Citrus Sinensis ID: 031881

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-
MLLPRLLRVGAFMVKELSRGGCTSISRTGCTRQHWRPFIELQSVPRVFQGSIFQKYPHFSTTAENDASHGSNKQKDMINVTFVDKDGEEKNIKVPVGMSMLEAAHENDIELEGACEGSLACSTCHVIVMVHYWPYMCRDNVLSNIFKNMFL
ccHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEcccccEEEEEEcccccHHHHHHHccccccccccccccccccEEEEEcccccccccccccccHHHcccc
cHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHccccccccccccccccccccHHHccccccccccccccccccccccEEEEEEEEccccEEEEEEccccEHHHHHHHccccccccccccccccccEEEEcHHHHHHHHcccHHHHHHHHHcc
MLLPRLLRVGAFMVKElsrggctsisrtgctrqhwrpfielqsvprvfqgsifqkyphfsttaendashgsnkqkdminvtfvdkdgeeknikvpvGMSMLEAAHendielegacegslacstCHVIVMVHywpymcrdnVLSNIFKNMFL
MLLPRLLRVGAFMvkelsrggctsisrtgctrqhwrpfIELQSVPRVFQGSIFQKYPHFSTTAEndashgsnkqkdMINVTFVDKDGEEKNIKVPVGMSMLEAAHENDIELEGACEGSLACSTCHVIVMVHYWPYMCRDNVLSNIFKNMFL
MLLPRLLRVGAFMVKELSRGGCTSISRTGCTRQHWRPFIELQSVPRVFQGSIFQKYPHFSTTAENDASHGSNKQKDMINVTFVDKDGEEKNIKVPVGMSMLEAAHENDIELEGACEGSLACSTCHVIVMVHYWPYMCRDNVLSNIFKNMFL
****RLLRVGAFMVKELSRGGCTSISRTGCTRQHWRPFIELQSVPRVFQGSIFQKYPHF*******************NVTFV********IKVPVGMSMLEAAHENDIELEGACEGSLACSTCHVIVMVHYWPYMCRDNVLSNIFKN***
********VGAFMVKELSRG***********************************************************VTFVDKDGEEKNIKVPVGMSMLEAAHENDIELEGACEGSLACSTCHVIVMVHYWPYMCRDNVLSNIFKNMFL
MLLPRLLRVGAFMVKELSRGGCTSISRTGCTRQHWRPFIELQSVPRVFQGSIFQKYPHFST**********NKQKDMINVTFVDKDGEEKNIKVPVGMSMLEAAHENDIELEGACEGSLACSTCHVIVMVHYWPYMCRDNVLSNIFKNMFL
MLLPRLLRVGAFMVKELSRGGCTSISRTGCTRQHW**************************************QKDMINVTFVDKDGEEKNIKVPVGMSMLEAAHENDIELEGACEGSLACSTCHVIVMVHYWPYMCRDNVLSNIFKNMFL
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLLPRLLRVGAFMVKELSRGGCTSISRTGCTRQHWRPFIELQSVPRVFQGSIFQKYPHFSTTAENDASHGSNKQKDMINVTFVDKDGEEKNIKVPVGMSMLEAAHENDIELEGACEGSLACSTCHVIVMVHYWPYMCRDNVLSNIFKNMFL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query151 2.2.26 [Sep-21-2011]
Q9AKM6112 2Fe-2S ferredoxin OS=Rick yes no 0.370 0.5 0.607 7e-16
Q92J08112 2Fe-2S ferredoxin OS=Rick yes no 0.370 0.5 0.607 7e-16
Q9AKH1112 2Fe-2S ferredoxin OS=Rick yes no 0.370 0.5 0.607 9e-16
Q4UKL2112 2Fe-2S ferredoxin OS=Rick yes no 0.370 0.5 0.589 2e-15
Q1RJ69111 2Fe-2S ferredoxin OS=Rick yes no 0.370 0.504 0.625 1e-14
Q9ZDW6112 2Fe-2S ferredoxin OS=Rick yes no 0.370 0.5 0.553 3e-14
Q9AKC4117 2Fe-2S ferredoxin OS=Rick yes no 0.370 0.478 0.553 6e-14
Q6P4F2183 Adrenodoxin-like protein, yes no 0.768 0.633 0.347 1e-11
P37193172 Adrenodoxin-like protein, yes no 0.377 0.331 0.508 4e-11
Q08C57195 Adrenodoxin-like protein, yes no 0.814 0.630 0.330 6e-11
>sp|Q9AKM6|FER2_RICMO 2Fe-2S ferredoxin OS=Rickettsia montana GN=fdxB PE=3 SV=1 Back     alignment and function desciption
 Score = 82.8 bits (203), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 34/56 (60%), Positives = 46/56 (82%)

Query: 78  INVTFVDKDGEEKNIKVPVGMSMLEAAHENDIELEGACEGSLACSTCHVIVMVHYW 133
           I VTF+  DGEEK ++ P+G+S+LE AH ND++LEGACEGSLAC+TCHVI+   ++
Sbjct: 5   IKVTFIINDGEEKTVEAPIGLSILEIAHSNDLDLEGACEGSLACATCHVILEEEFY 60
Ferredoxin are iron-sulfur proteins that transfer electrons in a wide variety of metabolic reactions.
Rickettsia montana (taxid: 33991)
>sp|Q92J08|FER2_RICCN 2Fe-2S ferredoxin OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=fdxB PE=3 SV=1 Back     alignment and function description
>sp|Q9AKH1|FER2_RICRI 2Fe-2S ferredoxin OS=Rickettsia rickettsii GN=fdxB PE=3 SV=1 Back     alignment and function description
>sp|Q4UKL2|FER2_RICFE 2Fe-2S ferredoxin OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=fdxB PE=3 SV=1 Back     alignment and function description
>sp|Q1RJ69|FER2_RICBR 2Fe-2S ferredoxin OS=Rickettsia bellii (strain RML369-C) GN=fdxB PE=3 SV=1 Back     alignment and function description
>sp|Q9ZDW6|FER2_RICPR 2Fe-2S ferredoxin OS=Rickettsia prowazekii (strain Madrid E) GN=fdxB PE=3 SV=1 Back     alignment and function description
>sp|Q9AKC4|FER2_RICTY 2Fe-2S ferredoxin OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=fdxB PE=3 SV=1 Back     alignment and function description
>sp|Q6P4F2|ADXL_HUMAN Adrenodoxin-like protein, mitochondrial OS=Homo sapiens GN=FDX1L PE=1 SV=1 Back     alignment and function description
>sp|P37193|ADXH_DROME Adrenodoxin-like protein, mitochondrial OS=Drosophila melanogaster GN=Fdxh PE=2 SV=3 Back     alignment and function description
>sp|Q08C57|ADXL_DANRE Adrenodoxin-like protein, mitochondrial OS=Danio rerio GN=fdx1l PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query151
255550341199 adrenodoxin, putative [Ricinus communis] 0.827 0.628 0.635 3e-37
351629593194 adrenodoxin-like ferredoxin 1-1 [Dimocar 0.854 0.664 0.635 8e-37
224115868198 predicted protein [Populus trichocarpa] 0.854 0.651 0.616 3e-35
224072725198 predicted protein [Populus trichocarpa] 0.847 0.646 0.606 8e-35
225444625198 PREDICTED: 2Fe-2S ferredoxin [Vitis vini 0.854 0.651 0.571 1e-32
388507328201 unknown [Lotus japonicus] 0.834 0.626 0.583 8e-32
356564716198 PREDICTED: 2Fe-2S ferredoxin-like [Glyci 0.827 0.631 0.534 3e-31
356547972199 PREDICTED: 2Fe-2S ferredoxin-like [Glyci 0.854 0.648 0.544 6e-30
357480231204 2Fe-2S ferredoxin [Medicago truncatula] 0.854 0.632 0.525 2e-29
449465507196 PREDICTED: 2Fe-2S ferredoxin-like [Cucum 0.841 0.647 0.511 6e-26
>gi|255550341|ref|XP_002516221.1| adrenodoxin, putative [Ricinus communis] gi|223544707|gb|EEF46223.1| adrenodoxin, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  159 bits (403), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 82/129 (63%), Positives = 99/129 (76%), Gaps = 4/129 (3%)

Query: 5   RLLRVGAFMVKELSRGGCTSISRTGCTR----QHWRPFIELQSVPRVFQGSIFQKYPHFS 60
           RL R+G+ +VK+LSRG CTS+SRT   R    Q+WRP  EL    + F+G++  +Y  FS
Sbjct: 6   RLSRIGSGIVKQLSRGICTSLSRTEFVRTPYSQYWRPQGELHPETKGFRGTLSPRYHLFS 65

Query: 61  TTAENDASHGSNKQKDMINVTFVDKDGEEKNIKVPVGMSMLEAAHENDIELEGACEGSLA 120
           TTA  +     ++QK  I+VTFVDKDGEEK+IKVP+GMSMLEAAHENDIELEGACEGSLA
Sbjct: 66  TTASGNDIADGDEQKHKISVTFVDKDGEEKHIKVPLGMSMLEAAHENDIELEGACEGSLA 125

Query: 121 CSTCHVIVM 129
           CSTCHVIVM
Sbjct: 126 CSTCHVIVM 134

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|351629593|gb|AEQ54760.1| adrenodoxin-like ferredoxin 1-1 [Dimocarpus longan] gi|351629597|gb|AEQ54762.1| adrenodoxin-like ferredoxin 1-2 [Dimocarpus longan] Back     alignment and taxonomy information
>gi|224115868|ref|XP_002332077.1| predicted protein [Populus trichocarpa] gi|222831963|gb|EEE70440.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224072725|ref|XP_002303851.1| predicted protein [Populus trichocarpa] gi|222841283|gb|EEE78830.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225444625|ref|XP_002275665.1| PREDICTED: 2Fe-2S ferredoxin [Vitis vinifera] gi|297738516|emb|CBI27761.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|388507328|gb|AFK41730.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|356564716|ref|XP_003550595.1| PREDICTED: 2Fe-2S ferredoxin-like [Glycine max] Back     alignment and taxonomy information
>gi|356547972|ref|XP_003542378.1| PREDICTED: 2Fe-2S ferredoxin-like [Glycine max] Back     alignment and taxonomy information
>gi|357480231|ref|XP_003610401.1| 2Fe-2S ferredoxin [Medicago truncatula] gi|355511456|gb|AES92598.1| 2Fe-2S ferredoxin [Medicago truncatula] Back     alignment and taxonomy information
>gi|449465507|ref|XP_004150469.1| PREDICTED: 2Fe-2S ferredoxin-like [Cucumis sativus] gi|449513377|ref|XP_004164310.1| PREDICTED: 2Fe-2S ferredoxin-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query151
TAIR|locus:2127358197 MFDX2 "MITOCHONDRIAL FERREDOXI 0.847 0.649 0.511 5.7e-27
TAIR|locus:2115939197 MFDX1 "mitochondrial ferredoxi 0.847 0.649 0.466 2e-24
GENEDB_PFALCIPARUM|PFL0705c158 PFL0705c "adrenodoxin-type fer 0.423 0.405 0.484 1.6e-13
UNIPROTKB|Q8I5R0158 PFL0705c "Adrenodoxin-type fer 0.423 0.405 0.484 1.6e-13
WB|WBGene00013532169 Y73F8A.27 [Caenorhabditis eleg 0.490 0.437 0.461 4.4e-13
DICTYBASE|DDB_G0267486159 DDB_G0267486 "2Fe-2S type ferr 0.536 0.509 0.4 5.6e-13
FB|FBgn0011769172 Fdxh "Ferredoxin" [Drosophila 0.377 0.331 0.508 1.9e-12
TIGR_CMR|NSE_0297111 NSE_0297 "iron-sulfur cluster 0.337 0.459 0.568 1.9e-12
ZFIN|ZDB-GENE-060929-1046195 fdx1l "ferredoxin 1-like" [Dan 0.708 0.548 0.380 1.9e-12
UNIPROTKB|E7EQL1142 E7EQL1 "Uncharacterized protei 0.768 0.816 0.347 5e-12
TAIR|locus:2127358 MFDX2 "MITOCHONDRIAL FERREDOXIN 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 303 (111.7 bits), Expect = 5.7e-27, P = 5.7e-27
 Identities = 68/133 (51%), Positives = 88/133 (66%)

Query:     1 MLLPRLLRVGAFMVKELSRGGCTSISRTGCTRQHWRPFIE----LQSVPRVFQGSIFQKY 56
             M+  RL R+G+ +VKEL R    S+      ++ +  +++    LQ   R F+ ++F   
Sbjct:     1 MVFHRLSRLGSRIVKELPRERHLSMCGKRILQRSYGQYLQSSPMLQRQTRSFKEALFSNN 60

Query:    57 PHFSTTAENDASHGSNKQKDMINVTFVDKDGEEKNIKVPVGMSMLEAAHENDIELEGACE 116
               F T+    +  G  K  + INVTFVDKDGEE +IKVPVGM++LEAAHENDIELEGACE
Sbjct:    61 HKFCTSFSTTSEKGGEKT-EKINVTFVDKDGEEIHIKVPVGMNILEAAHENDIELEGACE 119

Query:   117 GSLACSTCHVIVM 129
             GSLACSTCHVIVM
Sbjct:   120 GSLACSTCHVIVM 132
GO:0005739 "mitochondrion" evidence=ISM
GO:0009055 "electron carrier activity" evidence=IEA;ISS
GO:0051536 "iron-sulfur cluster binding" evidence=IEA
GO:0051537 "2 iron, 2 sulfur cluster binding" evidence=IEA
GO:0019243 "methylglyoxal catabolic process to D-lactate" evidence=RCA
TAIR|locus:2115939 MFDX1 "mitochondrial ferredoxin 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
GENEDB_PFALCIPARUM|PFL0705c PFL0705c "adrenodoxin-type ferredoxin, putative" [Plasmodium falciparum (taxid:5833)] Back     alignment and assigned GO terms
UNIPROTKB|Q8I5R0 PFL0705c "Adrenodoxin-type ferredoxin, putative" [Plasmodium falciparum 3D7 (taxid:36329)] Back     alignment and assigned GO terms
WB|WBGene00013532 Y73F8A.27 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0267486 DDB_G0267486 "2Fe-2S type ferredoxin" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
FB|FBgn0011769 Fdxh "Ferredoxin" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
TIGR_CMR|NSE_0297 NSE_0297 "iron-sulfur cluster binding protein" [Neorickettsia sennetsu str. Miyayama (taxid:222891)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060929-1046 fdx1l "ferredoxin 1-like" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E7EQL1 E7EQL1 "Uncharacterized protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
estExt_fgenesh4_pm.C_2080014
adrenodoxin-like ferredoxin protein (199 aa)
(Populus trichocarpa)
Predicted Functional Partners:
estExt_Genewise1_v1.C_LG_VII0255
cysteine desulfurase/transaminase (EC-2.8.1.7) (452 aa)
• ••• • 0.866
gw1.598.1.1
hypothetical protein (210 aa)
• ••  • 0.836
gw1.19933.4.1
Predicted protein (110 aa)
• ••• • 0.575
estExt_fgenesh4_pm.C_LG_XII0286
SubName- Full=Putative uncharacterized protein; (163 aa)
• •   • 0.515
eugene3.00150565
SubName- Full=Putative uncharacterized protein; (165 aa)
• •   • 0.509

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query151
PLN02593117 PLN02593, PLN02593, adrenodoxin-like ferredoxin pr 4e-34
COG0633102 COG0633, Fdx, Ferredoxin [Energy production and co 6e-12
TIGR02007110 TIGR02007, fdx_isc, ferredoxin, 2Fe-2S type, ISC s 7e-11
PTZ00490143 PTZ00490, PTZ00490, Ferredoxin superfamily; Provis 4e-08
cd0020784 cd00207, fer2, 2Fe-2S iron-sulfur cluster binding 7e-08
pfam0011177 pfam00111, Fer2, 2Fe-2S iron-sulfur cluster bindin 2e-05
TIGR0200897 TIGR02008, fdx_plant, ferredoxin [2Fe-2S] 3e-05
TIGR01941 405 TIGR01941, nqrF, NADH:ubiquinone oxidoreductase, N 0.002
PRK05464 409 PRK05464, PRK05464, Na(+)-translocating NADH-quino 0.003
>gnl|CDD|178203 PLN02593, PLN02593, adrenodoxin-like ferredoxin protein Back     alignment and domain information 
 Score =  115 bits (289), Expect = 4e-34
 Identities = 46/52 (88%), Positives = 50/52 (96%)

Query: 78  INVTFVDKDGEEKNIKVPVGMSMLEAAHENDIELEGACEGSLACSTCHVIVM 129
           I+VTFVDKDGEE+ +K PVGMS+LEAAHENDIELEGACEGSLACSTCHVIVM
Sbjct: 1   ISVTFVDKDGEERTVKAPVGMSLLEAAHENDIELEGACEGSLACSTCHVIVM 52

Length = 117
>gnl|CDD|223706 COG0633, Fdx, Ferredoxin [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|131062 TIGR02007, fdx_isc, ferredoxin, 2Fe-2S type, ISC system Back     alignment and domain information
>gnl|CDD|185668 PTZ00490, PTZ00490, Ferredoxin superfamily; Provisional Back     alignment and domain information
>gnl|CDD|238126 cd00207, fer2, 2Fe-2S iron-sulfur cluster binding domain Back     alignment and domain information
>gnl|CDD|215725 pfam00111, Fer2, 2Fe-2S iron-sulfur cluster binding domain Back     alignment and domain information
>gnl|CDD|233684 TIGR02008, fdx_plant, ferredoxin [2Fe-2S] Back     alignment and domain information
>gnl|CDD|130996 TIGR01941, nqrF, NADH:ubiquinone oxidoreductase, Na(+)-translocating, F subunit Back     alignment and domain information
>gnl|CDD|235481 PRK05464, PRK05464, Na(+)-translocating NADH-quinone reductase subunit F; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 151
KOG3309159 consensus Ferredoxin [Energy production and conver 99.87
PTZ00490143 Ferredoxin superfamily; Provisional 99.67
PLN02593117 adrenodoxin-like ferredoxin protein 99.67
COG0633102 Fdx Ferredoxin [Energy production and conversion] 99.52
TIGR02007110 fdx_isc ferredoxin, 2Fe-2S type, ISC system. This 99.48
TIGR0200897 fdx_plant ferredoxin [2Fe-2S]. This model represen 99.44
CHL0013499 petF ferredoxin; Validated 99.34
PRK1071384 2Fe-2S ferredoxin YfaE; Provisional 99.29
PF0011178 Fer2: 2Fe-2S iron-sulfur cluster binding domain; I 99.28
TIGR01941 405 nqrF NADH:ubiquinone oxidoreductase, Na(+)-translo 99.25
PLN03136148 Ferredoxin; Provisional 99.23
PTZ00038191 ferredoxin; Provisional 99.16
PRK05464 409 Na(+)-translocating NADH-quinone reductase subunit 99.15
cd0020784 fer2 2Fe-2S iron-sulfur cluster binding domain. Ir 99.14
PRK11872 340 antC anthranilate dioxygenase reductase; Provision 99.01
PRK07609 339 CDP-6-deoxy-delta-3,4-glucoseen reductase; Validat 98.97
PRK05713 312 hypothetical protein; Provisional 98.95
TIGR02160352 PA_CoA_Oxy5 phenylacetate-CoA oxygenase/reductase, 98.94
PRK10684332 HCP oxidoreductase, NADH-dependent; Provisional 98.87
PF1351082 Fer2_4: 2Fe-2S iron-sulfur cluster binding domain; 98.66
PRK07569 234 bidirectional hydrogenase complex protein HoxU; Va 98.58
COG3894 614 Uncharacterized metal-binding protein [General fun 98.57
COG2871 410 NqrF Na+-transporting NADH:ubiquinone oxidoreducta 98.43
PRK08166 847 NADH dehydrogenase subunit G; Validated 98.11
PRK09908159 xanthine dehydrogenase subunit XdhC; Provisional 97.88
PTZ00305 297 NADH:ubiquinone oxidoreductase; Provisional 97.8
PRK09130 687 NADH dehydrogenase subunit G; Validated 97.76
PRK07860 797 NADH dehydrogenase subunit G; Validated 97.68
PRK08493 819 NADH dehydrogenase subunit G; Validated 97.61
PRK12814 652 putative NADPH-dependent glutamate synthase small 97.59
COG1034 693 NuoG NADH dehydrogenase/NADH:ubiquinone oxidoreduc 97.54
PRK11433217 aldehyde oxidoreductase 2Fe-2S subunit; Provisiona 97.54
TIGR03193148 4hydroxCoAred 4-hydroxybenzoyl-CoA reductase, gamm 97.41
PRK09129 776 NADH dehydrogenase subunit G; Validated 97.39
TIGR01973 603 NuoG NADH-quinone oxidoreductase, chain G. This mo 97.36
COG3383 978 Uncharacterized anaerobic dehydrogenase [General f 97.21
PRK06259 486 succinate dehydrogenase/fumarate reductase iron-su 97.16
TIGR03198151 pucE xanthine dehydrogenase E subunit. This gene h 97.06
COG2080156 CoxS Aerobic-type carbon monoxide dehydrogenase, s 97.03
PRK12577 329 succinate dehydrogenase iron-sulfur subunit; Provi 96.97
PRK12576 279 succinate dehydrogenase iron-sulfur subunit; Provi 96.95
PRK12386 251 fumarate reductase iron-sulfur subunit; Provisiona 96.83
PRK05950 232 sdhB succinate dehydrogenase iron-sulfur subunit; 96.82
PF13085110 Fer2_3: 2Fe-2S iron-sulfur cluster binding domain; 96.8
TIGR00384 220 dhsB succinate dehydrogenase and fumarate reductas 96.75
PRK13552 239 frdB fumarate reductase iron-sulfur subunit; Provi 96.54
PRK09800 956 putative hypoxanthine oxidase; Provisional 96.51
PRK12385 244 fumarate reductase iron-sulfur subunit; Provisiona 96.38
PLN00129 276 succinate dehydrogenase [ubiquinone] iron-sulfur s 96.3
PRK08640 249 sdhB succinate dehydrogenase iron-sulfur subunit; 96.19
TIGR02963 467 xanthine_xdhA xanthine dehydrogenase, small subuni 96.1
TIGR03313 951 Se_sel_red_Mo probable selenate reductase, molybde 95.67
COG0479 234 FrdB Succinate dehydrogenase/fumarate reductase, F 95.22
PRK07570 250 succinate dehydrogenase/fumarate reductase iron-su 95.16
KOG2282 708 consensus NADH-ubiquinone oxidoreductase, NDUFS1/7 94.15
TIGR03311 848 Se_dep_Molyb_1 selenium-dependent molybdenum hydro 93.95
TIGR02969 1330 mam_aldehyde_ox aldehyde oxidase. Members of this 93.9
PLN00192 1344 aldehyde oxidase 93.66
PRK12575 235 succinate dehydrogenase iron-sulfur subunit; Provi 92.17
TIGR01372 985 soxA sarcosine oxidase, alpha subunit family, hete 80.38
>KOG3309 consensus Ferredoxin [Energy production and conversion] Back     alignment and domain information 
Probab=99.87  E-value=5.5e-22  Score=154.88  Aligned_cols=97  Identities=45%  Similarity=0.733  Sum_probs=76.6

Q ss_pred             cccccccceeeecccccc-CCCCCCCCCceEEEEEcCCCCEEEEEeCCCchHHHHHHHCCCCCcCCCCCCceecccEEEE
Q 031881           50 GSIFQKYPHFSTTAENDA-SHGSNKQKDMINVTFVDKDGEEKNIKVPVGMSMLEAAHENDIELEGACEGSLACSTCHVIV  128 (151)
Q Consensus        50 ~~~~~~~~~fst~~~~~~-~~~~~~~~~~v~Vtfi~~dG~~~tv~v~~G~sLLdaa~~~gI~l~~aCgG~g~CgTChV~v  128 (151)
                      -+++.+++.|.+.....- ...++++.+.++|+|+++||++..+.+.+|+|||++|++|||+++++|+|+.+|+||||+|
T Consensus        15 ~a~~~~~~~f~~~~t~~~~~~~~~~~~e~i~Itfv~~dG~~~~i~g~vGdtlLd~ah~n~idleGACEgslACSTCHViv   94 (159)
T KOG3309|consen   15 LAPFTRNHIFRTSSTSEFSPSKGPRKVEDIKITFVDPDGEEIKIKGKVGDTLLDAAHENNLDLEGACEGSLACSTCHVIV   94 (159)
T ss_pred             ccccccceeeccCcccccccccCCCCCceEEEEEECCCCCEEEeeeecchHHHHHHHHcCCCccccccccccccceEEEE
Confidence            345566666665443322 2366677777999999999999999999999999999999999999999999999999999


Q ss_pred             EcCCC---CCCChhh--hhhhhh
Q 031881          129 MVHYW---PYMCRDN--VLSNIF  146 (151)
Q Consensus       129 ~~~~l---~~~~~~E--~L~~~~  146 (151)
                      .+++|   +++.++|  +|+-.|
T Consensus        95 ~~~~yekl~ep~DeE~DmLDlA~  117 (159)
T KOG3309|consen   95 DEEYYEKLPEPEDEENDMLDLAF  117 (159)
T ss_pred             cHHHHhcCCCCcchHHHHHHhhh
Confidence            98554   4555554  666554

>PTZ00490 Ferredoxin superfamily; Provisional Back     alignment and domain information
>PLN02593 adrenodoxin-like ferredoxin protein Back     alignment and domain information
>COG0633 Fdx Ferredoxin [Energy production and conversion] Back     alignment and domain information
>TIGR02007 fdx_isc ferredoxin, 2Fe-2S type, ISC system Back     alignment and domain information
>TIGR02008 fdx_plant ferredoxin [2Fe-2S] Back     alignment and domain information
>CHL00134 petF ferredoxin; Validated Back     alignment and domain information
>PRK10713 2Fe-2S ferredoxin YfaE; Provisional Back     alignment and domain information
>PF00111 Fer2: 2Fe-2S iron-sulfur cluster binding domain; InterPro: IPR001041 The ferredoxin protein family are electron carrier proteins with an iron-sulphur cofactor that act in a wide variety of metabolic reactions Back     alignment and domain information
>TIGR01941 nqrF NADH:ubiquinone oxidoreductase, Na(+)-translocating, F subunit Back     alignment and domain information
>PLN03136 Ferredoxin; Provisional Back     alignment and domain information
>PTZ00038 ferredoxin; Provisional Back     alignment and domain information
>PRK05464 Na(+)-translocating NADH-quinone reductase subunit F; Provisional Back     alignment and domain information
>cd00207 fer2 2Fe-2S iron-sulfur cluster binding domain Back     alignment and domain information
>PRK11872 antC anthranilate dioxygenase reductase; Provisional Back     alignment and domain information
>PRK07609 CDP-6-deoxy-delta-3,4-glucoseen reductase; Validated Back     alignment and domain information
>PRK05713 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02160 PA_CoA_Oxy5 phenylacetate-CoA oxygenase/reductase, PaaK subunit Back     alignment and domain information
>PRK10684 HCP oxidoreductase, NADH-dependent; Provisional Back     alignment and domain information
>PF13510 Fer2_4: 2Fe-2S iron-sulfur cluster binding domain; PDB: 1Y56_A 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A Back     alignment and domain information
>PRK07569 bidirectional hydrogenase complex protein HoxU; Validated Back     alignment and domain information
>COG3894 Uncharacterized metal-binding protein [General function prediction only] Back     alignment and domain information
>COG2871 NqrF Na+-transporting NADH:ubiquinone oxidoreductase, subunit NqrF [Energy production and conversion] Back     alignment and domain information
>PRK08166 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>PRK09908 xanthine dehydrogenase subunit XdhC; Provisional Back     alignment and domain information
>PTZ00305 NADH:ubiquinone oxidoreductase; Provisional Back     alignment and domain information
>PRK09130 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>PRK07860 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>PRK08493 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>COG1034 NuoG NADH dehydrogenase/NADH:ubiquinone oxidoreductase 75 kD subunit (chain G) [Energy production and conversion] Back     alignment and domain information
>PRK11433 aldehyde oxidoreductase 2Fe-2S subunit; Provisional Back     alignment and domain information
>TIGR03193 4hydroxCoAred 4-hydroxybenzoyl-CoA reductase, gamma subunit Back     alignment and domain information
>PRK09129 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>TIGR01973 NuoG NADH-quinone oxidoreductase, chain G Back     alignment and domain information
>COG3383 Uncharacterized anaerobic dehydrogenase [General function prediction only] Back     alignment and domain information
>PRK06259 succinate dehydrogenase/fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>TIGR03198 pucE xanthine dehydrogenase E subunit Back     alignment and domain information
>COG2080 CoxS Aerobic-type carbon monoxide dehydrogenase, small subunit CoxS/CutS homologs [Energy production and conversion] Back     alignment and domain information
>PRK12577 succinate dehydrogenase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK12576 succinate dehydrogenase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK12386 fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK05950 sdhB succinate dehydrogenase iron-sulfur subunit; Reviewed Back     alignment and domain information
>PF13085 Fer2_3: 2Fe-2S iron-sulfur cluster binding domain; PDB: 3P4Q_N 1KFY_N 3CIR_N 3P4R_B 2B76_N 1KF6_B 3P4P_N 3P4S_B 1L0V_B 1ZOY_B Back     alignment and domain information
>TIGR00384 dhsB succinate dehydrogenase and fumarate reductase iron-sulfur protein Back     alignment and domain information
>PRK13552 frdB fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK09800 putative hypoxanthine oxidase; Provisional Back     alignment and domain information
>PRK12385 fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>PLN00129 succinate dehydrogenase [ubiquinone] iron-sulfur subunit Back     alignment and domain information
>PRK08640 sdhB succinate dehydrogenase iron-sulfur subunit; Reviewed Back     alignment and domain information
>TIGR02963 xanthine_xdhA xanthine dehydrogenase, small subunit Back     alignment and domain information
>TIGR03313 Se_sel_red_Mo probable selenate reductase, molybdenum-binding subunit Back     alignment and domain information
>COG0479 FrdB Succinate dehydrogenase/fumarate reductase, Fe-S protein subunit [Energy production and conversion] Back     alignment and domain information
>PRK07570 succinate dehydrogenase/fumarate reductase iron-sulfur subunit; Validated Back     alignment and domain information
>KOG2282 consensus NADH-ubiquinone oxidoreductase, NDUFS1/75 kDa subunit [Energy production and conversion] Back     alignment and domain information
>TIGR03311 Se_dep_Molyb_1 selenium-dependent molybdenum hydroxylase 1 Back     alignment and domain information
>TIGR02969 mam_aldehyde_ox aldehyde oxidase Back     alignment and domain information
>PLN00192 aldehyde oxidase Back     alignment and domain information
>PRK12575 succinate dehydrogenase iron-sulfur subunit; Provisional Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query151
2wlb_A103 Adrenodoxin-Like Ferredoxin Etp1fd(516-618) Of Schi 2e-10
3p1m_A132 Crystal Structure Of Human Ferredoxin-1 (Fdx1) In C 5e-10
3n9z_C123 Crystal Structure Of Human Cyp11a1 In Complex With 6e-10
3n9y_C114 Crystal Structure Of Human Cyp11a1 In Complex With 7e-10
2y5c_A109 Structure Of Human Ferredoxin 2 (Fdx2)in Complex Wi 1e-09
1l6v_A128 Structure Of Reduced Bovine Adrenodoxin Length = 12 3e-09
1e6e_B128 Adrenodoxin ReductaseADRENODOXIN COMPLEX OF MITOCHO 3e-09
1cje_A127 Adrenodoxin From Bovine Length = 127 3e-09
1l6u_A128 Nmr Structure Of Oxidized Adrenodoxin Length = 128 3e-09
2jqr_B105 Solution Model Of Crosslinked Complex Of Cytochrome 3e-09
1ayf_A105 Bovine Adrenodoxin (oxidized) Length = 105 3e-09
2bt6_A108 Ru(Bpy)2(Mbpy)-Modified Bovine Adrenodoxin Length = 3e-09
3hui_A126 Crystal Structure Of The Mutant A105r Of [2fe-2s] F 7e-06
1oqq_A106 Crystal Structure Of C73sC85S MUTANT OF PUTIDAREDOX 5e-05
1put_A106 An Nmr-Derived Model For The Solution Structure Of 6e-05
3ah7_A113 Crystal Structure Of The Isc-Like [2fe-2s] Ferredox 6e-05
1oqr_A106 Crystal Structure Of C73s Mutant Of Putidaredoxin, 7e-05
1gpx_A106 C85s Gapdx, Nmr, 20 Structures Length = 106 7e-05
1r7s_A106 Putidaredoxin (Fe2s2 Ferredoxin), C73g Mutant Lengt 7e-05
1pdx_A106 Putidaredoxin Length = 106 7e-05
3na0_C68 Crystal Structure Of Human Cyp11a1 In Complex With 2e-04
1i7h_A111 Crystal Sturcuture Of Fdx Length = 111 3e-04
1e9m_A106 Ferredoxin Vi From Rhodobacter Capsulatus Length = 8e-04
>pdb|2WLB|A Chain A, Adrenodoxin-Like Ferredoxin Etp1fd(516-618) Of Schizosaccharomyces Pombe Mitochondria Length = 103 Back     alignment and structure 
Iteration: 1

 Score = 61.2 bits (147), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 31/59 (52%), Positives = 41/59 (69%)
Query: 78  INVTFVDKDGEEKNIKVPVGMSMLEAAHENDIELEGACEGSLACSTCHVIVMVHYWPYM 136
           I V FV  +G E  I+   G S+L+ AH N+I+LEGACEGS+ACSTCHVIV   ++  +
Sbjct: 4   IKVFFVTPEGREIMIEGNEGDSILDLAHANNIDLEGACEGSVACSTCHVIVDPEHYELL 62
>pdb|3P1M|A Chain A, Crystal Structure Of Human Ferredoxin-1 (Fdx1) In Complex With Iron- Sulfur Cluster Length = 132 Back     alignment and structure
>pdb|3N9Z|C Chain C, Crystal Structure Of Human Cyp11a1 In Complex With 22- Hydroxycholesterol Length = 123 Back     alignment and structure
>pdb|3N9Y|C Chain C, Crystal Structure Of Human Cyp11a1 In Complex With Cholesterol Length = 114 Back     alignment and structure
>pdb|2Y5C|A Chain A, Structure Of Human Ferredoxin 2 (Fdx2)in Complex With 2fe2s Cluster Length = 109 Back     alignment and structure
>pdb|1L6V|A Chain A, Structure Of Reduced Bovine Adrenodoxin Length = 128 Back     alignment and structure
>pdb|1E6E|B Chain B, Adrenodoxin ReductaseADRENODOXIN COMPLEX OF MITOCHONDRIAL P450 Systems Length = 128 Back     alignment and structure
>pdb|1CJE|A Chain A, Adrenodoxin From Bovine Length = 127 Back     alignment and structure
>pdb|1L6U|A Chain A, Nmr Structure Of Oxidized Adrenodoxin Length = 128 Back     alignment and structure
>pdb|2JQR|B Chain B, Solution Model Of Crosslinked Complex Of Cytochrome C And Adrenodoxin Length = 105 Back     alignment and structure
>pdb|1AYF|A Chain A, Bovine Adrenodoxin (oxidized) Length = 105 Back     alignment and structure
>pdb|2BT6|A Chain A, Ru(Bpy)2(Mbpy)-Modified Bovine Adrenodoxin Length = 108 Back     alignment and structure
>pdb|3HUI|A Chain A, Crystal Structure Of The Mutant A105r Of [2fe-2s] Ferredoxin In The Class I Cyp199a2 System From Rhodopseudomonas Palustris Length = 126 Back     alignment and structure
>pdb|1OQQ|A Chain A, Crystal Structure Of C73sC85S MUTANT OF PUTIDAREDOXIN, A [2FE-2s] Ferredoxin From Pseudomonas Putida, At 1.47a Resolution Length = 106 Back     alignment and structure
>pdb|1PUT|A Chain A, An Nmr-Derived Model For The Solution Structure Of Oxidized Putidaredoxin, A 2fe, 2-S Ferredoxin From Pseudomonas Length = 106 Back     alignment and structure
>pdb|3AH7|A Chain A, Crystal Structure Of The Isc-Like [2fe-2s] Ferredoxin (Fdxb) From Pseudomonas Putida Jcm 20004 Length = 113 Back     alignment and structure
>pdb|1OQR|A Chain A, Crystal Structure Of C73s Mutant Of Putidaredoxin, A [2fe- 2s] Ferredoxin From Pseudomonas Putida, At 1.65a Resolution Length = 106 Back     alignment and structure
>pdb|1GPX|A Chain A, C85s Gapdx, Nmr, 20 Structures Length = 106 Back     alignment and structure
>pdb|1R7S|A Chain A, Putidaredoxin (Fe2s2 Ferredoxin), C73g Mutant Length = 106 Back     alignment and structure
>pdb|1PDX|A Chain A, Putidaredoxin Length = 106 Back     alignment and structure
>pdb|3NA0|C Chain C, Crystal Structure Of Human Cyp11a1 In Complex With 20,22- Dihydroxycholesterol Length = 68 Back     alignment and structure
>pdb|1I7H|A Chain A, Crystal Sturcuture Of Fdx Length = 111 Back     alignment and structure
>pdb|1E9M|A Chain A, Ferredoxin Vi From Rhodobacter Capsulatus Length = 106 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query151
2wlb_A103 ETP1-FD, electron transfer protein 1, mitochondria 3e-27
2y5c_A109 Adrenodoxin-like protein, mitochondrial; electron 5e-27
3hui_A126 Ferredoxin; cytochrome P450, electron transfer, ir 6e-26
2bt6_A108 Adrenodoxin 1; ruthenium(II) bipyridyl complex, in 6e-25
3n9z_C123 Adrenodoxin; cytochrome P450, 22-hydroxycholestero 7e-25
3ah7_A113 [2Fe-2S]ferredoxin; [2Fe-2S] cluster, iron-sulfur 9e-25
1b9r_A105 Protein (terpredoxin); structure from molmol, ferr 1e-23
1xlq_A106 Putidaredoxin, PDX; [2Fe-2S], ferredoxin, oxidored 3e-23
1i7h_A111 Ferredoxin; 2Fe-2S,electron transport; 1.70A {Esch 1e-22
1uwm_A106 Ferredoxin VI, FDVI; electron transport, metal-bin 1e-22
3lxf_A104 Ferredoxin; iron, iron-sulfur, metal-binding, meta 3e-21
1l5p_A93 Ferredoxin; [2Fe-2S] cluster, electron transfer, i 3e-18
3zyy_X 631 Iron-sulfur cluster binding protein; iron-sulfur-b 2e-06
1jq4_A98 Methane monooxygenase component C; [2Fe-2S] ferred 5e-06
1frd_A98 Heterocyst [2Fe-2S] ferredoxin; electron transport 1e-05
1czp_A98 Ferredoxin I; [2Fe-2S] protein, crystal reduced wi 1e-05
1doi_A128 2Fe-2S ferredoxin; halophilic protein, redox prote 2e-05
1a70_A97 Ferredoxin; iron-sulfur protein, photosynthesis, e 3e-05
1frr_A95 Ferredoxin I; electron transfer(iron-sulfur protei 4e-05
1awd_A94 Ferredoxin; electron transport, eukaryotic, green 4e-05
1iue_A98 Ferredoxin; electron transport, iron-sulfur; 1.70A 1e-04
1krh_A 338 Benzoate 1,2-dioxygenase reductase; alpha-beta, FA 9e-04
>2wlb_A ETP1-FD, electron transfer protein 1, mitochondrial; iron-sulfur, iron, transport, ferredoxin, adrenodoxin-like, electron transport; 2.60A {Schizosaccharomyces pombe} Length = 103 Back     alignment and structure
 Score = 96.9 bits (242), Expect = 3e-27
 Identities = 31/53 (58%), Positives = 38/53 (71%)

Query: 76  DMINVTFVDKDGEEKNIKVPVGMSMLEAAHENDIELEGACEGSLACSTCHVIV 128
             I V FV  +G E  I+   G S+L+ AH N+I+LEGACEGS+ACSTCHVIV
Sbjct: 2   TGIKVFFVTPEGREIMIEGNEGDSILDLAHANNIDLEGACEGSVACSTCHVIV 54
>2y5c_A Adrenodoxin-like protein, mitochondrial; electron transport, iron-sulfur cluster biogenesis; 1.70A {Homo sapiens} Length = 109 Back     alignment and structure
>3hui_A Ferredoxin; cytochrome P450, electron transfer, iron, iron-sulfur, metal-binding, electron transport; 2.01A {Rhodopseudomonas palustris} Length = 126 Back     alignment and structure
>2bt6_A Adrenodoxin 1; ruthenium(II) bipyridyl complex, intramolecular electron TRA electron transport, metal-binding; HET: RUA; 1.50A {Bos taurus} SCOP: d.15.4.1 PDB: 1ayf_A 3n9y_C* 2jqr_B* 3na0_C* Length = 108 Back     alignment and structure
>3n9z_C Adrenodoxin; cytochrome P450, 22-hydroxycholesterol, cholesterol SIDE CHA cleavage, structural genomics; HET: HEM HC9; 2.17A {Homo sapiens} PDB: 3na1_C* 3p1m_A* 1l6u_A 1l6v_A 1e6e_B* 1cje_A Length = 123 Back     alignment and structure
>3ah7_A [2Fe-2S]ferredoxin; [2Fe-2S] cluster, iron-sulfur cluster biosynthes pseudomonas, metal binding protein; 1.90A {Pseudomonas putida} Length = 113 Back     alignment and structure
>1b9r_A Protein (terpredoxin); structure from molmol, ferredoxin; NMR {Pseudomonas SP} SCOP: d.15.4.1 Length = 105 Back     alignment and structure
>1xlq_A Putidaredoxin, PDX; [2Fe-2S], ferredoxin, oxidoreductase; 1.45A {Pseudomonas putida} SCOP: d.15.4.1 PDB: 1xlp_A 1oqr_A 1r7s_A 1pdx_A 1yji_A 1yjj_A 1oqq_A 1xln_A 1xlo_A 3lb8_C* 1put_A 1gpx_A Length = 106 Back     alignment and structure
>1i7h_A Ferredoxin; 2Fe-2S,electron transport; 1.70A {Escherichia coli} SCOP: d.15.4.1 Length = 111 Back     alignment and structure
>1uwm_A Ferredoxin VI, FDVI; electron transport, metal-binding, iron-sulfur, iron, 2Fe-2S; 2.0A {Rhodobacter capsulatus} SCOP: d.15.4.1 PDB: 1e9m_A Length = 106 Back     alignment and structure
>3lxf_A Ferredoxin; iron, iron-sulfur, metal-binding, metal protein; 2.30A {Novosphingobium aromaticivorans} Length = 104 Back     alignment and structure
>1l5p_A Ferredoxin; [2Fe-2S] cluster, electron transfer, iron-sulfur protein, metalloprotein, oxidoreductase; 2.20A {Trichomonas vaginalis} SCOP: d.15.4.1 Length = 93 Back     alignment and structure
>3zyy_X Iron-sulfur cluster binding protein; iron-sulfur-binding protein, ashka family, ATPase; 2.20A {Carboxydothermus hydrogenoformans} Length = 631 Back     alignment and structure
>1jq4_A Methane monooxygenase component C; [2Fe-2S] ferredoxin, oxidoreductase; NMR {Methylococcus capsulatus str} SCOP: d.15.4.2 Length = 98 Back     alignment and structure
>1frd_A Heterocyst [2Fe-2S] ferredoxin; electron transport; 1.70A {Nostoc SP} SCOP: d.15.4.1 Length = 98 Back     alignment and structure
>1czp_A Ferredoxin I; [2Fe-2S] protein, crystal reduced with dithionite, electron; 1.17A {Nostoc SP} SCOP: d.15.4.1 PDB: 1ewy_C* 1fxa_A 1qt9_A 1qog_A 1j7c_A 1j7b_A 1qof_A 1qob_A 1j7a_A 1qoa_A 1rfk_A 3p63_A 4fxc_A 3ab5_A 1roe_A 2cjn_A 2cjo_A 1off_A 1dox_A 1doy_A ... Length = 98 Back     alignment and structure
>1doi_A 2Fe-2S ferredoxin; halophilic protein, redox protein, iron-sulfur, electron transport; 1.90A {Haloarcula marismortui} SCOP: d.15.4.1 PDB: 1e0z_A* 1e10_A Length = 128 Back     alignment and structure
>1a70_A Ferredoxin; iron-sulfur protein, photosynthesis, electron transport; 1.70A {Spinacia oleracea} SCOP: d.15.4.1 PDB: 1pfd_A Length = 97 Back     alignment and structure
>1frr_A Ferredoxin I; electron transfer(iron-sulfur protein); 1.80A {Equisetum arvense} SCOP: d.15.4.1 Length = 95 Back     alignment and structure
>1awd_A Ferredoxin; electron transport, eukaryotic, green ALGA, electron transfer, metalloprotein; 1.40A {'chlorella' fusca} SCOP: d.15.4.1 Length = 94 Back     alignment and structure
>1iue_A Ferredoxin; electron transport, iron-sulfur; 1.70A {Plasmodium falciparum} SCOP: d.15.4.1 Length = 98 Back     alignment and structure
>1krh_A Benzoate 1,2-dioxygenase reductase; alpha-beta, FAD-binding, ferredoxin, NADH-binding, oxidoreductase; HET: FAD; 1.50A {Acinetobacter SP} SCOP: b.43.4.2 c.25.1.2 d.15.4.2 Length = 338 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query151
2bt6_A108 Adrenodoxin 1; ruthenium(II) bipyridyl complex, in 99.74
3hui_A126 Ferredoxin; cytochrome P450, electron transfer, ir 99.74
2y5c_A109 Adrenodoxin-like protein, mitochondrial; electron 99.72
3lxf_A104 Ferredoxin; iron, iron-sulfur, metal-binding, meta 99.69
3n9z_C123 Adrenodoxin; cytochrome P450, 22-hydroxycholestero 99.68
3ah7_A113 [2Fe-2S]ferredoxin; [2Fe-2S] cluster, iron-sulfur 99.66
1xlq_A106 Putidaredoxin, PDX; [2Fe-2S], ferredoxin, oxidored 99.66
1uwm_A106 Ferredoxin VI, FDVI; electron transport, metal-bin 99.64
2wlb_A103 ETP1-FD, electron transfer protein 1, mitochondria 99.63
1b9r_A105 Protein (terpredoxin); structure from molmol, ferr 99.61
1l5p_A93 Ferredoxin; [2Fe-2S] cluster, electron transfer, i 99.57
1i7h_A111 Ferredoxin; 2Fe-2S,electron transport; 1.70A {Esch 99.55
1jq4_A98 Methane monooxygenase component C; [2Fe-2S] ferred 99.49
1frr_A95 Ferredoxin I; electron transfer(iron-sulfur protei 99.44
1czp_A98 Ferredoxin I; [2Fe-2S] protein, crystal reduced wi 99.38
1frd_A98 Heterocyst [2Fe-2S] ferredoxin; electron transport 99.37
1awd_A94 Ferredoxin; electron transport, eukaryotic, green 99.37
1a70_A97 Ferredoxin; iron-sulfur protein, photosynthesis, e 99.35
1iue_A98 Ferredoxin; electron transport, iron-sulfur; 1.70A 99.33
1krh_A 338 Benzoate 1,2-dioxygenase reductase; alpha-beta, FA 99.32
1wri_A93 Ferredoxin II, ferredoxin; electron transport; 1.2 99.31
3zyy_X 631 Iron-sulfur cluster binding protein; iron-sulfur-b 99.16
1doi_A128 2Fe-2S ferredoxin; halophilic protein, redox prote 99.16
2pia_A321 Phthalate dioxygenase reductase; HET: FMN; 2.00A { 99.08
1t3q_A168 Quinoline 2-oxidoreductase small subunit; QOR, mol 98.51
3i9v_3 783 NADH-quinone oxidoreductase subunit 3; electron tr 98.19
3hrd_D160 Nicotinate dehydrogenase small FES subunit; seleni 98.04
1n62_A166 Carbon monoxide dehydrogenase small chain; CODH, m 97.93
1ffv_A163 CUTS, iron-sulfur protein of carbon monoxide dehyd 97.9
3c8y_A 574 Iron hydrogenase 1; dithiomethylether, H-cluster, 97.88
1rm6_C161 4-hydroxybenzoyl-COA reductase gamma subunit; xant 97.88
1kf6_B 243 Fumarate reductase iron-sulfur protein; respiratio 97.49
2bs2_B 241 Quinol-fumarate reductase iron-sulfur subunit B; 2 97.42
2wdq_B 238 Succinate dehydrogenase iron-sulfur subunit; succi 97.29
2h88_B 252 Succinate dehydrogenase IP subunit; complex II, me 97.07
1vlb_A 907 Aldehyde oxidoreductase; iron-sulphur cluster; HET 96.89
3nvw_A164 Xanthine dehydrogenase/oxidase; hydroxylase, homod 96.76
2w3s_A 462 Xanthine dehydrogenase; XO, XDH, GOUT, iron, 2Fe-2 96.67
1dgj_A 907 Aldehyde oxidoreductase; beta half-barrel, four-he 96.66
3vr8_B 282 Iron-sulfur subunit of succinate dehydrogenase; me 96.64
1y56_A 493 Hypothetical protein PH1363; dehydrogenase, protei 95.08
3unc_A 1332 Xanthine dehydrogenase/oxidase; oxidoreductase; HE 92.83
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 91.12
3u7z_A101 Putative metal binding protein rumgna_00854; the b 86.87
2l05_A95 Serine/threonine-protein kinase B-RAF; structural 86.76
3plu_A93 Ubiquitin-like modifier HUB1; ubiquitin-like, HUB- 84.73
3ny5_A96 Serine/threonine-protein kinase B-RAF; NESG, struc 83.71
3zyv_A 1335 AOH1; oxidoreductase, molybdenum cofactor; HET: MT 82.83
1wxm_A86 A-RAF proto-oncogene serine/threonine-protein kina 82.48
2al3_A90 TUG long isoform; TUG UBL1 insulin, endocytosis/ex 82.34
3kdv_A 184 DDRB, DNA damage response B protein; anti-parallel 81.92
2gow_A125 HCG-1 protein, ubiquitin-like protein 3; BC059385, 80.46
1uh6_A100 Ubiquitin-like 5; beta-grAsp fold, structural geno 80.18
>2bt6_A Adrenodoxin 1; ruthenium(II) bipyridyl complex, intramolecular electron TRA electron transport, metal-binding; HET: RUA; 1.50A {Bos taurus} SCOP: d.15.4.1 PDB: 1ayf_A 3n9y_C* 2jqr_B* 3na0_C* Back     alignment and structure
Probab=99.74  E-value=3e-18  Score=123.35  Aligned_cols=71  Identities=38%  Similarity=0.746  Sum_probs=60.7

Q ss_pred             CCCCceEEEEEcCCCCEEEEEeCCCchHHHHHHHCCCCCc--CCCCCCceecccEEEEEcC---CCCCCChhh--hhh
Q 031881           73 KQKDMINVTFVDKDGEEKNIKVPVGMSMLEAAHENDIELE--GACEGSLACSTCHVIVMVH---YWPYMCRDN--VLS  143 (151)
Q Consensus        73 ~~~~~v~Vtfi~~dG~~~tv~v~~G~sLLdaa~~~gI~l~--~aCgG~g~CgTChV~v~~~---~l~~~~~~E--~L~  143 (151)
                      ++.+|++|+|++++|..+++++++|+|||++|+++||++|  +.|+|.|+||||||+|.++   .+++++++|  +|+
T Consensus         2 ~~~~m~~V~~~~~~g~~~~v~~~~g~tLL~aa~~~gi~i~~~~~Cgg~G~CgtC~v~v~~g~~~~l~~~~~~E~~~L~   79 (108)
T 2bt6_A            2 SSGDKITVHFINRDGETLTTKGKIGDSLLDVVVQNNLDIDGFGACEGTLACSTCHLIFEQHIFEKLEAITDEENDMLD   79 (108)
T ss_dssp             ---CEEEEEEECTTSCEEEEEEETTCBHHHHHHHTTCCCTTTTTTSSSSSBSTTEEECCHHHHTTSCCCCHHHHHHHT
T ss_pred             CCCceEEEEEECCCCCEEEEEECCCChHHHHHHHcCCCCCcccCCCCCcCcCCCEEEECccccccCCCCCHHHHHHHh
Confidence            4567999999989998889999999999999999999999  9999999999999999875   566777544  555
>3hui_A Ferredoxin; cytochrome P450, electron transfer, iron, iron-sulfur, metal-binding, electron transport; 2.01A {Rhodopseudomonas palustris} Back     alignment and structure
>2y5c_A Adrenodoxin-like protein, mitochondrial; electron transport, iron-sulfur cluster biogenesis; 1.70A {Homo sapiens} Back     alignment and structure
>3lxf_A Ferredoxin; iron, iron-sulfur, metal-binding, metal protein; 2.30A {Novosphingobium aromaticivorans} SCOP: d.15.4.0 Back     alignment and structure
>3n9z_C Adrenodoxin; cytochrome P450, 22-hydroxycholesterol, cholesterol SIDE CHA cleavage, structural genomics; HET: HEM HC9; 2.17A {Homo sapiens} SCOP: d.15.4.1 PDB: 3na1_C* 3p1m_A* 1l6u_A 1l6v_A 1e6e_B* 1cje_A Back     alignment and structure
>3ah7_A [2Fe-2S]ferredoxin; [2Fe-2S] cluster, iron-sulfur cluster biosynthes pseudomonas, metal binding protein; 1.90A {Pseudomonas putida} Back     alignment and structure
>1xlq_A Putidaredoxin, PDX; [2Fe-2S], ferredoxin, oxidoreductase; 1.45A {Pseudomonas putida} SCOP: d.15.4.1 PDB: 1xlp_A 1oqr_A 1r7s_A 1pdx_A 1yji_A 1yjj_A 1oqq_A 1xln_A 1xlo_A 3lb8_C* 1put_A 1gpx_A Back     alignment and structure
>1uwm_A Ferredoxin VI, FDVI; electron transport, metal-binding, iron-sulfur, iron, 2Fe-2S; 2.0A {Rhodobacter capsulatus} SCOP: d.15.4.1 PDB: 1e9m_A Back     alignment and structure
>2wlb_A ETP1-FD, electron transfer protein 1, mitochondrial; iron-sulfur, iron, transport, ferredoxin, adrenodoxin-like, electron transport; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>1b9r_A Protein (terpredoxin); structure from molmol, ferredoxin; NMR {Pseudomonas SP} SCOP: d.15.4.1 Back     alignment and structure
>1l5p_A Ferredoxin; [2Fe-2S] cluster, electron transfer, iron-sulfur protein, metalloprotein, oxidoreductase; 2.20A {Trichomonas vaginalis} SCOP: d.15.4.1 Back     alignment and structure
>1i7h_A Ferredoxin; 2Fe-2S,electron transport; 1.70A {Escherichia coli} SCOP: d.15.4.1 Back     alignment and structure
>1jq4_A Methane monooxygenase component C; [2Fe-2S] ferredoxin, oxidoreductase; NMR {Methylococcus capsulatus str} SCOP: d.15.4.2 Back     alignment and structure
>1frr_A Ferredoxin I; electron transfer(iron-sulfur protein); 1.80A {Equisetum arvense} SCOP: d.15.4.1 Back     alignment and structure
>1czp_A Ferredoxin I; [2Fe-2S] protein, crystal reduced with dithionite, electron; 1.17A {Nostoc SP} SCOP: d.15.4.1 PDB: 1ewy_C* 1fxa_A 1qt9_A 1qog_A 1j7c_A 1j7b_A 1qof_A 1qob_A 1j7a_A 1qoa_A 1rfk_A 3p63_A 4fxc_A 3ab5_A 1roe_A 2cjn_A 2cjo_A 1off_A 1dox_A 1doy_A ... Back     alignment and structure
>1frd_A Heterocyst [2Fe-2S] ferredoxin; electron transport; 1.70A {Nostoc SP} SCOP: d.15.4.1 Back     alignment and structure
>1awd_A Ferredoxin; electron transport, eukaryotic, green ALGA, electron transfer, metalloprotein; 1.40A {'chlorella' fusca} SCOP: d.15.4.1 Back     alignment and structure
>1a70_A Ferredoxin; iron-sulfur protein, photosynthesis, electron transport; 1.70A {Spinacia oleracea} SCOP: d.15.4.1 PDB: 1pfd_A Back     alignment and structure
>1iue_A Ferredoxin; electron transport, iron-sulfur; 1.70A {Plasmodium falciparum} SCOP: d.15.4.1 Back     alignment and structure
>1krh_A Benzoate 1,2-dioxygenase reductase; alpha-beta, FAD-binding, ferredoxin, NADH-binding, oxidoreductase; HET: FAD; 1.50A {Acinetobacter SP} SCOP: b.43.4.2 c.25.1.2 d.15.4.2 Back     alignment and structure
>1wri_A Ferredoxin II, ferredoxin; electron transport; 1.20A {Equisetum arvense} SCOP: d.15.4.1 Back     alignment and structure
>3zyy_X Iron-sulfur cluster binding protein; iron-sulfur-binding protein, ashka family, ATPase; 2.20A {Carboxydothermus hydrogenoformans} Back     alignment and structure
>1doi_A 2Fe-2S ferredoxin; halophilic protein, redox protein, iron-sulfur, electron transport; 1.90A {Haloarcula marismortui} SCOP: d.15.4.1 PDB: 1e0z_A* 1e10_A Back     alignment and structure
>2pia_A Phthalate dioxygenase reductase; HET: FMN; 2.00A {Burkholderia cepacia} SCOP: b.43.4.2 c.25.1.2 d.15.4.2 Back     alignment and structure
>1t3q_A Quinoline 2-oxidoreductase small subunit; QOR, molybdenum, MCD; HET: FAD MCN; 1.80A {Pseudomonas putida} SCOP: a.56.1.1 d.15.4.2 Back     alignment and structure
>3i9v_3 NADH-quinone oxidoreductase subunit 3; electron transport, respiratory chain, cell flavoprotein, FMN, iron, iron-sulfur, membrane; HET: FMN; 3.10A {Thermus thermophilus} PDB: 2ybb_3* 2fug_3* 3iam_3* 3ias_3* 3m9s_3* Back     alignment and structure
>3hrd_D Nicotinate dehydrogenase small FES subunit; selenium ligand, iron, iron-sulfur, metal-binding, oxidoreductase; HET: MCN FAD; 2.20A {Eubacterium barkeri} Back     alignment and structure
>1n62_A Carbon monoxide dehydrogenase small chain; CODH, molybdenum, molybdopterin, oxidoreductase; HET: CUB MCN FAD; 1.09A {Oligotropha carboxidovorans} SCOP: a.56.1.1 d.15.4.2 PDB: 1n5w_A* 1n61_A* 1n60_A* 1n63_A* 1zxi_A* Back     alignment and structure
>1ffv_A CUTS, iron-sulfur protein of carbon monoxide dehydrogenase; hydrolase; HET: ARO PCD FAD; 2.25A {Hydrogenophaga pseudoflava} SCOP: a.56.1.1 d.15.4.2 PDB: 1ffu_A* Back     alignment and structure
>3c8y_A Iron hydrogenase 1; dithiomethylether, H-cluster, iron-sulfur binding, oxidoreductase; HET: HCN; 1.39A {Clostridium pasteurianum} SCOP: c.96.1.1 d.15.4.2 d.58.1.5 PDB: 1c4c_A* 1c4a_A* 1feh_A* Back     alignment and structure
>1rm6_C 4-hydroxybenzoyl-COA reductase gamma subunit; xanthine oxidase family, dimer heterotrimers, oxidoreductase; HET: PCD FAD SF4 EPE; 1.60A {Thauera aromatica} SCOP: a.56.1.1 d.15.4.2 PDB: 1sb3_C* Back     alignment and structure
>1kf6_B Fumarate reductase iron-sulfur protein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.1.2.1 d.15.4.2 PDB: 1kfy_B* 1l0v_B* 2b76_B* 3cir_B* 3p4p_B* 3p4q_B* 3p4r_B* 3p4s_B* Back     alignment and structure
>2bs2_B Quinol-fumarate reductase iron-sulfur subunit B; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.1.2.1 d.15.4.2 PDB: 2bs3_B* 1e7p_B* 1qlb_B* 2bs4_B* Back     alignment and structure
>2wdq_B Succinate dehydrogenase iron-sulfur subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_B* 2acz_B* 1nek_B* 2wdr_B* 2wdv_B* 2ws3_B* 2wu2_B* 2wu5_B* 2wp9_B* Back     alignment and structure
>2h88_B Succinate dehydrogenase IP subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_B* 1yq3_B* 2fbw_B* 2h89_B* 2wqy_B* 3aef_B* 3abv_B* 3ae1_B* 3ae3_B* 3ae2_B* 3ae5_B* 3ae6_B* 3ae7_B* 3ae8_B* 3ae9_B* 3aea_B* 3aeb_B* 3aec_B* 3aed_B* 3aee_B* ... Back     alignment and structure
>1vlb_A Aldehyde oxidoreductase; iron-sulphur cluster; HET: PCD; 1.28A {Desulfovibrio gigas} SCOP: a.56.1.1 d.15.4.2 d.41.1.1 d.133.1.1 PDB: 1sij_A* 1zcs_A* 3fah_A* 3fc4_A* 3l4p_A* Back     alignment and structure
>3nvw_A Xanthine dehydrogenase/oxidase; hydroxylase, homodimer, xanthine oxidase, guanine, oxidoredu; HET: FAD MTE GUN; 1.60A {Bos taurus} PDB: 3etr_A* 3ns1_A* 3nvv_A* 3nrz_A* 3nvy_A* 3nvz_A* 3rca_A* 3sr6_A* 3eub_A* Back     alignment and structure
>2w3s_A Xanthine dehydrogenase; XO, XDH, GOUT, iron, 2Fe-2S, iron-sulfur, oxidoreductase, purine metabolism, molybdenum cofactor, hypoxanthine; HET: MPN FAD XAN; 2.60A {Rhodobacter capsulatus} PDB: 2w3r_A* 2w54_A* 2w55_A* 1jro_A* 1jrp_A* Back     alignment and structure
>1dgj_A Aldehyde oxidoreductase; beta half-barrel, four-helix bundle, beta barrel; HET: MCN; 2.80A {Desulfovibrio desulfuricans} SCOP: a.56.1.1 d.15.4.2 d.41.1.1 d.133.1.1 Back     alignment and structure
>3vr8_B Iron-sulfur subunit of succinate dehydrogenase; membrane protein, reductase, mitochondria MEMB oxidoreductase; HET: FAD HEM RQX EPH; 2.81A {Ascaris suum} PDB: 3vrb_B* Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>3unc_A Xanthine dehydrogenase/oxidase; oxidoreductase; HET: MTE FAD SAL; 1.65A {Bos taurus} PDB: 3una_A* 3uni_A* 1v97_A* 1fo4_A* 1vdv_A* 3am9_A* 3amz_A* 3ax7_A* 3ax9_A* 3bdj_A* 1n5x_A* 2ckj_A* 2e1q_A* 3an1_A* 2e3t_A* 1wyg_A* 3b9j_B* 1fiq_B* 3b9j_A* 1fiq_A* Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>3u7z_A Putative metal binding protein rumgna_00854; the binding protein, transport protein, structural genomics, center for structural genomics; 1.30A {Ruminococcus gnavus} Back     alignment and structure
>2l05_A Serine/threonine-protein kinase B-RAF; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3plu_A Ubiquitin-like modifier HUB1; ubiquitin-like, HUB-1, SNU66, peptide binding protein; 1.40A {Saccharomyces cerevisiae} PDB: 3plv_A 1m94_A 1p0r_A Back     alignment and structure
>3ny5_A Serine/threonine-protein kinase B-RAF; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics consortium; HET: MSE; 1.99A {Homo sapiens} SCOP: d.15.1.0 Back     alignment and structure
>3zyv_A AOH1; oxidoreductase, molybdenum cofactor; HET: MTE FAD; 2.54A {Mus musculus} Back     alignment and structure
>1wxm_A A-RAF proto-oncogene serine/threonine-protein kinase; RAS-binding domain (RBD), ubiquitin-like fold, A-RAF kinase, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.5 Back     alignment and structure
>2al3_A TUG long isoform; TUG UBL1 insulin, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: d.15.1.2 Back     alignment and structure
>2gow_A HCG-1 protein, ubiquitin-like protein 3; BC059385, structural genomics, protein structure initiative, PSI; NMR {Homo sapiens} Back     alignment and structure
>1uh6_A Ubiquitin-like 5; beta-grAsp fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 151
d2bt6a1104 d.15.4.1 (A:5-108) Adrenodoxin {Cow (Bos taurus) [ 4e-15
d1b9ra_105 d.15.4.1 (A:) 2Fe-2S ferredoxin {Pseudomonas sp., 6e-14
d1l5pa_93 d.15.4.1 (A:) 2Fe-2S ferredoxin {Trichomonas vagin 2e-12
d1xlqa1106 d.15.4.1 (A:1-106) 2Fe-2S ferredoxin {Pseudomonas 4e-12
d1e9ma_106 d.15.4.1 (A:) 2Fe-2S ferredoxin {Rhodobacter capsu 2e-11
d1i7ha_109 d.15.4.1 (A:) Adrenodoxin-like ferredoxin {Escheri 3e-09
d1jq4a_98 d.15.4.2 (A:) Methane monooxygenase reductase N-te 3e-08
d1krha3104 d.15.4.2 (A:2-105) Benzoate dioxygenase reductase, 5e-08
d1frda_98 d.15.4.1 (A:) 2Fe-2S ferredoxin {Cyanobacterium (A 1e-06
d1czpa_98 d.15.4.1 (A:) 2Fe-2S ferredoxin {Cyanobacterium (A 2e-06
d1doia_128 d.15.4.1 (A:) 2Fe-2S ferredoxin {Archaeon Haloarcu 4e-06
d1frra_95 d.15.4.1 (A:) 2Fe-2S ferredoxin {Equisetum arvense 5e-06
d1a70a_97 d.15.4.1 (A:) 2Fe-2S ferredoxin {Spinach (Spinacia 4e-05
d2fug3395 d.15.4.2 (3:1-95) Nadh-quinone oxidoreductase chai 0.001
>d2bt6a1 d.15.4.1 (A:5-108) Adrenodoxin {Cow (Bos taurus) [TaxId: 9913]} Length = 104 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-Grasp (ubiquitin-like)
superfamily: 2Fe-2S ferredoxin-like
family: 2Fe-2S ferredoxin-related
domain: Adrenodoxin
species: Cow (Bos taurus) [TaxId: 9913]

 Score = 64.6 bits (157), Expect = 4e-15
 Identities = 26/67 (38%), Positives = 42/67 (62%), Gaps = 2/67 (2%)

Query: 76  DMINVTFVDKDGEEKNIKVPVGMSMLEAAHENDIELEG--ACEGSLACSTCHVIVMVHYW 133
           D I V F+++DGE    K  +G S+L+   +N+++++G  ACEG+LACSTCH+I   H +
Sbjct: 1   DKITVHFINRDGETLTTKGKIGDSLLDVVVQNNLDIDGFGACEGTLACSTCHLIFEQHIF 60

Query: 134 PYMCRDN 140
             +    
Sbjct: 61  EKLEAIT 67
>d1b9ra_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Pseudomonas sp., terpredoxin [TaxId: 306]} Length = 105 Back     information, alignment and structure
>d1l5pa_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Trichomonas vaginalis [TaxId: 5722]} Length = 93 Back     information, alignment and structure
>d1xlqa1 d.15.4.1 (A:1-106) 2Fe-2S ferredoxin {Pseudomonas putida, putidaredoxin [TaxId: 303]} Length = 106 Back     information, alignment and structure
>d1e9ma_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Rhodobacter capsulatus, ferredoxin VI [TaxId: 1061]} Length = 106 Back     information, alignment and structure
>d1i7ha_ d.15.4.1 (A:) Adrenodoxin-like ferredoxin {Escherichia coli [TaxId: 562]} Length = 109 Back     information, alignment and structure
>d1jq4a_ d.15.4.2 (A:) Methane monooxygenase reductase N-terminal domain {Methylococcus capsulatus [TaxId: 414]} Length = 98 Back     information, alignment and structure
>d1krha3 d.15.4.2 (A:2-105) Benzoate dioxygenase reductase, N-terminal domain {Acinetobacter sp. [TaxId: 472]} Length = 104 Back     information, alignment and structure
>d1frda_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), pcc 7119 and 7120 [TaxId: 1167]} Length = 98 Back     information, alignment and structure
>d1czpa_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), pcc 7119 and 7120 [TaxId: 1167]} Length = 98 Back     information, alignment and structure
>d1doia_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Archaeon Haloarcula marismortui [TaxId: 2238]} Length = 128 Back     information, alignment and structure
>d1frra_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258]} Length = 95 Back     information, alignment and structure
>d1a70a_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Spinach (Spinacia oleracea) [TaxId: 3562]} Length = 97 Back     information, alignment and structure
>d2fug33 d.15.4.2 (3:1-95) Nadh-quinone oxidoreductase chain 3, Nqo3, N-terminal domain {Thermus thermophilus [TaxId: 274]} Length = 95 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query151
d1e9ma_106 2Fe-2S ferredoxin {Rhodobacter capsulatus, ferredo 99.74
d1xlqa1106 2Fe-2S ferredoxin {Pseudomonas putida, putidaredox 99.73
d2bt6a1104 Adrenodoxin {Cow (Bos taurus) [TaxId: 9913]} 99.72
d1l5pa_93 2Fe-2S ferredoxin {Trichomonas vaginalis [TaxId: 5 99.71
d1b9ra_105 2Fe-2S ferredoxin {Pseudomonas sp., terpredoxin [T 99.71
d1jq4a_98 Methane monooxygenase reductase N-terminal domain 99.57
d1i7ha_109 Adrenodoxin-like ferredoxin {Escherichia coli [Tax 99.57
d1krha3104 Benzoate dioxygenase reductase, N-terminal domain 99.5
d1czpa_98 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), 99.48
d1a70a_97 2Fe-2S ferredoxin {Spinach (Spinacia oleracea) [Ta 99.48
d1frra_95 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258] 99.47
d1awda_94 2Fe-2S ferredoxin {Chlorella fusca [TaxId: 3073]} 99.47
d1iuea_98 2Fe-2S ferredoxin {Malaria parasite (Plasmodium fa 99.45
d1frda_98 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), 99.44
d2piaa398 Phthalate dioxygenase reductase, C-terminal domain 99.41
d2fug3395 Nadh-quinone oxidoreductase chain 3, Nqo3, N-termi 99.39
d1wria_93 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258] 99.29
d1doia_128 2Fe-2S ferredoxin {Archaeon Haloarcula marismortui 99.14
d3c8ya2126 Fe-only hydrogenase, N-terminal domain {Clostridiu 98.6
d1t3qa281 Quinoline 2-oxidoreductase small subunit QorS, N-d 98.37
d1vlba280 Aldehyde oxidoreductase, N-terminal domain {Desulf 98.27
d1dgja280 Aldehyde oxidoreductase, N-terminal domain {Desulf 98.03
d1rm6c281 4-hydroxybenzoyl-CoA reductase gamma subunit HrcC, 97.93
d1n62a279 Carbone monoxide (CO) dehydrogenase iron-sulfur pr 97.89
d1ffva279 Carbone monoxide (CO) dehydrogenase iron-sulfur pr 97.82
d1jroa284 Xanthine dehydrogenase chain A, N-terminal domain 97.75
d1v97a290 Xanthine oxidase, N-terminal domain {Cow (Bos taur 97.34
d1kf6b2105 Fumarate reductase iron-sulfur protein, N-terminal 97.01
d2bs2b2106 Fumarate reductase iron-sulfur protein, N-terminal 96.65
d1nekb2106 Succinate dehydogenase iron-sulfur protein, N-term 93.74
d2al3a176 Tether containing UBX domain for GLUT4 (Tug) {Mous 88.02
d1tkea162 Threonyl-tRNA synthetase (ThrRS), N-terminal 'addi 86.03
d1v2ya_105 Ubiquitin-like protein 3300001g02rik {Mouse (Mus m 84.57
d1ep3b2160 Dihydroorotate dehydrogenase B, PyrK subunit {Lact 84.37
d1m94a_73 Ubiquitin-like modifier protein hub1 {Baker's yeas 83.78
d1z2ma276 Interferon-induced 15 kDa protein {Human (Homo sap 80.59
>d1e9ma_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Rhodobacter capsulatus, ferredoxin VI [TaxId: 1061]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-Grasp (ubiquitin-like)
superfamily: 2Fe-2S ferredoxin-like
family: 2Fe-2S ferredoxin-related
domain: 2Fe-2S ferredoxin
species: Rhodobacter capsulatus, ferredoxin VI [TaxId: 1061]

Probab=99.74  E-value=2.3e-18  Score=122.94  Aligned_cols=62  Identities=27%  Similarity=0.641  Sum_probs=56.9

Q ss_pred             EEEEEcCCCCEEEEEeCCCchHHHHHHHCCCC-CcCCCCCCceecccEEEEEcC---CCCCCChhh
Q 031881           79 NVTFVDKDGEEKNIKVPVGMSMLEAAHENDIE-LEGACEGSLACSTCHVIVMVH---YWPYMCRDN  140 (151)
Q Consensus        79 ~Vtfi~~dG~~~tv~v~~G~sLLdaa~~~gI~-l~~aCgG~g~CgTChV~v~~~---~l~~~~~~E  140 (151)
                      ||||+++||++++|++++|+|||++|+++||+ +++.|||.|.|+||||+|.++   .+++++++|
T Consensus         2 KIt~i~~dG~~~~i~~~~G~tLl~a~~~~gi~~i~~~CgG~g~C~tC~V~i~~g~~~~l~~~~~~E   67 (106)
T d1e9ma_           2 KIIFIEHNGTRHEVEAKPGLTVMEAARDNGVPGIDADCGGACACSTCHAYVDPAWVDKLPKALPTE   67 (106)
T ss_dssp             EEEEECTTSCEEEEECCTTSBHHHHHHTTTCTTCCCTTSSSSSSCTTEEEECHHHHTTSCCCCHHH
T ss_pred             EEEEECCCCCEEEEEECCCChHHHHHHHcCCCCcCcccccCceecceEEEeccCccccCCCCCHHH
Confidence            79999999999999999999999999999996 999999999999999999874   577777755
>d1xlqa1 d.15.4.1 (A:1-106) 2Fe-2S ferredoxin {Pseudomonas putida, putidaredoxin [TaxId: 303]} Back     information, alignment and structure
>d2bt6a1 d.15.4.1 (A:5-108) Adrenodoxin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1l5pa_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Trichomonas vaginalis [TaxId: 5722]} Back     information, alignment and structure
>d1b9ra_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Pseudomonas sp., terpredoxin [TaxId: 306]} Back     information, alignment and structure
>d1jq4a_ d.15.4.2 (A:) Methane monooxygenase reductase N-terminal domain {Methylococcus capsulatus [TaxId: 414]} Back     information, alignment and structure
>d1i7ha_ d.15.4.1 (A:) Adrenodoxin-like ferredoxin {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1krha3 d.15.4.2 (A:2-105) Benzoate dioxygenase reductase, N-terminal domain {Acinetobacter sp. [TaxId: 472]} Back     information, alignment and structure
>d1czpa_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), pcc 7119 and 7120 [TaxId: 1167]} Back     information, alignment and structure
>d1a70a_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1frra_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258]} Back     information, alignment and structure
>d1awda_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Chlorella fusca [TaxId: 3073]} Back     information, alignment and structure
>d1iuea_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1frda_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), pcc 7119 and 7120 [TaxId: 1167]} Back     information, alignment and structure
>d2piaa3 d.15.4.2 (A:224-321) Phthalate dioxygenase reductase, C-terminal domain {Pseudomonas cepacia, db01 [TaxId: 292]} Back     information, alignment and structure
>d2fug33 d.15.4.2 (3:1-95) Nadh-quinone oxidoreductase chain 3, Nqo3, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wria_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258]} Back     information, alignment and structure
>d1doia_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d3c8ya2 d.15.4.2 (A:1-126) Fe-only hydrogenase, N-terminal domain {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1t3qa2 d.15.4.2 (A:7-87) Quinoline 2-oxidoreductase small subunit QorS, N-domain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1vlba2 d.15.4.2 (A:1-80) Aldehyde oxidoreductase, N-terminal domain {Desulfovibrio gigas [TaxId: 879]} Back     information, alignment and structure
>d1dgja2 d.15.4.2 (A:1-80) Aldehyde oxidoreductase, N-terminal domain {Desulfovibrio desulfuricans [TaxId: 876]} Back     information, alignment and structure
>d1rm6c2 d.15.4.2 (C:1-81) 4-hydroxybenzoyl-CoA reductase gamma subunit HrcC, N-terminal domain {Thauera aromatica [TaxId: 59405]} Back     information, alignment and structure
>d1n62a2 d.15.4.2 (A:3-81) Carbone monoxide (CO) dehydrogenase iron-sulfur protein, N-domain {Oligotropha carboxidovorans, formerly Pseudomonas carboxydovorans [TaxId: 40137]} Back     information, alignment and structure
>d1ffva2 d.15.4.2 (A:3-81) Carbone monoxide (CO) dehydrogenase iron-sulfur protein, N-domain {Hydrogenophaga pseudoflava [TaxId: 47421]} Back     information, alignment and structure
>d1jroa2 d.15.4.2 (A:1-84) Xanthine dehydrogenase chain A, N-terminal domain {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1v97a2 d.15.4.2 (A:3-92) Xanthine oxidase, N-terminal domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kf6b2 d.15.4.2 (B:1-105) Fumarate reductase iron-sulfur protein, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bs2b2 d.15.4.2 (B:1-106) Fumarate reductase iron-sulfur protein, N-terminal domain {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1nekb2 d.15.4.2 (B:1-106) Succinate dehydogenase iron-sulfur protein, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2al3a1 d.15.1.2 (A:10-85) Tether containing UBX domain for GLUT4 (Tug) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tkea1 d.15.10.1 (A:1-62) Threonyl-tRNA synthetase (ThrRS), N-terminal 'additional' domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v2ya_ d.15.1.1 (A:) Ubiquitin-like protein 3300001g02rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ep3b2 c.25.1.3 (B:103-262) Dihydroorotate dehydrogenase B, PyrK subunit {Lactococcus lactis, isozyme B [TaxId: 1358]} Back     information, alignment and structure
>d1m94a_ d.15.1.1 (A:) Ubiquitin-like modifier protein hub1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z2ma2 d.15.1.1 (A:79-154) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure