197 LSPYFVTDPEKMEVELENPYILLTDKKISSIQELLPILELVAKA-GRPLLIIAEDVEGEA 255

Query: 64  IGSLILGKTCLQNKVSIAKPHEDDYEKETKAIMDDLAILTGGQVLNGATNVSFMPL---M 120
           + +L++ K  L+  + +       +    KA+++D+AILTGG V++    +    +    
Sbjct: 256 LATLVVNK--LRGGLKVCAVKAPGFGDRRKAMLEDIAILTGGTVISEELGLKLEDVTLED 313

Query: 121 LGSCKE 126
           LG  K+
Sbjct: 314 LGRAKK 319

Chaperonins are involved in productive folding of proteins. They share a common general morphology, a double toroid of 2 stacked rings, each composed of 7-9 subunits. The symmetry of type I is seven-fold and they are found in eubacteria (GroEL) and in organelles of eubacterial descent (hsp60 and RBP). With the aid of cochaperonin GroES, GroEL encapsulates non-native substrate proteins inside the cavity of the GroEL-ES complex and promotes folding by using energy derived from ATP hydrolysis. Length = 520
>gnl|CDD|237230 PRK12849, groEL, chaperonin GroEL; Reviewed Back     alignment and domain information
>gnl|CDD|185455 PTZ00114, PTZ00114, Heat shock protein 60; Provisional Back     alignment and domain information
>gnl|CDD|233828 TIGR02348, GroEL, chaperonin GroL Back     alignment and domain information
>gnl|CDD|237231 PRK12850, groEL, chaperonin GroEL; Reviewed Back     alignment and domain information
>gnl|CDD|234573 PRK00013, groEL, chaperonin GroEL; Reviewed Back     alignment and domain information
>gnl|CDD|177025 CHL00093, groEL, chaperonin GroEL Back     alignment and domain information
>gnl|CDD|171770 PRK12851, groEL, chaperonin GroEL; Reviewed Back     alignment and domain information
>gnl|CDD|237232 PRK12852, groEL, chaperonin GroEL; Reviewed Back     alignment and domain information
>gnl|CDD|172594 PRK14104, PRK14104, chaperonin GroEL; Provisional Back     alignment and domain information
>gnl|CDD|215611 PLN03167, PLN03167, Chaperonin-60 beta subunit; Provisional Back     alignment and domain information
>gnl|CDD|223535 COG0459, GroL, Chaperonin GroEL (HSP60 family) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|238189 cd00309, chaperonin_type_I_II, chaperonin families, type I and type II Back     alignment and domain information
>gnl|CDD|215730 pfam00118, Cpn60_TCP1, TCP-1/cpn60 chaperonin family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 152
KOG0356 550 consensus Mitochondrial chaperonin, Cpn60/Hsp60p [ 100.0
PLN03167 600 Chaperonin-60 beta subunit; Provisional 100.0
PRK14104 546 chaperonin GroEL; Provisional 100.0
PRK12852 545 groEL chaperonin GroEL; Reviewed 100.0
PTZ00114 555 Heat shock protein 60; Provisional 100.0
CHL00093 529 groEL chaperonin GroEL 99.98
PRK12851 541 groEL chaperonin GroEL; Reviewed 99.97
TIGR02348 524 GroEL chaperonin GroL. This family consists of Gro 99.97
PRK00013 542 groEL chaperonin GroEL; Reviewed 99.97
PRK12850 544 groEL chaperonin GroEL; Reviewed 99.97
PRK12849 542 groEL chaperonin GroEL; Reviewed 99.96
cd03344 520 GroEL GroEL_like type I chaperonin. Chaperonins ar 99.96
COG0459 524 GroL Chaperonin GroEL (HSP60 family) [Posttranslat 99.93
TIGR02343 532 chap_CCT_epsi T-complex protein 1, epsilon subunit 99.53
cd03339 526 TCP1_epsilon TCP-1 (CTT or eukaryotic type II) cha 99.53
cd03338 515 TCP1_delta TCP-1 (CTT or eukaryotic type II) chape 99.52
cd03343 517 cpn60 cpn60 chaperonin family. Chaperonins are inv 99.49
cd03342 484 TCP1_zeta TCP-1 (CTT or eukaryotic type II) chaper 99.47
TIGR02342 517 chap_CCT_delta T-complex protein 1, delta subunit. 99.45
TIGR02345 522 chap_CCT_eta T-complex protein 1, eta subunit. Mem 99.44
TIGR02339 519 thermosome_arch thermosome, various subunits, arch 99.41
TIGR02346 531 chap_CCT_theta T-complex protein 1, theta subunit. 99.41
PTZ00212 533 T-complex protein 1 subunit beta; Provisional 99.4
TIGR02340 536 chap_CCT_alpha T-complex protein 1, alpha subunit. 99.35
cd03335 527 TCP1_alpha TCP-1 (CTT or eukaryotic type II) chape 99.33
TIGR02347 531 chap_CCT_zeta T-complex protein 1, zeta subunit. M 99.31
cd00309 464 chaperonin_type_I_II chaperonin families, type I a 99.28
cd03336 517 TCP1_beta TCP-1 (CTT or eukaryotic type II) chaper 99.28
TIGR02341 519 chap_CCT_beta T-complex protein 1, beta subunit. M 99.28
cd03333209 chaperonin_like chaperonin_like superfamily. Chape 99.26
cd03341 472 TCP1_theta TCP-1 (CTT or eukaryotic type II) chape 99.2
cd03340 522 TCP1_eta TCP-1 (CTT or eukaryotic type II) chapero 99.12
PF00118 485 Cpn60_TCP1: TCP-1/cpn60 chaperonin family Chaperon 99.07
TIGR02344 525 chap_CCT_gamma T-complex protein 1, gamma subunit. 98.98
cd03337 480 TCP1_gamma TCP-1 (CTT or eukaryotic type II) chape 98.87
cd03334261 Fab1_TCP TCP-1 like domain of the eukaryotic phosp 96.95
KOG0357 400 consensus Chaperonin complex component, TCP-1 epsi 91.95
>KOG0356 consensus Mitochondrial chaperonin, Cpn60/Hsp60p [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=2.4e-48  Score=347.88  Aligned_cols=149  Identities=29%  Similarity=0.401  Sum_probs=145.5

Q ss_pred             CccCCccccccc-cCCCCceEEeeCceEEEecccccchHHHHHHH--HhhcCCCeEEEecccccchhhhhhcccccccce
Q 031820            1 MKLKWRPVSSYF-TNQKAKDCVLENPFLLILENMIVSKNIVEQAI--AQADSRPLLIVAEDVEDKLIGSLILGKTCLQNK   77 (152)
Q Consensus         1 m~fdrGylSpyf-td~~~~~~ele~p~ILltd~kIs~~~~ilp~L--~~~~~rpLlIiAedv~~eaL~tLv~Nklrg~l~   77 (152)
                      |+|||||+|||| |+++++++|||||++|++++||+++++|+|+|  +.+..+||+||||||++|||++||+||+|++++
T Consensus       206 mkfdrGyiSPyfi~~~k~~~~e~e~~~~ll~~kki~~v~~ivp~LE~A~~~~~PLliIAeDi~~eaL~tLIlNkLk~glq  285 (550)
T KOG0356|consen  206 MKFDRGYISPYFITSSKKQKVEFENALLLLSEKKISSVQSIVPALELALAKRRPLLIIAEDIDGEALATLVLNKLKGGLQ  285 (550)
T ss_pred             ccccccccCccccccchhhhhhhhhhhhhhhhhhhhHHHHHhHHHHHhhhccCceEEEehhcchhHHHHHHhhhhcccee
Confidence            899999999999 99999999999999999999999999999999  778889999999999999999999999999999


Q ss_pred             EE-EecCCCCCchhhHhhhhhhhhhhhcCeEeec----cccCCCCCCCCceeeEEEEeCCceEEEcCCCChHhhhhhhcC
Q 031820           78 VS-IAKPHEDDYEKETKAIMDDLAILTGGQVLNG----ATNVSFMPLMLGSCKELLYQMTRWLSLVGLVASLLLKKDVHS  152 (152)
Q Consensus        78 v~-VkaP~~~gfG~~rk~~L~DiAilTGg~vi~~----~~l~~~~~~~LG~a~~v~vtkd~T~il~g~g~~~~i~~rv~~  152 (152)
                      || ||+|   ||||+|++.|+|||++|||+++.+    ++|+.+++++||.|.++++|||+|+|+.|.+++++++.|+++
T Consensus       286 V~AvKap---gfGdnrk~~l~Diai~Tg~~v~~~e~~~l~le~~~~~dLG~~~evvvtkd~t~ll~g~~~~~~v~~rIeq  362 (550)
T KOG0356|consen  286 VVAVKAP---GFGDNRKNLLKDIAILTGATVFGEELSTLNLEDAKLEDLGEVGEVVVTKDDTMLLKGKGNKAQVEGRIEQ  362 (550)
T ss_pred             EEEEecC---CCcchHHHhhhHHHHHhhhhhhccchhhcccccCchhhcCcceeEEEecCcceeeCCCCCHHHHHHHHHH
Confidence            99 9999   999999999999999999999999    788999999999999999999999999999999999999873

>PLN03167 Chaperonin-60 beta subunit; Provisional Back     alignment and domain information
>PRK14104 chaperonin GroEL; Provisional Back     alignment and domain information
>PRK12852 groEL chaperonin GroEL; Reviewed Back     alignment and domain information
>PTZ00114 Heat shock protein 60; Provisional Back     alignment and domain information
>CHL00093 groEL chaperonin GroEL Back     alignment and domain information
>PRK12851 groEL chaperonin GroEL; Reviewed Back     alignment and domain information
>TIGR02348 GroEL chaperonin GroL Back     alignment and domain information
>PRK00013 groEL chaperonin GroEL; Reviewed Back     alignment and domain information
>PRK12850 groEL chaperonin GroEL; Reviewed Back     alignment and domain information
>PRK12849 groEL chaperonin GroEL; Reviewed Back     alignment and domain information
>cd03344 GroEL GroEL_like type I chaperonin Back     alignment and domain information
>COG0459 GroL Chaperonin GroEL (HSP60 family) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02343 chap_CCT_epsi T-complex protein 1, epsilon subunit Back     alignment and domain information
>cd03339 TCP1_epsilon TCP-1 (CTT or eukaryotic type II) chaperonin family, epsilon subunit Back     alignment and domain information
>cd03338 TCP1_delta TCP-1 (CTT or eukaryotic type II) chaperonin family, delta subunit Back     alignment and domain information
>cd03343 cpn60 cpn60 chaperonin family Back     alignment and domain information
>cd03342 TCP1_zeta TCP-1 (CTT or eukaryotic type II) chaperonin family, zeta subunit Back     alignment and domain information
>TIGR02342 chap_CCT_delta T-complex protein 1, delta subunit Back     alignment and domain information
>TIGR02345 chap_CCT_eta T-complex protein 1, eta subunit Back     alignment and domain information
>TIGR02339 thermosome_arch thermosome, various subunits, archaeal Back     alignment and domain information
>TIGR02346 chap_CCT_theta T-complex protein 1, theta subunit Back     alignment and domain information
>PTZ00212 T-complex protein 1 subunit beta; Provisional Back     alignment and domain information
>TIGR02340 chap_CCT_alpha T-complex protein 1, alpha subunit Back     alignment and domain information
>cd03335 TCP1_alpha TCP-1 (CTT or eukaryotic type II) chaperonin family, alpha subunit Back     alignment and domain information
>TIGR02347 chap_CCT_zeta T-complex protein 1, zeta subunit Back     alignment and domain information
>cd00309 chaperonin_type_I_II chaperonin families, type I and type II Back     alignment and domain information
>cd03336 TCP1_beta TCP-1 (CTT or eukaryotic type II) chaperonin family, beta subunit Back     alignment and domain information
>TIGR02341 chap_CCT_beta T-complex protein 1, beta subunit Back     alignment and domain information
>cd03333 chaperonin_like chaperonin_like superfamily Back     alignment and domain information
>cd03341 TCP1_theta TCP-1 (CTT or eukaryotic type II) chaperonin family, theta subunit Back     alignment and domain information
>cd03340 TCP1_eta TCP-1 (CTT or eukaryotic type II) chaperonin family, eta subunit Back     alignment and domain information
>PF00118 Cpn60_TCP1: TCP-1/cpn60 chaperonin family Chaperonins cpn60 signature Chaperonins TCP-1 signatures 60 kd chaperonin signature; InterPro: IPR002423 Partially folded polypeptide chains, either newly made by ribosomes or emerging from mature proteins unfolded by stress, run the risk of aggregating with one another to the detriment of the organism Back     alignment and domain information
>TIGR02344 chap_CCT_gamma T-complex protein 1, gamma subunit Back     alignment and domain information
>cd03337 TCP1_gamma TCP-1 (CTT or eukaryotic type II) chaperonin family, gamma subunit Back     alignment and domain information
>cd03334 Fab1_TCP TCP-1 like domain of the eukaryotic phosphatidylinositol 3-phosphate (PtdIns3P) 5-kinase Fab1 Back     alignment and domain information
>KOG0357 consensus Chaperonin complex component, TCP-1 epsilon subunit (CCT5) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query152
1srv_A145 Thermus Thermophilus Groel (Hsp60 Class) Fragment ( 1e-09
1kid_A203 Groel (Hsp60 Class) Fragment (Apical Domain) Compri 2e-09
1jon_A155 Groel (Hsp60 Class) Fragment Comprising Residues 19 3e-09
1dk7_A146 Crystal Structure Of An Isolated Apical Domain Of G 3e-09
1fy9_A193 Crystal Structure Of The Hexa-Substituted Mutant Of 3e-09
1la1_A192 Gro-El Fragment (Apical Domain) Comprising Residues 3e-09
1fya_A193 Crystal Structure Of The Hexa-Substituted Mutant Of 5e-09
1we3_A 543 Crystal Structure Of The Chaperonin Complex Cpn60CP 6e-09
1sjp_A 504 Mycobacterium Tuberculosis Chaperonin60.2 Length = 1e-08
3rtk_A 546 Crystal Structure Of Cpn60.2 From Mycobacterium Tub 1e-08
1ss8_A 524 Groel Length = 524 2e-08
1pcq_A 524 Crystal Structure Of Groel-Groes Length = 524 2e-08
1sx3_A 525 Groel14-(Atpgammas)14 Length = 525 3e-08
1j4z_A 547 Structural And Mechanistic Basis For Allostery In T 3e-08
2yey_A 524 Crystal Structure Of The Allosteric-Defective Chape 3e-08
1kp8_A 547 Structural Basis For Groel-Assisted Protein Folding 3e-08
3c9v_A 526 C7 Symmetrized Structure Of Unliganded Groel At 4.7 3e-08
1aon_A 547 Crystal Structure Of The Asymmetric Chaperonin Comp 3e-08
1gr5_A 547 Solution Structure Of Apo Groel By Cryo-Electron Mi 3e-08
4aaq_A 548 Atp-Triggered Molecular Mechanics Of The Chaperonin 3e-08
2eu1_A 548 Crystal Structure Of The Chaperonin Groel-E461k Len 3e-08
3osx_A201 Crystal Structure Of Apical Domain Of Insecticidal 3e-08
1iok_A 545 Crystal Structure Of Chaperonin-60 From Paracoccus 8e-08
1grl_A 548 The Crystal Structure Of The Bacterial Chaperonin G 1e-07
3cau_A 526 D7 Symmetrized Structure Of Unliganded Groel At 4.2 1e-07
1oel_A 547 Conformational Variability In The Refined Structure 1e-07
3m6c_A194 Crystal Structure Of Mycobacterium Tuberculosis Gro 4e-07
>pdb|1SRV|A Chain A, Thermus Thermophilus Groel (Hsp60 Class) Fragment (Apical Domain) Comprising Residues 192-336 Length = 145 Back     alignment and structure 
Iteration: 1

 Score = 58.5 bits (140), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 38/107 (35%), Positives = 65/107 (60%), Gaps = 9/107 (8%)
Query: 8   VSSYF-TNQKAKDCVLENPFLLILENMIVSKN----IVEQAIAQADSRPLLIVAEDVEDK 62
           +S YF TN +  + VLE+ F+LI+E  + +      I+EQ +AQ   +PLLI+AEDVE +
Sbjct: 9   ISPYFVTNPETMEAVLEDAFILIVEKKVSNVRELLPILEQ-VAQT-GKPLLIIAEDVEGE 66
Query: 63  LIGSLILGKTCLQNKVSIAKPHEDDYEKETKAIMDDLAILTGGQVLN 109
            + +L++ K  L+  +S+A      +    K ++ D+A +TGG V++
Sbjct: 67  ALATLVVNK--LRGTLSVAAVKAPGFGDRRKEMLKDIAAVTGGTVIS 111
>pdb|1KID|A Chain A, Groel (Hsp60 Class) Fragment (Apical Domain) Comprising Residues 191-376, Mutant With Ala 262 Replaced With Leu And Ile 267 Replaced With Met Length = 203 Back     alignment and structure
>pdb|1JON|A Chain A, Groel (Hsp60 Class) Fragment Comprising Residues 191-345 Length = 155 Back     alignment and structure
>pdb|1DK7|A Chain A, Crystal Structure Of An Isolated Apical Domain Of Groel Length = 146 Back     alignment and structure
>pdb|1FY9|A Chain A, Crystal Structure Of The Hexa-Substituted Mutant Of The Molecular Chaperonin Groel Apical Domain Length = 193 Back     alignment and structure
>pdb|1LA1|A Chain A, Gro-El Fragment (Apical Domain) Comprising Residues 188-379 Length = 192 Back     alignment and structure
>pdb|1FYA|A Chain A, Crystal Structure Of The Hexa-Substituted Mutant Of The Molecular Chaperonin Groel Apical Domain Length = 193 Back     alignment and structure
>pdb|1WE3|A Chain A, Crystal Structure Of The Chaperonin Complex Cpn60CPN10(ADP)7 FROM THERMUS THERMOPHILUS Length = 543 Back     alignment and structure
>pdb|1SJP|A Chain A, Mycobacterium Tuberculosis Chaperonin60.2 Length = 504 Back     alignment and structure
>pdb|3RTK|A Chain A, Crystal Structure Of Cpn60.2 From Mycobacterium Tuberculosis At 2.8a Length = 546 Back     alignment and structure
>pdb|1SS8|A Chain A, Groel Length = 524 Back     alignment and structure
>pdb|1PCQ|A Chain A, Crystal Structure Of Groel-Groes Length = 524 Back     alignment and structure
>pdb|1SX3|A Chain A, Groel14-(Atpgammas)14 Length = 525 Back     alignment and structure
>pdb|1J4Z|A Chain A, Structural And Mechanistic Basis For Allostery In The Bacterial Chaperonin Groel; See Remark 400 Length = 547 Back     alignment and structure
>pdb|2YEY|A Chain A, Crystal Structure Of The Allosteric-Defective Chaperonin Groel E434k Mutant Length = 524 Back     alignment and structure
>pdb|1KP8|A Chain A, Structural Basis For Groel-Assisted Protein Folding From The Crystal Structure Of (Groel-Kmgatp)14 At 2.0 A Resolution Length = 547 Back     alignment and structure
>pdb|3C9V|A Chain A, C7 Symmetrized Structure Of Unliganded Groel At 4.7 Angstrom Resolution From Cryoem Length = 526 Back     alignment and structure
>pdb|1AON|A Chain A, Crystal Structure Of The Asymmetric Chaperonin Complex GroelGROES(ADP)7 Length = 547 Back     alignment and structure
>pdb|1GR5|A Chain A, Solution Structure Of Apo Groel By Cryo-Electron Microscopy Length = 547 Back     alignment and structure
>pdb|4AAQ|A Chain A, Atp-Triggered Molecular Mechanics Of The Chaperonin Groel Length = 548 Back     alignment and structure
>pdb|2EU1|A Chain A, Crystal Structure Of The Chaperonin Groel-E461k Length = 548 Back     alignment and structure
>pdb|3OSX|A Chain A, Crystal Structure Of Apical Domain Of Insecticidal Groel From Xenorhapdus Nematophila Length = 201 Back     alignment and structure
>pdb|1IOK|A Chain A, Crystal Structure Of Chaperonin-60 From Paracoccus Denitrificans Length = 545 Back     alignment and structure
>pdb|1GRL|A Chain A, The Crystal Structure Of The Bacterial Chaperonin Groel At 2.8 Angstroms Length = 548 Back     alignment and structure
>pdb|3CAU|A Chain A, D7 Symmetrized Structure Of Unliganded Groel At 4.2 Angstrom Resolution By Cryoem Length = 526 Back     alignment and structure
>pdb|1OEL|A Chain A, Conformational Variability In The Refined Structure Of The Chaperonin Groel At 2.8 Angstrom Resolution Length = 547 Back     alignment and structure
>pdb|3M6C|A Chain A, Crystal Structure Of Mycobacterium Tuberculosis Groel1 Apical Domain Length = 194 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query152
1srv_A145 Protein (groel (HSP60 class)); chaperone, cell div 3e-14
3m6c_A194 60 kDa chaperonin 1; chaperone, ATP-binding, nucle 1e-13
3osx_A201 60 kDa chaperonin; alpha, beta, apical domain, cha 1e-13
1iok_A 545 Chaperonin 60; chaperone; 3.20A {Paracoccus denitr 3e-13
1kp8_A 547 Groel protein; chaperonin, assisted protein foldin 4e-13
3rtk_A 546 60 kDa chaperonin 2; heat shock protein, chaperone 4e-13
1we3_A 543 CPN60(groel); chaperonin, chaperone, groel, HSP60, 7e-13
>1srv_A Protein (groel (HSP60 class)); chaperone, cell division, ATP-binding, phosphorylation; 1.70A {Thermus thermophilus} SCOP: c.8.5.1 Length = 145 Back     alignment and structure
 Score = 64.6 bits (158), Expect = 3e-14
 Identities = 38/106 (35%), Positives = 64/106 (60%), Gaps = 9/106 (8%)

Query: 8   VSSYF-TNQKAKDCVLENPFLLILENMIVSKN----IVEQAIAQADSRPLLIVAEDVEDK 62
           +S YF TN +  + VLE+ F+LI+E  + +      I+EQ +AQ   +PLLI+AEDVE +
Sbjct: 9   ISPYFVTNPETMEAVLEDAFILIVEKKVSNVRELLPILEQ-VAQT-GKPLLIIAEDVEGE 66

Query: 63  LIGSLILGKTCLQNKVSIAKPHEDDYEKETKAIMDDLAILTGGQVL 108
            + +L++ K  L+  +S+A      +    K ++ D+A +TGG V+
Sbjct: 67  ALATLVVNK--LRGTLSVAAVKAPGFGDRRKEMLKDIAAVTGGTVI 110
>3m6c_A 60 kDa chaperonin 1; chaperone, ATP-binding, nucleotide-binding; 2.20A {Mycobacterium tuberculosis} Length = 194 Back     alignment and structure
>3osx_A 60 kDa chaperonin; alpha, beta, apical domain, chaperone; 1.55A {Xenorhabdus nematophila} PDB: 1kid_A 1fy9_A 1la1_A 1fya_A 1jon_A 1dk7_A 1dkd_A Length = 201 Back     alignment and structure
>1iok_A Chaperonin 60; chaperone; 3.20A {Paracoccus denitrificans} SCOP: a.129.1.1 c.8.5.1 d.56.1.1 Length = 545 Back     alignment and structure
>1kp8_A Groel protein; chaperonin, assisted protein folding, chaperone; HET: ATP; 2.00A {Escherichia coli} SCOP: a.129.1.1 c.8.5.1 d.56.1.1 PDB: 1gr5_A 2c7e_A* 1grl_A 1oel_A 1xck_A 1gru_A 1mnf_A 1aon_A 2c7c_A 2c7d_A 2cgt_A 2nwc_A 3e76_A* 2eu1_A 1j4z_A 1kpo_O 1sx3_A* 3c9v_A 1ss8_A 3cau_A ... Length = 547 Back     alignment and structure
>3rtk_A 60 kDa chaperonin 2; heat shock protein, chaperone; 2.80A {Mycobacterium tuberculosis} PDB: 1sjp_A Length = 546 Back     alignment and structure
>1we3_A CPN60(groel); chaperonin, chaperone, groel, HSP60, HSP10, folding, ADP, ATP; HET: ADP; 2.80A {Thermus thermophilus} SCOP: a.129.1.1 c.8.5.1 d.56.1.1 PDB: 1wf4_a* Length = 543 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query152
3osx_A201 60 kDa chaperonin; alpha, beta, apical domain, cha 100.0
3m6c_A194 60 kDa chaperonin 1; chaperone, ATP-binding, nucle 100.0
1srv_A145 Protein (groel (HSP60 class)); chaperone, cell div 100.0
3rtk_A 546 60 kDa chaperonin 2; heat shock protein, chaperone 100.0
1kp8_A 547 Groel protein; chaperonin, assisted protein foldin 100.0
1we3_A 543 CPN60(groel); chaperonin, chaperone, groel, HSP60, 100.0
1iok_A 545 Chaperonin 60; chaperone; 3.20A {Paracoccus denitr 100.0
3iyg_E 515 T-complex protein 1 subunit; TRIC/CCT, asymmetric, 99.87
3p9d_E 562 T-complex protein 1 subunit epsilon; HSP60, eukary 99.85
3p9d_A 559 T-complex protein 1 subunit alpha; HSP60, eukaryot 99.84
3aq1_B 500 Thermosome subunit; group II chaperonin, protein f 99.83
3iyg_H 515 T-complex protein 1 subunit ETA; TRIC/CCT, asymmet 99.82
1a6d_A 545 Thermosome (alpha subunit); group II chaperonin, C 99.82
1q3q_A 548 Thermosome alpha subunit; chaperone, chaperonin; H 99.82
1a6d_B 543 Thermosome (beta subunit); group II chaperonin, CC 99.81
3ruv_A 543 Chaperonin, CPN; double-ring, protein folding mach 99.81
3ko1_A 553 Chaperonin; 9-fold symmetry, double ring, ATP hydr 99.8
3p9d_C 590 T-complex protein 1 subunit gamma; HSP60, eukaryot 99.77
3iyg_B 513 T-complex protein 1 subunit beta; TRIC/CCT, asymme 99.76
3iyg_Z 517 T-complex protein 1 subunit zeta; TRIC/CCT, asymme 99.76
3p9d_D 528 T-complex protein 1 subunit delta; HSP60, eukaryot 99.75
3iyg_D 518 T-complex protein 1 subunit delta; TRIC/CCT, asymm 99.74
3p9d_F 546 T-complex protein 1 subunit zeta; HSP60, eukaryoti 99.73
3iyg_A 529 T-complex protein 1 subunit alpha; TRIC/CCT, asymm 99.72
3p9d_G 550 T-complex protein 1 subunit ETA; HSP60, eukaryotic 99.7
3p9d_B 527 T-complex protein 1 subunit beta; HSP60, eukaryoti 99.67
3iyg_Q 512 T-complex protein 1 subunit theta; TRIC/CCT, asymm 99.66
3iyg_G 515 T-complex protein 1 subunit gamma; TRIC/CCT, asymm 99.65
3p9d_H 568 T-complex protein 1 subunit theta; HSP60, eukaryot 99.52
1ass_A159 Thermosome; chaperonin, HSP60, TCP1, groel, thermo 97.91
1gml_A178 T-complex protein 1 subunit gamma; chaperone, chap 97.33
>3osx_A 60 kDa chaperonin; alpha, beta, apical domain, chaperone; 1.55A {Xenorhabdus nematophila} SCOP: c.8.5.1 PDB: 1kid_A 1fy9_A 1la1_A 1fya_A 1jon_A 1dk7_A 1dkd_A Back     alignment and structure
Probab=100.00  E-value=1.4e-69  Score=436.36  Aligned_cols=148  Identities=24%  Similarity=0.381  Sum_probs=146.1

Q ss_pred             CccCCccccccc-cCCCCceEEeeCceEEEecccccchHHHHHHH--HhhcCCCeEEEecccccchhhhhhcccccccce
Q 031820            1 MKLKWRPVSSYF-TNQKAKDCVLENPFLLILENMIVSKNIVEQAI--AQADSRPLLIVAEDVEDKLIGSLILGKTCLQNK   77 (152)
Q Consensus         1 m~fdrGylSpyf-td~~~~~~ele~p~ILltd~kIs~~~~ilp~L--~~~~~rpLlIiAedv~~eaL~tLv~Nklrg~l~   77 (152)
                      |||||||+|||| ||+++|+|+|+|||||+||+|||++++|+|+|  +++.+||||||||||++|||+|||+||+||+++
T Consensus        15 ~qfDrGYiSPYfvtd~e~m~~~le~p~ILitdkKIs~i~~ilP~LE~v~~~~rpLlIIAEDvegEALatLvvNklrg~l~   94 (201)
T 3osx_A           15 MQFDRGYLSPYFINKPESGSVELENPYILLVDKKISNIRELLPVLEGVAKASKPLVIIAEDVEGEALATLVVNNMRGIVK   94 (201)
T ss_dssp             EEESCCBSCGGGCSBTTTTBEEEESCEEEEEEEEECCHHHHHHHHHHHHTSSCCEEEEEEEECHHHHHHHHHHHHHTSCC
T ss_pred             cEecCccCChheeecccCCEEEecCCeEEEEcCccCCHHHHHHHHHHHHHhCCCeEEEeccccchhhhHHHHhhccceEE
Confidence            899999999999 99999999999999999999999999999999  889999999999999999999999999999999


Q ss_pred             EE-EecCCCCCchhhHhhhhhhhhhhhcCeEeec---cccCCCCCCCCceeeEEEEeCCceEEEcCCCChHhhhhhhc
Q 031820           78 VS-IAKPHEDDYEKETKAIMDDLAILTGGQVLNG---ATNVSFMPLMLGSCKELLYQMTRWLSLVGLVASLLLKKDVH  151 (152)
Q Consensus        78 v~-VkaP~~~gfG~~rk~~L~DiAilTGg~vi~~---~~l~~~~~~~LG~a~~v~vtkd~T~il~g~g~~~~i~~rv~  151 (152)
                      || ||||   ||||+||++|+||||+|||+||++   ++|+++++++||+|++|+||||+|+|++|.|++++|++||+
T Consensus        95 v~AVKAP---gFGdrRk~~L~DIAilTGg~visee~g~~Le~~~~~~LG~a~~V~vtkd~TtIv~G~G~~~~I~~Rv~  169 (201)
T 3osx_A           95 VASVKAP---GFGDRRKAMLQDIATLTNGTVISEEIGLELEKATLEDLGQAKRVVINKDTTTIIDGVGEEGAIAARVT  169 (201)
T ss_dssp             EEEEECS---SCHHHHHHHHHHHHHHHTCCCBCGGGTCCGGGCCGGGCEEEEEEEECSSCEEEEEECCCHHHHHHHHH
T ss_pred             EEEEeCC---CCccchhhhhHhHHHHhCCEEEecccCCccccCCHhhCCCccEEEEcCCceEEecCCCCHHHHHHHHH
Confidence            99 9999   999999999999999999999999   89999999999999999999999999999999999999985
>3m6c_A 60 kDa chaperonin 1; chaperone, ATP-binding, nucleotide-binding; 2.20A {Mycobacterium tuberculosis} Back     alignment and structure
>1srv_A Protein (groel (HSP60 class)); chaperone, cell division, ATP-binding, phosphorylation; 1.70A {Thermus thermophilus} SCOP: c.8.5.1 Back     alignment and structure
>3rtk_A 60 kDa chaperonin 2; heat shock protein, chaperone; 2.80A {Mycobacterium tuberculosis} PDB: 1sjp_A Back     alignment and structure
>1kp8_A Groel protein; chaperonin, assisted protein folding, chaperone; HET: ATP; 2.00A {Escherichia coli} SCOP: a.129.1.1 c.8.5.1 d.56.1.1 PDB: 1gr5_A 2c7e_A* 1grl_A 1oel_A 1xck_A 1gru_A 1mnf_A 1aon_A 2c7c_A 2c7d_A 2cgt_A 2nwc_A 3e76_A* 2eu1_A 1j4z_A 1kpo_O 1sx3_A* 3c9v_A 1ss8_A 3cau_A ... Back     alignment and structure
>1we3_A CPN60(groel); chaperonin, chaperone, groel, HSP60, HSP10, folding, ADP, ATP; HET: ADP; 2.80A {Thermus thermophilus} SCOP: a.129.1.1 c.8.5.1 d.56.1.1 PDB: 1wf4_a* Back     alignment and structure
>1iok_A Chaperonin 60; chaperone; 3.20A {Paracoccus denitrificans} SCOP: a.129.1.1 c.8.5.1 d.56.1.1 Back     alignment and structure
>3iyg_E T-complex protein 1 subunit; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} Back     alignment and structure
>3p9d_E T-complex protein 1 subunit epsilon; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_e* 4d8q_E* 4d8r_e* Back     alignment and structure
>3p9d_A T-complex protein 1 subunit alpha; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_a* 4d8q_A* 4d8r_a* Back     alignment and structure
>3aq1_B Thermosome subunit; group II chaperonin, protein folding, chaperone; 2.75A {Methanococcoides burtonii} Back     alignment and structure
>3iyg_H T-complex protein 1 subunit ETA; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} Back     alignment and structure
>1a6d_A Thermosome (alpha subunit); group II chaperonin, CCT, TRIC, PR folding, ATPase, chaperonin; 2.60A {Thermoplasma acidophilum} SCOP: a.129.1.2 c.8.5.2 d.56.1.2 PDB: 1a6e_A* Back     alignment and structure
>1q3q_A Thermosome alpha subunit; chaperone, chaperonin; HET: ANP; 2.30A {Thermococcus SP} SCOP: a.129.1.2 c.8.5.2 d.56.1.2 PDB: 1q2v_A* 1q3s_A* 1q3r_A Back     alignment and structure
>1a6d_B Thermosome (beta subunit); group II chaperonin, CCT, TRIC, PR folding, ATPase, chaperonin; 2.60A {Thermoplasma acidophilum} SCOP: a.129.1.2 c.8.5.2 d.56.1.2 PDB: 1a6e_B* 1e0r_B Back     alignment and structure
>3ruv_A Chaperonin, CPN; double-ring, protein folding machinery, group II chaperonin, binding, chaperone; HET: ANP; 2.24A {Methanococcus maripaludis} PDB: 3rus_A* 3ruw_A* 3ruq_A* 3los_A 3kfb_A* 3izi_A 3izj_A 3izm_A 3izh_A 3kfe_A* 3iyf_A* 3kfk_A* 3izk_A 3izl_A 3j03_A 3izn_A 3j02_A Back     alignment and structure
>3ko1_A Chaperonin; 9-fold symmetry, double ring, ATP hydrolase, chaperone, NUCL binding; HET: ADP; 3.70A {Acidianus tengchongensis} Back     alignment and structure
>3p9d_C T-complex protein 1 subunit gamma; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_c* 4d8q_C* 4d8r_c* 2bbm_B 2bbn_B Back     alignment and structure
>3iyg_B T-complex protein 1 subunit beta; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} PDB: 3ktt_B 4a0o_A 4a0v_A 4a0w_A 4a13_A Back     alignment and structure
>3iyg_Z T-complex protein 1 subunit zeta; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} Back     alignment and structure
>3p9d_D T-complex protein 1 subunit delta; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_d* 4d8q_D* 4d8r_d* Back     alignment and structure
>3iyg_D T-complex protein 1 subunit delta; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} Back     alignment and structure
>3p9d_F T-complex protein 1 subunit zeta; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_f* 4d8q_F* 4d8r_f* Back     alignment and structure
>3iyg_A T-complex protein 1 subunit alpha; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} Back     alignment and structure
>3p9d_G T-complex protein 1 subunit ETA; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_g* 4d8q_G* 4d8r_g* Back     alignment and structure
>3p9d_B T-complex protein 1 subunit beta; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_b* 4d8q_B* 4d8r_b* Back     alignment and structure
>3iyg_Q T-complex protein 1 subunit theta; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} Back     alignment and structure
>3iyg_G T-complex protein 1 subunit gamma; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} Back     alignment and structure
>3p9d_H T-complex protein 1 subunit theta; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_h* 4d8q_H* 4d8r_h* Back     alignment and structure
>1ass_A Thermosome; chaperonin, HSP60, TCP1, groel, thermoplasma ACI ATP-binding; 2.30A {Thermoplasma acidophilum} SCOP: c.8.5.2 PDB: 1asx_A Back     alignment and structure
>1gml_A T-complex protein 1 subunit gamma; chaperone, chaperonin, actin, tubulin; 2.2A {Mus musculus} SCOP: c.8.5.2 PDB: 1gn1_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 152
d1kida_193 c.8.5.1 (A:) GroEL, A domain {Escherichia coli [Ta 9e-17
d1srva_145 c.8.5.1 (A:) GroEL, A domain {Thermus thermophilus 2e-16
d1ioka2176 c.8.5.1 (A:191-366) GroEL, A domain {Paracoccus de 2e-16
d1sjpa2184 c.8.5.1 (A:189-372) GroEL, A domain {Mycobacterium 5e-15
>d1kida_ c.8.5.1 (A:) GroEL, A domain {Escherichia coli [TaxId: 562]} Length = 193 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: The "swivelling" beta/beta/alpha domain
superfamily: GroEL apical domain-like
family: GroEL-like chaperone, apical domain
domain: GroEL, A domain
species: Escherichia coli [TaxId: 562]

 Score = 71.4 bits (175), Expect = 9e-17
 Identities = 35/126 (27%), Positives = 59/126 (46%), Gaps = 12/126 (9%)

Query: 8   VSSYF-TNQKAKDCVLENPFLLILENMIVSK----NIVEQAIAQADSRPLLIVAEDVEDK 62
           +S YF    +     LE+PF+L+ +  I +      ++E        +PLLI+AEDVE +
Sbjct: 17  LSPYFINKPETGAVELESPFILLADKKISNIREMLPVLEAVAKA--GKPLLIIAEDVEGE 74

Query: 63  LIGSLILGKTCLQNKVSIAKPHEDDYEKETKAIMDDLAILTGGQVLNGATNVSFMPL--- 119
            + +L++       KV+  K     +    KA++ D+A LTGG V++    +        
Sbjct: 75  ALATLVVNTMRGIVKVAAVKAPG--FGDRRKAMLQDIATLTGGTVISEEIGMELEKATLE 132

Query: 120 MLGSCK 125
            LG  K
Sbjct: 133 DLGQAK 138
>d1srva_ c.8.5.1 (A:) GroEL, A domain {Thermus thermophilus [TaxId: 274]} Length = 145 Back     information, alignment and structure
>d1ioka2 c.8.5.1 (A:191-366) GroEL, A domain {Paracoccus denitrificans [TaxId: 266]} Length = 176 Back     information, alignment and structure
>d1sjpa2 c.8.5.1 (A:189-372) GroEL, A domain {Mycobacterium tuberculosis, GroEL2 [TaxId: 1773]} Length = 184 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query152
d1ioka2176 GroEL, A domain {Paracoccus denitrificans [TaxId: 100.0
d1sjpa2184 GroEL, A domain {Mycobacterium tuberculosis, GroEL 100.0
d1kida_193 GroEL, A domain {Escherichia coli [TaxId: 562]} 100.0
d1srva_145 GroEL, A domain {Thermus thermophilus [TaxId: 274] 100.0
d1sjpa389 GroEL, I domain {Mycobacterium tuberculosis, GroEL 98.94
d1q3qa2153 Thermosome, A-domain {Archaeon Thermococcus sp. ks 98.24
d1assa_152 Thermosome, A-domain {Archaeon Thermoplasma acidop 98.09
d1a6db2152 Thermosome, A-domain {Archaeon Thermoplasma acidop 97.98
d1we3a386 GroEL, I domain {Thermus thermophilus [TaxId: 274] 97.63
d1gmla_168 Thermosome, A-domain {Mouse (Mus musculus), gamma 97.57
d1kp8a397 GroEL, I domain {Escherichia coli [TaxId: 562]} 97.37
d1ioka397 GroEL, I domain {Paracoccus denitrificans [TaxId: 97.3
d1ioka1 252 GroEL, E domain {Paracoccus denitrificans [TaxId: 95.91
d1kp8a1 252 GroEL, E domain {Escherichia coli [TaxId: 562]} 95.46
>d1ioka2 c.8.5.1 (A:191-366) GroEL, A domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: The "swivelling" beta/beta/alpha domain
superfamily: GroEL apical domain-like
family: GroEL-like chaperone, apical domain
domain: GroEL, A domain
species: Paracoccus denitrificans [TaxId: 266]

Probab=100.00  E-value=1.4e-61  Score=381.32  Aligned_cols=148  Identities=28%  Similarity=0.398  Sum_probs=108.7

Q ss_pred             CccCCccccccc-cCCCCceEEeeCceEEEecccccchHHHHHHH--HhhcCCCeEEEecccccchhhhhhcccccccce
Q 031820            1 MKLKWRPVSSYF-TNQKAKDCVLENPFLLILENMIVSKNIVEQAI--AQADSRPLLIVAEDVEDKLIGSLILGKTCLQNK   77 (152)
Q Consensus         1 m~fdrGylSpyf-td~~~~~~ele~p~ILltd~kIs~~~~ilp~L--~~~~~rpLlIiAedv~~eaL~tLv~Nklrg~l~   77 (152)
                      |+|||||+|||| ||+++|+|+|+|||||+||+||+++++|+|+|  +.+.+|||||||+||+++||++|++|+++|+++
T Consensus         3 ~~~d~Gy~SpyFvtd~~~~~~~l~np~ILi~d~kI~~~~~i~p~Le~~~~~~~PLlIIA~di~~~aL~~Lv~N~~~g~l~   82 (176)
T d1ioka2           3 MQFDRGYLSPYFVTNADKMIAELEDAYILLHEKKLSSLQPMVPLLESVIQSQKPLLIVAEDVEGEALATLVVNKLRGGLK   82 (176)
T ss_dssp             EECSCCCSCGGGCCCSSSSCEEEEEEEEEECSSCBCCCCC-----------CCCCEEEESCBC-----------------
T ss_pred             cccccCccCccceeCCcCCEEEeeCcEEEEEccccCcHHHHHHHHHHHHhcCCcEEEEecCCCHHHHHHHHHHHhcCCce
Confidence            799999999999 99999999999999999999999999999999  888999999999999999999999999999999


Q ss_pred             EE-EecCCCCCchhhHhhhhhhhhhhhcCeEeec---cccCCCCCCCCceeeEEEEeCCceEEEcCCCChHhhhhhhc
Q 031820           78 VS-IAKPHEDDYEKETKAIMDDLAILTGGQVLNG---ATNVSFMPLMLGSCKELLYQMTRWLSLVGLVASLLLKKDVH  151 (152)
Q Consensus        78 v~-VkaP~~~gfG~~rk~~L~DiAilTGg~vi~~---~~l~~~~~~~LG~a~~v~vtkd~T~il~g~g~~~~i~~rv~  151 (152)
                      || ||||   |||++|+++|+|||++|||++|++   .+++++++++||+|++|+|||++|+|++|+|+++.|++||+
T Consensus        83 v~aVkaP---~fG~~r~~~LeDlA~~tGa~vi~~~~g~~l~~~~~~~LG~a~kv~vtk~~T~ii~g~g~~~~i~~Ri~  157 (176)
T d1ioka2          83 IAAVKAP---GFGDRRKAMLQDIAILTGGQVISEDLGMKLENVTIDMLGRAKKVSINKDNTTIVDGAGEKAEIEARVS  157 (176)
T ss_dssp             CEEEECS---CCTTHHHHHHHHHHHHHTC---------------CTTSEEEEEEEECSSCEEEESCCCCHHHHHHHHH
T ss_pred             EEEEeCC---CCCcHHHHHHHHHHHhhCCEEEecccCCChhhCCHHHCceeeEEEEecCceEEEcCCCCHHHHHHHHH
Confidence            99 9999   999999999999999999999998   88999999999999999999999999999999999999985
>d1sjpa2 c.8.5.1 (A:189-372) GroEL, A domain {Mycobacterium tuberculosis, GroEL2 [TaxId: 1773]} Back     information, alignment and structure
>d1kida_ c.8.5.1 (A:) GroEL, A domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1srva_ c.8.5.1 (A:) GroEL, A domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sjpa3 d.56.1.1 (A:135-188,A:373-407) GroEL, I domain {Mycobacterium tuberculosis, GroEL2 [TaxId: 1773]} Back     information, alignment and structure
>d1q3qa2 c.8.5.2 (A:217-369) Thermosome, A-domain {Archaeon Thermococcus sp. ks-1, alpha chain [TaxId: 79679]} Back     information, alignment and structure
>d1assa_ c.8.5.2 (A:) Thermosome, A-domain {Archaeon Thermoplasma acidophilum, alpha chain [TaxId: 2303]} Back     information, alignment and structure
>d1a6db2 c.8.5.2 (B:216-367) Thermosome, A-domain {Archaeon Thermoplasma acidophilum, beta chain [TaxId: 2303]} Back     information, alignment and structure
>d1we3a3 d.56.1.1 (A:139-189,A:374-408) GroEL, I domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1gmla_ c.8.5.2 (A:) Thermosome, A-domain {Mouse (Mus musculus), gamma chain [TaxId: 10090]} Back     information, alignment and structure
>d1kp8a3 d.56.1.1 (A:137-190,A:367-409) GroEL, I domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ioka3 d.56.1.1 (A:137-190,A:367-409) GroEL, I domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1ioka1 a.129.1.1 (A:2-136,A:410-526) GroEL, E domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1kp8a1 a.129.1.1 (A:2-136,A:410-526) GroEL, E domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure