Citrus Sinensis ID: 031987
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 149 | ||||||
| 225459908 | 139 | PREDICTED: uncharacterized protein LOC10 | 0.744 | 0.798 | 0.698 | 3e-40 | |
| 297734729 | 117 | unnamed protein product [Vitis vinifera] | 0.724 | 0.923 | 0.699 | 7e-39 | |
| 255574534 | 159 | conserved hypothetical protein [Ricinus | 0.624 | 0.584 | 0.827 | 6e-38 | |
| 356530967 | 130 | PREDICTED: uncharacterized protein LOC10 | 0.671 | 0.769 | 0.72 | 3e-34 | |
| 326494464 | 135 | predicted protein [Hordeum vulgare subsp | 0.765 | 0.844 | 0.569 | 6e-34 | |
| 357163733 | 135 | PREDICTED: uncharacterized protein LOC10 | 0.758 | 0.837 | 0.598 | 6e-33 | |
| 255557833 | 106 | conserved hypothetical protein [Ricinus | 0.711 | 1.0 | 0.650 | 6e-33 | |
| 351722508 | 142 | uncharacterized protein LOC100499968 [Gl | 0.805 | 0.845 | 0.569 | 7e-33 | |
| 116778702 | 169 | unknown [Picea sitchensis] gi|224284992| | 0.617 | 0.544 | 0.706 | 7e-33 | |
| 21553516 | 136 | unknown [Arabidopsis thaliana] | 0.838 | 0.919 | 0.544 | 1e-32 |
| >gi|225459908|ref|XP_002263897.1| PREDICTED: uncharacterized protein LOC100256915 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 169 bits (428), Expect = 3e-40, Method: Compositional matrix adjust.
Identities = 81/116 (69%), Positives = 90/116 (77%), Gaps = 5/116 (4%)
Query: 34 TPRVSKSKPVMASTTTTTAATAEIFGVKIEKNPPQSKLSELGVTSWPKWGCPPSKFPWTF 93
T ++K P AST A EIFGVKI +NPPQ+ L++LGVTSW KWGC PSKFPWTF
Sbjct: 29 TSNMTKPNPQEAST-----AIIEIFGVKIHRNPPQATLTDLGVTSWKKWGCSPSKFPWTF 83
Query: 94 TATETMYLLEGKVIVYVDGREGSFEIGTGDLVVFPKGMKITWDVIEAVNKHYSLEK 149
A ETMYLLEGKV VY DG +G FEIG GDLV FPKGMK+TWDV EA+NKHYSLEK
Sbjct: 84 EAKETMYLLEGKVKVYCDGHDGFFEIGAGDLVEFPKGMKVTWDVTEALNKHYSLEK 139
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|297734729|emb|CBI16963.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255574534|ref|XP_002528178.1| conserved hypothetical protein [Ricinus communis] gi|223532390|gb|EEF34185.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|356530967|ref|XP_003534050.1| PREDICTED: uncharacterized protein LOC100807654 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|326494464|dbj|BAJ90501.1| predicted protein [Hordeum vulgare subsp. vulgare] | Back alignment and taxonomy information |
|---|
| >gi|357163733|ref|XP_003579828.1| PREDICTED: uncharacterized protein LOC100825165 [Brachypodium distachyon] | Back alignment and taxonomy information |
|---|
| >gi|255557833|ref|XP_002519946.1| conserved hypothetical protein [Ricinus communis] gi|223540992|gb|EEF42550.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|351722508|ref|NP_001234944.1| uncharacterized protein LOC100499968 [Glycine max] gi|255628091|gb|ACU14390.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|116778702|gb|ABK20966.1| unknown [Picea sitchensis] gi|224284992|gb|ACN40225.1| unknown [Picea sitchensis] | Back alignment and taxonomy information |
|---|
| >gi|21553516|gb|AAM62609.1| unknown [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 149 | ||||||
| TAIR|locus:2122734 | 134 | AT4G10300 "AT4G10300" [Arabido | 0.624 | 0.694 | 0.666 | 6e-32 | |
| TAIR|locus:2122809 | 140 | AT4G10280 "AT4G10280" [Arabido | 0.731 | 0.778 | 0.535 | 3.5e-27 | |
| UNIPROTKB|Q60B25 | 91 | MCA0659 "Putative uncharacteri | 0.577 | 0.945 | 0.551 | 1.3e-22 | |
| TAIR|locus:2103095 | 96 | AT3G04300 "AT3G04300" [Arabido | 0.597 | 0.927 | 0.494 | 1e-20 | |
| TAIR|locus:2122819 | 120 | AT4G10290 "AT4G10290" [Arabido | 0.624 | 0.775 | 0.520 | 1.2e-19 | |
| TAIR|locus:505006531 | 107 | AT4G28703 "AT4G28703" [Arabido | 0.563 | 0.785 | 0.473 | 5.8e-18 | |
| TAIR|locus:2045532 | 139 | PTAC18 "AT2G32180" [Arabidopsi | 0.516 | 0.553 | 0.337 | 5.2e-10 | |
| TAIR|locus:2046412 | 139 | AT2G32650 "AT2G32650" [Arabido | 0.516 | 0.553 | 0.337 | 5.2e-10 | |
| UNIPROTKB|Q720P1 | 147 | LMOf2365_1197 "Putative unchar | 0.315 | 0.319 | 0.367 | 0.00035 | |
| UNIPROTKB|Q88BC6 | 121 | PSPTO_0091 "Uncharacterized pr | 0.489 | 0.603 | 0.324 | 0.00035 |
| TAIR|locus:2122734 AT4G10300 "AT4G10300" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 350 (128.3 bits), Expect = 6.0e-32, P = 6.0e-32
Identities = 62/93 (66%), Positives = 72/93 (77%)
Query: 56 EIFGVKIEKNPPQSKLSELGVTSWPKWGCPPSKFPWTFTATETMYLLEGKVIVYVDGREG 115
E G+ IEKNPP+SKL++LGV SWPKWGCPPSKFPWT++A ET YLL+GKV VY +G +
Sbjct: 42 EKLGITIEKNPPESKLTQLGVRSWPKWGCPPSKFPWTYSAKETCYLLQGKVKVYPNGSDE 101
Query: 116 SFEIGTGDLVVFPKGMKITWDVIEAVNKHYSLE 148
EI GD VVFPKGM TWDV AV+KHY E
Sbjct: 102 GVEIEAGDFVVFPKGMSCTWDVSVAVDKHYQFE 134
|
|
| TAIR|locus:2122809 AT4G10280 "AT4G10280" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q60B25 MCA0659 "Putative uncharacterized protein" [Methylococcus capsulatus str. Bath (taxid:243233)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2103095 AT3G04300 "AT3G04300" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2122819 AT4G10290 "AT4G10290" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:505006531 AT4G28703 "AT4G28703" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2045532 PTAC18 "AT2G32180" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2046412 AT2G32650 "AT2G32650" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q720P1 LMOf2365_1197 "Putative uncharacterized protein" [Listeria monocytogenes serotype 4b str. F2365 (taxid:265669)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q88BC6 PSPTO_0091 "Uncharacterized protein" [Pseudomonas syringae pv. tomato str. DC3000 (taxid:223283)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 149 | |||
| pfam05899 | 74 | pfam05899, Cupin_3, Protein of unknown function (D | 7e-28 | |
| COG3450 | 116 | COG3450, COG3450, Predicted enzyme of the cupin su | 3e-18 | |
| COG4766 | 176 | COG4766, EutQ, Ethanolamine utilization protein [A | 2e-06 | |
| pfam06249 | 152 | pfam06249, EutQ, Ethanolamine utilisation protein | 5e-05 | |
| pfam07883 | 70 | pfam07883, Cupin_2, Cupin domain | 6e-05 | |
| COG0662 | 127 | COG0662, {ManC}, Mannose-6-phosphate isomerase [Ca | 0.002 |
| >gnl|CDD|147835 pfam05899, Cupin_3, Protein of unknown function (DUF861) | Back alignment and domain information |
|---|
Score = 98.1 bits (245), Expect = 7e-28
Identities = 37/75 (49%), Positives = 45/75 (60%), Gaps = 1/75 (1%)
Query: 71 LSELGVTSWPKWGCPPSKFPWTFTATETMYLLEGKVIVYVDGREGSFEIGTGDLVVFPKG 130
L GV SW W C P KF WT+ E Y+L G+V V +G E + E+ GDLVVFP G
Sbjct: 1 LGPDGVFSWGIWECTPGKFRWTYEEDEFCYILSGEVTVTPEGGE-TVELRAGDLVVFPAG 59
Query: 131 MKITWDVIEAVNKHY 145
TW+V+E V KHY
Sbjct: 60 FTGTWEVLETVRKHY 74
|
This family consists of several proteins which seem to be specific to plants and bacteria. The function of this family is unknown. Length = 74 |
| >gnl|CDD|225981 COG3450, COG3450, Predicted enzyme of the cupin superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|227107 COG4766, EutQ, Ethanolamine utilization protein [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|114941 pfam06249, EutQ, Ethanolamine utilisation protein EutQ | Back alignment and domain information |
|---|
| >gnl|CDD|219618 pfam07883, Cupin_2, Cupin domain | Back alignment and domain information |
|---|
| >gnl|CDD|223734 COG0662, {ManC}, Mannose-6-phosphate isomerase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 149 | |||
| COG3450 | 116 | Predicted enzyme of the cupin superfamily [General | 99.94 | |
| PF05899 | 74 | Cupin_3: Protein of unknown function (DUF861); Int | 99.9 | |
| PF06249 | 152 | EutQ: Ethanolamine utilisation protein EutQ; Inter | 99.5 | |
| PRK15457 | 233 | ethanolamine utilization protein EutQ; Provisional | 99.34 | |
| COG4766 | 176 | EutQ Ethanolamine utilization protein [Amino acid | 99.31 | |
| PF07883 | 71 | Cupin_2: Cupin domain; InterPro: IPR013096 This fa | 98.95 | |
| COG3837 | 161 | Uncharacterized conserved protein, contains double | 98.95 | |
| COG0662 | 127 | {ManC} Mannose-6-phosphate isomerase [Carbohydrate | 98.86 | |
| PRK13290 | 125 | ectC L-ectoine synthase; Reviewed | 98.81 | |
| PRK09943 | 185 | DNA-binding transcriptional repressor PuuR; Provis | 98.65 | |
| COG1917 | 131 | Uncharacterized conserved protein, contains double | 98.53 | |
| PRK13264 | 177 | 3-hydroxyanthranilate 3,4-dioxygenase; Provisional | 98.47 | |
| TIGR03037 | 159 | anthran_nbaC 3-hydroxyanthranilate 3,4-dioxygenase | 98.41 | |
| PF00190 | 144 | Cupin_1: Cupin; InterPro: IPR006045 This family re | 98.39 | |
| PF02311 | 136 | AraC_binding: AraC-like ligand binding domain; Int | 98.38 | |
| TIGR03404 | 367 | bicupin_oxalic bicupin, oxalate decarboxylase fami | 98.38 | |
| smart00835 | 146 | Cupin_1 Cupin. This family represents the conserve | 98.36 | |
| TIGR01479 | 468 | GMP_PMI mannose-1-phosphate guanylyltransferase/ma | 98.35 | |
| PRK11171 | 266 | hypothetical protein; Provisional | 98.34 | |
| PRK11171 | 266 | hypothetical protein; Provisional | 98.33 | |
| TIGR03214 | 260 | ura-cupin putative allantoin catabolism protein. T | 98.31 | |
| PRK15460 | 478 | cpsB mannose-1-phosphate guanyltransferase; Provis | 98.24 | |
| TIGR03404 | 367 | bicupin_oxalic bicupin, oxalate decarboxylase fami | 98.19 | |
| TIGR03214 | 260 | ura-cupin putative allantoin catabolism protein. T | 98.08 | |
| PRK04190 | 191 | glucose-6-phosphate isomerase; Provisional | 98.03 | |
| PF01050 | 151 | MannoseP_isomer: Mannose-6-phosphate isomerase; In | 97.9 | |
| COG4297 | 163 | Uncharacterized protein containing double-stranded | 97.71 | |
| PF06865 | 94 | DUF1255: Protein of unknown function (DUF1255); In | 97.65 | |
| PRK13500 | 312 | transcriptional activator RhaR; Provisional | 97.6 | |
| PF03079 | 157 | ARD: ARD/ARD' family; InterPro: IPR004313 The two | 97.59 | |
| PRK10296 | 278 | DNA-binding transcriptional regulator ChbR; Provis | 97.58 | |
| PRK10579 | 94 | hypothetical protein; Provisional | 97.57 | |
| PRK13501 | 290 | transcriptional activator RhaR; Provisional | 97.56 | |
| PLN00212 | 493 | glutelin; Provisional | 97.55 | |
| PRK10371 | 302 | DNA-binding transcriptional regulator MelR; Provis | 97.53 | |
| PRK13502 | 282 | transcriptional activator RhaR; Provisional | 97.52 | |
| PRK13503 | 278 | transcriptional activator RhaS; Provisional | 97.38 | |
| TIGR02297 | 287 | HpaA 4-hydroxyphenylacetate catabolism regulatory | 97.36 | |
| COG3257 | 264 | GlxB Uncharacterized protein, possibly involved in | 97.33 | |
| COG2140 | 209 | Thermophilic glucose-6-phosphate isomerase and rel | 97.27 | |
| PF11699 | 85 | CENP-C_C: Mif2/CENP-C like; PDB: 2VPV_B. | 97.26 | |
| PF12852 | 186 | Cupin_6: Cupin | 97.13 | |
| COG4101 | 142 | Predicted mannose-6-phosphate isomerase [Carbohydr | 97.07 | |
| PF12973 | 91 | Cupin_7: ChrR Cupin-like domain; PDB: 3O14_B 2Z2S_ | 96.99 | |
| PF04209 | 424 | HgmA: homogentisate 1,2-dioxygenase; InterPro: IPR | 96.95 | |
| PRK05341 | 438 | homogentisate 1,2-dioxygenase; Provisional | 96.84 | |
| PF06052 | 151 | 3-HAO: 3-hydroxyanthranilic acid dioxygenase; Inte | 96.81 | |
| TIGR02272 | 335 | gentisate_1_2 gentisate 1,2-dioxygenase. This fami | 96.77 | |
| TIGR01015 | 429 | hmgA homogentisate 1,2-dioxygenase. Missing in hum | 96.75 | |
| PLN02658 | 435 | homogentisate 1,2-dioxygenase | 96.56 | |
| KOG2107 | 179 | consensus Uncharacterized conserved protein, conta | 96.46 | |
| COG3123 | 94 | Uncharacterized protein conserved in bacteria [Fun | 96.38 | |
| PLN00212 | 493 | glutelin; Provisional | 96.17 | |
| PRK10572 | 290 | DNA-binding transcriptional regulator AraC; Provis | 96.17 | |
| COG1791 | 181 | Uncharacterized conserved protein, contains double | 96.06 | |
| PF06560 | 182 | GPI: Glucose-6-phosphate isomerase (GPI); InterPro | 96.03 | |
| PF06339 | 126 | Ectoine_synth: Ectoine synthase; InterPro: IPR0104 | 95.85 | |
| PF02041 | 167 | Auxin_BP: Auxin binding protein; InterPro: IPR0005 | 95.76 | |
| TIGR02451 | 215 | anti_sig_ChrR anti-sigma factor, putative, ChrR fa | 95.61 | |
| COG3508 | 427 | HmgA Homogentisate 1,2-dioxygenase [Secondary meta | 95.33 | |
| PRK09685 | 302 | DNA-binding transcriptional activator FeaR; Provis | 95.31 | |
| TIGR00218 | 302 | manA mannose-6-phosphate isomerase, class I. The n | 95.17 | |
| PF05523 | 131 | FdtA: WxcM-like, C-terminal ; InterPro: IPR008894 | 95.1 | |
| PF14525 | 172 | AraC_binding_2: AraC-binding-like domain | 94.71 | |
| TIGR02272 | 335 | gentisate_1_2 gentisate 1,2-dioxygenase. This fami | 94.55 | |
| PRK00924 | 276 | 5-keto-4-deoxyuronate isomerase; Provisional | 94.54 | |
| PRK15131 | 389 | mannose-6-phosphate isomerase; Provisional | 94.52 | |
| PF04962 | 261 | KduI: KduI/IolB family; InterPro: IPR021120 The Kd | 93.74 | |
| PF08007 | 319 | Cupin_4: Cupin superfamily protein; InterPro: IPR0 | 93.62 | |
| PF11142 | 63 | DUF2917: Protein of unknown function (DUF2917); In | 93.61 | |
| KOG2757 | 411 | consensus Mannose-6-phosphate isomerase [Carbohydr | 93.13 | |
| PLN02288 | 394 | mannose-6-phosphate isomerase | 93.08 | |
| COG1482 | 312 | ManA Phosphomannose isomerase [Carbohydrate transp | 91.78 | |
| COG3435 | 351 | Gentisate 1,2-dioxygenase [Secondary metabolites b | 91.28 | |
| COG3435 | 351 | Gentisate 1,2-dioxygenase [Secondary metabolites b | 91.1 | |
| PF13621 | 251 | Cupin_8: Cupin-like domain; PDB: 3AL6_C 3AL5_C 2XU | 90.75 | |
| PRK15186 | 291 | AraC family transcriptional regulator; Provisional | 90.49 | |
| PF09313 | 82 | DUF1971: Domain of unknown function (DUF1971); Int | 89.6 | |
| PF06719 | 155 | AraC_N: AraC-type transcriptional regulator N-term | 88.59 | |
| PF14499 | 251 | DUF4437: Domain of unknown function (DUF4437); PDB | 88.29 | |
| PF04622 | 216 | ERG2_Sigma1R: ERG2 and Sigma1 receptor like protei | 88.12 | |
| PF02678 | 107 | Pirin: Pirin; InterPro: IPR003829 This entry repre | 88.06 | |
| PF05726 | 104 | Pirin_C: Pirin C-terminal cupin domain; InterPro: | 88.04 | |
| COG3718 | 270 | IolB Uncharacterized enzyme involved in inositol m | 87.34 | |
| COG3257 | 264 | GlxB Uncharacterized protein, possibly involved in | 86.37 | |
| KOG0501 | 971 | consensus K+-channel KCNQ [Inorganic ion transport | 85.65 |
| >COG3450 Predicted enzyme of the cupin superfamily [General function prediction only] | Back alignment and domain information |
|---|
Probab=99.94 E-value=4.7e-26 Score=170.57 Aligned_cols=110 Identities=35% Similarity=0.574 Sum_probs=89.9
Q ss_pred ecCCCCCCCCcccCCCcccccccCCccccceeeeEEEeeCCChhhhhhcCCceeeeEecCCccccccCCCceEEEEEEeE
Q 031987 26 PIPKSKPTTPRVSKSKPVMASTTTTTAATAEIFGVKIEKNPPQSKLSELGVTSWPKWGCPPSKFPWTFTATETMYLLEGK 105 (149)
Q Consensus 26 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~V~i~~~ps~~~L~~lGv~~~giWe~~pg~f~~h~~~dE~~yVLEG~ 105 (149)
+|++.+-..++...+.|+...++.+...++.++. ...|...+|+|+|+||+|+++|+.+|+||||+|+
T Consensus 6 ~~~~~p~~~~~~~~~~p~~~i~G~p~~~t~~~~~------------~~dg~~~~GiWe~TpG~~r~~y~~~E~chil~G~ 73 (116)
T COG3450 6 IIDTVPLEEPELGDPAPEPLILGDPSAATWNLYG------------APDGQVETGIWECTPGKFRVTYDEDEFCHILEGR 73 (116)
T ss_pred eccCCccccccccccCCcccccCCccceehheee------------CCCCCeeEeEEEecCccceEEcccceEEEEEeeE
Confidence 4444444556666666666655555555444432 1257788999999999999999999999999999
Q ss_pred EEEEECCcceEEEEcCCcEEEEcCCcEEEEEEcCceEEEEEec
Q 031987 106 VIVYVDGREGSFEIGTGDLVVFPKGMKITWDVIEAVNKHYSLE 148 (149)
Q Consensus 106 v~vt~dgg~~~~~i~aGD~v~~PkG~~~tW~v~e~vrK~Yvi~ 148 (149)
++++.|+| +.++++|||+++||+|+.++|+|.|++||+|++.
T Consensus 74 v~~T~d~G-e~v~~~aGD~~~~~~G~~g~W~V~EtvrK~Yv~~ 115 (116)
T COG3450 74 VEVTPDGG-EPVEVRAGDSFVFPAGFKGTWEVLETVRKHYVIR 115 (116)
T ss_pred EEEECCCC-eEEEEcCCCEEEECCCCeEEEEEeeeeEEEEEEe
Confidence 99999999 9999999999999999999999999999999974
|
|
| >PF05899 Cupin_3: Protein of unknown function (DUF861); InterPro: IPR008579 The function of the proteins in this entry are unknown | Back alignment and domain information |
|---|
| >PF06249 EutQ: Ethanolamine utilisation protein EutQ; InterPro: IPR010424 The eut operon of Salmonella typhimurium encodes proteins involved in the cobalamin-dependent degradation of ethanolamine | Back alignment and domain information |
|---|
| >PRK15457 ethanolamine utilization protein EutQ; Provisional | Back alignment and domain information |
|---|
| >COG4766 EutQ Ethanolamine utilization protein [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF07883 Cupin_2: Cupin domain; InterPro: IPR013096 This family represents the conserved barrel domain of the cupin superfamily [] (cupa is the Latin term for a small barrel) | Back alignment and domain information |
|---|
| >COG3837 Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] | Back alignment and domain information |
|---|
| >COG0662 {ManC} Mannose-6-phosphate isomerase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13290 ectC L-ectoine synthase; Reviewed | Back alignment and domain information |
|---|
| >PRK09943 DNA-binding transcriptional repressor PuuR; Provisional | Back alignment and domain information |
|---|
| >COG1917 Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] | Back alignment and domain information |
|---|
| >PRK13264 3-hydroxyanthranilate 3,4-dioxygenase; Provisional | Back alignment and domain information |
|---|
| >TIGR03037 anthran_nbaC 3-hydroxyanthranilate 3,4-dioxygenase | Back alignment and domain information |
|---|
| >PF00190 Cupin_1: Cupin; InterPro: IPR006045 This family represents the conserved barrel domain of the 'cupin' superfamily ('cupa' is the Latin term for a small barrel) | Back alignment and domain information |
|---|
| >PF02311 AraC_binding: AraC-like ligand binding domain; InterPro: IPR003313 This entry defines the arabinose-binding and dimerisation domain of the bacterial gene regulatory protein AraC | Back alignment and domain information |
|---|
| >TIGR03404 bicupin_oxalic bicupin, oxalate decarboxylase family | Back alignment and domain information |
|---|
| >smart00835 Cupin_1 Cupin | Back alignment and domain information |
|---|
| >TIGR01479 GMP_PMI mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase | Back alignment and domain information |
|---|
| >PRK11171 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK11171 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03214 ura-cupin putative allantoin catabolism protein | Back alignment and domain information |
|---|
| >PRK15460 cpsB mannose-1-phosphate guanyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR03404 bicupin_oxalic bicupin, oxalate decarboxylase family | Back alignment and domain information |
|---|
| >TIGR03214 ura-cupin putative allantoin catabolism protein | Back alignment and domain information |
|---|
| >PRK04190 glucose-6-phosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >PF01050 MannoseP_isomer: Mannose-6-phosphate isomerase; InterPro: IPR001538 Mannose-6-phosphate isomerase or phosphomannose isomerase (5 | Back alignment and domain information |
|---|
| >COG4297 Uncharacterized protein containing double-stranded beta helix domain [Function unknown] | Back alignment and domain information |
|---|
| >PF06865 DUF1255: Protein of unknown function (DUF1255); InterPro: IPR009664 This family consists of several conserved hypothetical bacterial proteins of around 95 residues in length | Back alignment and domain information |
|---|
| >PRK13500 transcriptional activator RhaR; Provisional | Back alignment and domain information |
|---|
| >PF03079 ARD: ARD/ARD' family; InterPro: IPR004313 The two acireductone dioxygenase enzymes (ARD and ARD', previously known as E-2 and E-2') from Klebsiella pneumoniae share the same amino acid sequence Q9ZFE7 from SWISSPROT, but bind different metal ions: ARD binds Ni2+, ARD' binds Fe2+ [] | Back alignment and domain information |
|---|
| >PRK10296 DNA-binding transcriptional regulator ChbR; Provisional | Back alignment and domain information |
|---|
| >PRK10579 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK13501 transcriptional activator RhaR; Provisional | Back alignment and domain information |
|---|
| >PLN00212 glutelin; Provisional | Back alignment and domain information |
|---|
| >PRK10371 DNA-binding transcriptional regulator MelR; Provisional | Back alignment and domain information |
|---|
| >PRK13502 transcriptional activator RhaR; Provisional | Back alignment and domain information |
|---|
| >PRK13503 transcriptional activator RhaS; Provisional | Back alignment and domain information |
|---|
| >TIGR02297 HpaA 4-hydroxyphenylacetate catabolism regulatory protein HpaA | Back alignment and domain information |
|---|
| >COG3257 GlxB Uncharacterized protein, possibly involved in glyoxylate utilization [General function prediction only] | Back alignment and domain information |
|---|
| >COG2140 Thermophilic glucose-6-phosphate isomerase and related metalloenzymes [Carbohydrate transport and metabolism / General function prediction only] | Back alignment and domain information |
|---|
| >PF11699 CENP-C_C: Mif2/CENP-C like; PDB: 2VPV_B | Back alignment and domain information |
|---|
| >PF12852 Cupin_6: Cupin | Back alignment and domain information |
|---|
| >COG4101 Predicted mannose-6-phosphate isomerase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF12973 Cupin_7: ChrR Cupin-like domain; PDB: 3O14_B 2Z2S_F 2Q1Z_B 3EBR_A | Back alignment and domain information |
|---|
| >PF04209 HgmA: homogentisate 1,2-dioxygenase; InterPro: IPR005708 Alkaptonuria (AKU), a rare hereditary disorder, was the first disease to be interpreted as an inborn error of metabolism | Back alignment and domain information |
|---|
| >PRK05341 homogentisate 1,2-dioxygenase; Provisional | Back alignment and domain information |
|---|
| >PF06052 3-HAO: 3-hydroxyanthranilic acid dioxygenase; InterPro: IPR010329 Members of this protein family, from both bacteria and eukaryotes, are the enzyme 3-hydroxyanthranilate 3,4-dioxygenase (1 | Back alignment and domain information |
|---|
| >TIGR02272 gentisate_1_2 gentisate 1,2-dioxygenase | Back alignment and domain information |
|---|
| >TIGR01015 hmgA homogentisate 1,2-dioxygenase | Back alignment and domain information |
|---|
| >PLN02658 homogentisate 1,2-dioxygenase | Back alignment and domain information |
|---|
| >KOG2107 consensus Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] | Back alignment and domain information |
|---|
| >COG3123 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PLN00212 glutelin; Provisional | Back alignment and domain information |
|---|
| >PRK10572 DNA-binding transcriptional regulator AraC; Provisional | Back alignment and domain information |
|---|
| >COG1791 Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] | Back alignment and domain information |
|---|
| >PF06560 GPI: Glucose-6-phosphate isomerase (GPI); InterPro: IPR010551 This entry consists of several bacterial and archaeal glucose-6-phosphate isomerase (GPI) proteins (5 | Back alignment and domain information |
|---|
| >PF06339 Ectoine_synth: Ectoine synthase; InterPro: IPR010462 This family consists of several bacterial ectoine synthase proteins | Back alignment and domain information |
|---|
| >PF02041 Auxin_BP: Auxin binding protein; InterPro: IPR000526 Auxin binding protein is located in the lumen of the endoplasmic reticulum (ER) | Back alignment and domain information |
|---|
| >TIGR02451 anti_sig_ChrR anti-sigma factor, putative, ChrR family | Back alignment and domain information |
|---|
| >COG3508 HmgA Homogentisate 1,2-dioxygenase [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PRK09685 DNA-binding transcriptional activator FeaR; Provisional | Back alignment and domain information |
|---|
| >TIGR00218 manA mannose-6-phosphate isomerase, class I | Back alignment and domain information |
|---|
| >PF05523 FdtA: WxcM-like, C-terminal ; InterPro: IPR008894 This entry includes FdtA (Q6T1W8 from SWISSPROT) from Aneurinibacillus thermoaerophilus, which has been characterised as a dTDP-6-deoxy-3,4-keto-hexulose isomerase [] | Back alignment and domain information |
|---|
| >PF14525 AraC_binding_2: AraC-binding-like domain | Back alignment and domain information |
|---|
| >TIGR02272 gentisate_1_2 gentisate 1,2-dioxygenase | Back alignment and domain information |
|---|
| >PRK00924 5-keto-4-deoxyuronate isomerase; Provisional | Back alignment and domain information |
|---|
| >PRK15131 mannose-6-phosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >PF04962 KduI: KduI/IolB family; InterPro: IPR021120 The KduI/IolB family of enzymes includes 5-keto 4-deoxyuronate isomerase (KduI) and 5-deoxy-glucuronate isomerase (IolB) | Back alignment and domain information |
|---|
| >PF08007 Cupin_4: Cupin superfamily protein; InterPro: IPR022777 This signature represents primarily the cupin fold found in JmjC transcription factors | Back alignment and domain information |
|---|
| >PF11142 DUF2917: Protein of unknown function (DUF2917); InterPro: IPR021317 This bacterial family of proteins appears to be restricted to Proteobacteria | Back alignment and domain information |
|---|
| >KOG2757 consensus Mannose-6-phosphate isomerase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02288 mannose-6-phosphate isomerase | Back alignment and domain information |
|---|
| >COG1482 ManA Phosphomannose isomerase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >COG3435 Gentisate 1,2-dioxygenase [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >COG3435 Gentisate 1,2-dioxygenase [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PF13621 Cupin_8: Cupin-like domain; PDB: 3AL6_C 3AL5_C 2XUM_A 2Y0I_A 1MZE_A 3KCY_A 1MZF_A 1YCI_A 2ILM_A 1H2L_A | Back alignment and domain information |
|---|
| >PRK15186 AraC family transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >PF09313 DUF1971: Domain of unknown function (DUF1971); InterPro: IPR015392 This uncharacterised domain is predominantly found in bacterial Tellurite resistance proteins | Back alignment and domain information |
|---|
| >PF06719 AraC_N: AraC-type transcriptional regulator N-terminus; InterPro: IPR009594 This entry represents the N terminus of bacterial ARAC-type transcriptional regulators | Back alignment and domain information |
|---|
| >PF14499 DUF4437: Domain of unknown function (DUF4437); PDB: 2QDR_A | Back alignment and domain information |
|---|
| >PF04622 ERG2_Sigma1R: ERG2 and Sigma1 receptor like protein; InterPro: IPR006716 This family consists of the fungal C-8 sterol isomerase and mammalian sigma1 receptor | Back alignment and domain information |
|---|
| >PF02678 Pirin: Pirin; InterPro: IPR003829 This entry represents N-terminal domain of Pirin proteins from both eukaryotes and prokaryotes | Back alignment and domain information |
|---|
| >PF05726 Pirin_C: Pirin C-terminal cupin domain; InterPro: IPR008778 This entry represents C-terminal domain of Pirin proteins from both eukaryotes and prokaryotes | Back alignment and domain information |
|---|
| >COG3718 IolB Uncharacterized enzyme involved in inositol metabolism [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >COG3257 GlxB Uncharacterized protein, possibly involved in glyoxylate utilization [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0501 consensus K+-channel KCNQ [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 149 | ||||
| 1o5u_A | 101 | Crystal Structure Of A Duf861 Family Protein (Tm111 | 9e-16 | ||
| 1lkn_A | 89 | Solution Nmr Structure Of Protein Tm_1112 From Ther | 1e-15 | ||
| 4axo_A | 151 | Structure Of The Clostridium Difficile Eutq Protein | 3e-04 |
| >pdb|1O5U|A Chain A, Crystal Structure Of A Duf861 Family Protein (Tm1112) From Thermotoga Maritima At 1.83 A Resolution Length = 101 | Back alignment and structure |
|
| >pdb|1LKN|A Chain A, Solution Nmr Structure Of Protein Tm_1112 From Thermotoga Maritima. Ontario Centre For Structural Proteomics Target Tm1112_1_89; Northeast Structural Genomics Consortium Target Vt74. Length = 89 | Back alignment and structure |
| >pdb|4AXO|A Chain A, Structure Of The Clostridium Difficile Eutq Protein Length = 151 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 149 | |||
| 1o5u_A | 101 | Novel thermotoga maritima enzyme TM1112; cupin, st | 2e-32 | |
| 3myx_A | 238 | Uncharacterized protein pspto_0244; protein of unk | 2e-23 | |
| 3myx_A | 238 | Uncharacterized protein pspto_0244; protein of unk | 3e-04 | |
| 3bcw_A | 123 | Uncharacterized protein; structural genomics, join | 1e-19 | |
| 2pyt_A | 133 | Ethanolamine utilization protein EUTQ; structural | 5e-15 | |
| 4axo_A | 151 | EUTQ, ethanolamine utilization protein; structural | 1e-14 | |
| 3lwc_A | 119 | Uncharacterized protein; structural genomics, unkn | 1e-11 | |
| 3es4_A | 116 | Uncharacterized protein DUF861 with A RMLC-like C; | 3e-05 | |
| 3l2h_A | 162 | Putative sugar phosphate isomerase; AFE_0303, stru | 4e-05 | |
| 1y3t_A | 337 | Hypothetical protein YXAG; BI cupin, dioxygenase, | 5e-05 | |
| 1y3t_A | 337 | Hypothetical protein YXAG; BI cupin, dioxygenase, | 3e-04 | |
| 1o4t_A | 133 | Putative oxalate decarboxylase; double-stranded be | 6e-05 | |
| 1v70_A | 105 | Probable antibiotics synthesis protein; structural | 1e-04 | |
| 3cew_A | 125 | Uncharacterized cupin protein; all beta-protein, j | 1e-04 | |
| 1juh_A | 350 | Quercetin 2,3-dioxygenase; cupin, glycoprotein, be | 2e-04 | |
| 2gu9_A | 113 | Tetracenomycin polyketide synthesis protein; X-RAY | 2e-04 | |
| 2vqa_A | 361 | SLL1358 protein, MNCA; periplasmic binding protein | 2e-04 | |
| 2vqa_A | 361 | SLL1358 protein, MNCA; periplasmic binding protein | 4e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-04 | |
| 1j58_A | 385 | YVRK protein; cupin, decarboxyklase, oxalate, mang | 3e-04 | |
| 1fxz_A | 476 | Glycinin G1; proglycinin, legumin, SEED storage pr | 4e-04 | |
| 1vj2_A | 126 | Novel manganese-containing cupin TM1459; structura | 5e-04 |
| >1o5u_A Novel thermotoga maritima enzyme TM1112; cupin, structural genomics center for structural genomics, JCSG, protein structure INI PSI; 1.83A {Thermotoga maritima} SCOP: b.82.1.8 PDB: 1lkn_A 2k9z_A Length = 101 | Back alignment and structure |
|---|
Score = 109 bits (275), Expect = 2e-32
Identities = 43/100 (43%), Positives = 54/100 (54%), Gaps = 2/100 (2%)
Query: 48 TTTTAATAEIFGVKIEKNPPQSKLSELGVTSWPKWGCPPSKFPWTFTATETMYLLEGKVI 107
+ VKIEK P KL EL V WP W S+F W + ET Y+LEGKV
Sbjct: 3 SDKIHHHHHHMEVKIEK-PTPEKLKELSVEKWPIWEKEVSEFDWYYDTNETCYILEGKVE 61
Query: 108 VYVDGREGSFEIGTGDLVVFPKGMKITWDVIEAVNKHYSL 147
V + + + I GDLV FPKG++ W V+E V KHY+L
Sbjct: 62 VTTEDGK-KYVIEKGDLVTFPKGLRCRWKVLEPVRKHYNL 100
|
| >3myx_A Uncharacterized protein pspto_0244; protein of unknown function (DUF861), cupin_3 (PF05899), STR genomics; HET: MSE; 1.30A {Pseudomonas syringae PV} Length = 238 | Back alignment and structure |
|---|
| >3myx_A Uncharacterized protein pspto_0244; protein of unknown function (DUF861), cupin_3 (PF05899), STR genomics; HET: MSE; 1.30A {Pseudomonas syringae PV} Length = 238 | Back alignment and structure |
|---|
| >3bcw_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.60A {Bordetella bronchiseptica RB50} Length = 123 | Back alignment and structure |
|---|
| >2pyt_A Ethanolamine utilization protein EUTQ; structural genomics, joint center for structural genomics, J protein structure initiative; 1.90A {Salmonella typhimurium LT2} SCOP: b.82.1.24 Length = 133 | Back alignment and structure |
|---|
| >4axo_A EUTQ, ethanolamine utilization protein; structural protein, bacterial microcompartment, BMC; 1.00A {Clostridium difficile} Length = 151 | Back alignment and structure |
|---|
| >3lwc_A Uncharacterized protein; structural genomics, unknown function, joint center for STRU genomics, JCSG, protein structure initiative; HET: MSE; 1.40A {Rhizobium leguminosarum} Length = 119 | Back alignment and structure |
|---|
| >3es4_A Uncharacterized protein DUF861 with A RMLC-like C; 17741406, protein of unknown function (DUF861) with A RMLC-L fold; HET: MSE; 1.64A {Agrobacterium tumefaciens str} Length = 116 | Back alignment and structure |
|---|
| >3l2h_A Putative sugar phosphate isomerase; AFE_0303, structural GEN joint center for structural genomics, JCSG; HET: MSE CXS; 1.85A {Acidithiobacillus ferrooxidans} Length = 162 | Back alignment and structure |
|---|
| >1y3t_A Hypothetical protein YXAG; BI cupin, dioxygenase, oxidoreductase; 2.40A {Bacillus subtilis} SCOP: b.82.1.5 PDB: 2h0v_A* Length = 337 | Back alignment and structure |
|---|
| >1y3t_A Hypothetical protein YXAG; BI cupin, dioxygenase, oxidoreductase; 2.40A {Bacillus subtilis} SCOP: b.82.1.5 PDB: 2h0v_A* Length = 337 | Back alignment and structure |
|---|
| >1o4t_A Putative oxalate decarboxylase; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; 1.95A {Thermotoga maritima} SCOP: b.82.1.9 Length = 133 | Back alignment and structure |
|---|
| >1v70_A Probable antibiotics synthesis protein; structural genomics, thermus thermophilus HB8, riken structu genomics/proteomics initiative, RSGI; 1.30A {Thermus thermophilus} SCOP: b.82.1.9 PDB: 2dct_A Length = 105 | Back alignment and structure |
|---|
| >3cew_A Uncharacterized cupin protein; all beta-protein, jelly-roll (cupin-2), structural genomics, protein structure initiative; 2.31A {Bacteroides fragilis} Length = 125 | Back alignment and structure |
|---|
| >1juh_A Quercetin 2,3-dioxygenase; cupin, glycoprotein, beta sandwich, oxidoreduct; HET: NAG BMA MAN; 1.60A {Aspergillus japonicus} SCOP: b.82.1.5 PDB: 1gqh_A* 1h1i_A* 1h1m_A* 1gqg_A* Length = 350 | Back alignment and structure |
|---|
| >2gu9_A Tetracenomycin polyketide synthesis protein; X-RAY diffraction, cupin, immune system; 1.40A {Xanthomonas campestris} PDB: 2ilb_A 3h50_A Length = 113 | Back alignment and structure |
|---|
| >2vqa_A SLL1358 protein, MNCA; periplasmic binding protein, metal-binding protein, cupin, BI-cupin, oxalate decarboxylase; 2.95A {Synechocystis SP} Length = 361 | Back alignment and structure |
|---|
| >2vqa_A SLL1358 protein, MNCA; periplasmic binding protein, metal-binding protein, cupin, BI-cupin, oxalate decarboxylase; 2.95A {Synechocystis SP} Length = 361 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1j58_A YVRK protein; cupin, decarboxyklase, oxalate, manganese, formate, metal BI protein; 1.75A {Bacillus subtilis} SCOP: b.82.1.2 PDB: 1l3j_A 1uw8_A 2uyb_A 2uy9_A 2uy8_A 2v09_A 2uya_A 3s0m_A Length = 385 | Back alignment and structure |
|---|
| >1fxz_A Glycinin G1; proglycinin, legumin, SEED storage protein, plant protein; 2.80A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ud1_A 1ucx_A Length = 476 | Back alignment and structure |
|---|
| >1vj2_A Novel manganese-containing cupin TM1459; structural genomics, joint for structural genomics, JCSG; 1.65A {Thermotoga maritima} SCOP: b.82.1.10 Length = 126 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 149 | |||
| 3myx_A | 238 | Uncharacterized protein pspto_0244; protein of unk | 99.91 | |
| 3es4_A | 116 | Uncharacterized protein DUF861 with A RMLC-like C; | 99.9 | |
| 3bcw_A | 123 | Uncharacterized protein; structural genomics, join | 99.87 | |
| 1o5u_A | 101 | Novel thermotoga maritima enzyme TM1112; cupin, st | 99.78 | |
| 2pyt_A | 133 | Ethanolamine utilization protein EUTQ; structural | 99.65 | |
| 4axo_A | 151 | EUTQ, ethanolamine utilization protein; structural | 99.59 | |
| 3myx_A | 238 | Uncharacterized protein pspto_0244; protein of unk | 99.53 | |
| 3lwc_A | 119 | Uncharacterized protein; structural genomics, unkn | 99.49 | |
| 2i45_A | 107 | Hypothetical protein; neisseria meningitidis cupin | 98.91 | |
| 3fjs_A | 114 | Uncharacterized protein with RMLC-like cupin fold; | 98.9 | |
| 2pfw_A | 116 | Cupin 2, conserved barrel domain protein; cupin do | 98.9 | |
| 1v70_A | 105 | Probable antibiotics synthesis protein; structural | 98.89 | |
| 3h8u_A | 125 | Uncharacterized conserved protein with double-STR | 98.88 | |
| 3l2h_A | 162 | Putative sugar phosphate isomerase; AFE_0303, stru | 98.87 | |
| 4e2g_A | 126 | Cupin 2 conserved barrel domain protein; MCSG, PSI | 98.86 | |
| 2gu9_A | 113 | Tetracenomycin polyketide synthesis protein; X-RAY | 98.84 | |
| 1yhf_A | 115 | Hypothetical protein SPY1581; structural genomics, | 98.84 | |
| 3i7d_A | 163 | Sugar phosphate isomerase; YP_168127.1, structural | 98.8 | |
| 2ozj_A | 114 | Cupin 2, conserved barrel; cupin superfamily prote | 98.79 | |
| 3ibm_A | 167 | Cupin 2, conserved barrel domain protein; cupin 2 | 98.78 | |
| 2q30_A | 110 | Uncharacterized protein; double-stranded beta-heli | 98.77 | |
| 2vpv_A | 166 | Protein MIF2, MIF2P; nucleus, mitosis, centromere, | 98.76 | |
| 2opk_A | 112 | Hypothetical protein; putative mannose-6-phosphate | 98.76 | |
| 2fqp_A | 97 | Hypothetical protein BP2299; double-stranded beta- | 98.75 | |
| 3d82_A | 102 | Cupin 2, conserved barrel domain protein; structur | 98.74 | |
| 2bnm_A | 198 | Epoxidase; oxidoreductase, cupin, HTH, cation-depe | 98.72 | |
| 3ht1_A | 145 | REMF protein; cupin fold, Zn-binding, antibiotic b | 98.7 | |
| 2o8q_A | 134 | Hypothetical protein; cpuin-like fold, structural | 98.7 | |
| 3es1_A | 172 | Cupin 2, conserved barrel domain protein; YP_00116 | 98.67 | |
| 3kgz_A | 156 | Cupin 2 conserved barrel domain protein; metallopr | 98.67 | |
| 3rns_A | 227 | Cupin 2 conserved barrel domain protein; structura | 98.67 | |
| 2oa2_A | 148 | BH2720 protein; 10175341, structural genomics, joi | 98.66 | |
| 2b8m_A | 117 | Hypothetical protein MJ0764; structural genomics, | 98.64 | |
| 3rns_A | 227 | Cupin 2 conserved barrel domain protein; structura | 98.64 | |
| 1o4t_A | 133 | Putative oxalate decarboxylase; double-stranded be | 98.64 | |
| 3jzv_A | 166 | Uncharacterized protein RRU_A2000; structural geno | 98.61 | |
| 4h7l_A | 157 | Uncharacterized protein; structural genomics, PSI- | 98.61 | |
| 4i4a_A | 128 | Similar to unknown protein; structural genomics, P | 98.59 | |
| 3cew_A | 125 | Uncharacterized cupin protein; all beta-protein, j | 98.59 | |
| 1lr5_A | 163 | Auxin binding protein 1; beta jellyroll, double st | 98.58 | |
| 1vj2_A | 126 | Novel manganese-containing cupin TM1459; structura | 98.58 | |
| 1sfn_A | 246 | Conserved hypothetical protein; structural genomic | 98.57 | |
| 1juh_A | 350 | Quercetin 2,3-dioxygenase; cupin, glycoprotein, be | 98.57 | |
| 1y9q_A | 192 | Transcriptional regulator, HTH_3 family; transcrip | 98.56 | |
| 1rc6_A | 261 | Hypothetical protein YLBA; structural genomics, NY | 98.56 | |
| 4b29_A | 217 | Dimethylsulfoniopropionate lyase; hydrolase, dimet | 98.52 | |
| 1dgw_A | 178 | Canavalin; duplicated swiss-roll beta barrels, loo | 98.52 | |
| 1y3t_A | 337 | Hypothetical protein YXAG; BI cupin, dioxygenase, | 98.51 | |
| 1fi2_A | 201 | Oxalate oxidase, germin; beta-jellyroll, oxidoredu | 98.5 | |
| 2vqa_A | 361 | SLL1358 protein, MNCA; periplasmic binding protein | 98.5 | |
| 2f4p_A | 147 | Hypothetical protein TM1010; double-stranded beta- | 98.49 | |
| 1x82_A | 190 | Glucose-6-phosphate isomerase; cupin superfamily, | 98.48 | |
| 1rc6_A | 261 | Hypothetical protein YLBA; structural genomics, NY | 98.48 | |
| 4e2q_A | 266 | Ureidoglycine aminohydrolase; BI-cupin, manganese | 98.47 | |
| 2arc_A | 164 | ARAC, arabinose operon regulatory protein; transcr | 98.47 | |
| 1sq4_A | 278 | GLXB, glyoxylate-induced protein; structural genom | 98.47 | |
| 2cav_A | 445 | Protein (canavalin); vicilin, 7S SEED protein, dom | 98.46 | |
| 3h7j_A | 243 | Bacilysin biosynthesis protein BACB; YWFC, bacilys | 98.45 | |
| 1sef_A | 274 | Conserved hypothetical protein; structural genomic | 98.45 | |
| 1y3t_A | 337 | Hypothetical protein YXAG; BI cupin, dioxygenase, | 98.44 | |
| 1yfu_A | 174 | 3-hydroxyanthranilate-3,4-dioxygenase; cupin, oxid | 98.43 | |
| 1sef_A | 274 | Conserved hypothetical protein; structural genomic | 98.41 | |
| 3h7j_A | 243 | Bacilysin biosynthesis protein BACB; YWFC, bacilys | 98.4 | |
| 1zvf_A | 176 | 3-hydroxyanthranilate 3,4-dioxygenase; jellyroll b | 98.37 | |
| 1juh_A | 350 | Quercetin 2,3-dioxygenase; cupin, glycoprotein, be | 98.37 | |
| 2ea7_A | 434 | 7S globulin-1; beta barrel, cupin superfamily, pla | 98.36 | |
| 1uij_A | 416 | Beta subunit of beta conglycinin; double-stranded | 98.32 | |
| 2xlg_A | 239 | SLL1785 protein, CUCA; metal binding protein, cupi | 98.29 | |
| 2oyz_A | 94 | UPF0345 protein VPA0057; unknown function, structu | 98.28 | |
| 1sfn_A | 246 | Conserved hypothetical protein; structural genomic | 98.27 | |
| 1vr3_A | 191 | Acireductone dioxygenase; 13543033, structural gen | 98.26 | |
| 2vqa_A | 361 | SLL1358 protein, MNCA; periplasmic binding protein | 98.25 | |
| 1j58_A | 385 | YVRK protein; cupin, decarboxyklase, oxalate, mang | 98.22 | |
| 3d0j_A | 140 | Uncharacterized protein CA_C3497; beta-barrel, str | 98.22 | |
| 1j58_A | 385 | YVRK protein; cupin, decarboxyklase, oxalate, mang | 98.21 | |
| 2ozi_A | 98 | Hypothetical protein RPA4178; APC6210, putative pr | 98.11 | |
| 3lag_A | 98 | Uncharacterized protein RPA4178; functionally unkn | 98.05 | |
| 1sq4_A | 278 | GLXB, glyoxylate-induced protein; structural genom | 98.01 | |
| 2d40_A | 354 | Z3393, putative gentisate 1,2-dioxygenase; gentisi | 98.01 | |
| 1zrr_A | 179 | E-2/E-2' protein; nickel, cupin, beta helix, methi | 98.0 | |
| 1fxz_A | 476 | Glycinin G1; proglycinin, legumin, SEED storage pr | 97.96 | |
| 2qnk_A | 286 | 3-hydroxyanthranilate 3,4-dioxygenase; bicupin fol | 97.95 | |
| 3fz3_A | 531 | Prunin; TREE NUT allergen, allergy, amandin, almon | 97.95 | |
| 2d5f_A | 493 | Glycinin A3B4 subunit; soybean, globulin, 11S,SEED | 97.94 | |
| 2d40_A | 354 | Z3393, putative gentisate 1,2-dioxygenase; gentisi | 97.93 | |
| 3c3v_A | 510 | Arachin ARAH3 isoform; peanut allergen, allergy, g | 97.91 | |
| 2phl_A | 397 | Phaseolin; plant SEED storage protein(vicilin); HE | 97.87 | |
| 4e2q_A | 266 | Ureidoglycine aminohydrolase; BI-cupin, manganese | 97.84 | |
| 3nw4_A | 368 | Gentisate 1,2-dioxygenase; beta-barrel, oxidoreduc | 97.78 | |
| 3bu7_A | 394 | Gentisate 1,2-dioxygenase; cupin domain, oxidoredu | 97.77 | |
| 3s7i_A | 418 | Allergen ARA H 1, clone P41B; bicupin, vicilin, st | 97.76 | |
| 3bu7_A | 394 | Gentisate 1,2-dioxygenase; cupin domain, oxidoredu | 97.74 | |
| 2e9q_A | 459 | 11S globulin subunit beta; cucubitin, pumpkin SEED | 97.72 | |
| 2phl_A | 397 | Phaseolin; plant SEED storage protein(vicilin); HE | 97.71 | |
| 3eo6_A | 106 | Protein of unknown function (DUF1255); AFE_2634, s | 97.66 | |
| 2d5f_A | 493 | Glycinin A3B4 subunit; soybean, globulin, 11S,SEED | 97.65 | |
| 2e9q_A | 459 | 11S globulin subunit beta; cucubitin, pumpkin SEED | 97.64 | |
| 1uij_A | 416 | Beta subunit of beta conglycinin; double-stranded | 97.63 | |
| 1fxz_A | 476 | Glycinin G1; proglycinin, legumin, SEED storage pr | 97.6 | |
| 2o1q_A | 145 | Putative acetyl/propionyl-COA carboxylase, alpha; | 97.58 | |
| 3qac_A | 465 | 11S globulin SEED storage protein; 11S SEED storag | 97.58 | |
| 3nw4_A | 368 | Gentisate 1,2-dioxygenase; beta-barrel, oxidoreduc | 97.51 | |
| 3ksc_A | 496 | LEGA class, prolegumin; PEA prolegumin, 11S SEED s | 97.51 | |
| 3qac_A | 465 | 11S globulin SEED storage protein; 11S SEED storag | 97.5 | |
| 3kgl_A | 466 | Cruciferin; 11S SEED globulin, rapeseed, SEED stor | 97.48 | |
| 2ea7_A | 434 | 7S globulin-1; beta barrel, cupin superfamily, pla | 97.47 | |
| 3hqx_A | 111 | UPF0345 protein aciad0356; DUF1255,PF06865,PSI2,MC | 97.45 | |
| 3ksc_A | 496 | LEGA class, prolegumin; PEA prolegumin, 11S SEED s | 97.34 | |
| 3c3v_A | 510 | Arachin ARAH3 isoform; peanut allergen, allergy, g | 97.29 | |
| 2q1z_B | 195 | Anti-sigma factor CHRR, transcriptional activator; | 97.18 | |
| 3cjx_A | 165 | Protein of unknown function with A cupin-like FOL; | 97.11 | |
| 2cav_A | 445 | Protein (canavalin); vicilin, 7S SEED protein, dom | 97.11 | |
| 2qnk_A | 286 | 3-hydroxyanthranilate 3,4-dioxygenase; bicupin fol | 97.01 | |
| 2y0o_A | 175 | Probable D-lyxose ketol-isomerase; carbohydrate me | 96.98 | |
| 3s7i_A | 418 | Allergen ARA H 1, clone P41B; bicupin, vicilin, st | 96.96 | |
| 3kgl_A | 466 | Cruciferin; 11S SEED globulin, rapeseed, SEED stor | 96.92 | |
| 3ebr_A | 159 | Uncharacterized RMLC-like cupin; structural genomi | 96.92 | |
| 3gbg_A | 276 | TCP pilus virulence regulatory protein; cupin, hel | 96.87 | |
| 1eyb_A | 471 | Homogentisate 1,2-dioxygenase; jelly roll, beta sa | 96.77 | |
| 3st7_A | 369 | Capsular polysaccharide synthesis enzyme CAP5F; ro | 96.6 | |
| 3o14_A | 223 | Anti-ecfsigma factor, CHRR; cupin, structural geno | 96.39 | |
| 3bal_A | 153 | Acetylacetone-cleaving enzyme; jelly roll, tetrame | 95.73 | |
| 2wfp_A | 394 | Mannose-6-phosphate isomerase; APO-structure, meta | 95.39 | |
| 2qjv_A | 270 | Uncharacterized IOLB-like protein; structural geno | 94.93 | |
| 2pa7_A | 141 | DTDP-6-deoxy-3,4-keto-hexulose isomerase; deoxysug | 94.47 | |
| 1qwr_A | 319 | Mannose-6-phosphate isomerase; structural genomics | 94.32 | |
| 1zx5_A | 300 | Mannosephosphate isomerase, putative; STRU genomic | 94.17 | |
| 4gjz_A | 235 | Lysine-specific demethylase 8; JMJC, beta barrel, | 93.54 | |
| 3fz3_A | 531 | Prunin; TREE NUT allergen, allergy, amandin, almon | 92.89 | |
| 1pmi_A | 440 | PMI, phosphomannose isomerase; aldose-ketose isome | 92.66 | |
| 3bb6_A | 127 | Uncharacterized protein YEAR; structural genomics, | 92.61 | |
| 3eqe_A | 171 | Putative cystein deoxygenase; YUBC, SR112, NESG, s | 92.54 | |
| 3ejk_A | 174 | DTDP sugar isomerase; YP_390184.1, structural geno | 92.39 | |
| 1ywk_A | 289 | 4-deoxy-L-threo-5-hexosulose-uronate ketol- isomer | 91.78 | |
| 3o14_A | 223 | Anti-ecfsigma factor, CHRR; cupin, structural geno | 91.64 | |
| 2vec_A | 256 | YHAK, pirin-like protein YHAK; ROS, bicupin, sulfe | 91.0 | |
| 2vec_A | 256 | YHAK, pirin-like protein YHAK; ROS, bicupin, sulfe | 90.37 | |
| 2gm6_A | 208 | Cysteine dioxygenase type I; structural genomics, | 90.25 | |
| 1xru_A | 282 | 4-deoxy-L-threo-5-hexosulose-uronate ketol-isomer; | 90.17 | |
| 3bpz_A | 202 | Potassium/sodium hyperpolarization-activated cycli | 89.64 | |
| 3ocp_A | 139 | PRKG1 protein; serine/threonine kinase, TF2I and I | 89.09 | |
| 2xdv_A | 442 | MYC-induced nuclear antigen; ribosome biogenesis, | 88.93 | |
| 3pna_A | 154 | CAMP-dependent protein kinase type I-alpha regula | 88.0 | |
| 1tq5_A | 242 | Protein YHHW; bicupin, pirin, montreal-kingston ba | 87.79 | |
| 4f8a_A | 160 | Potassium voltage-gated channel subfamily H membe; | 87.25 | |
| 2d93_A | 134 | RAP guanine nucleotide exchange factor 6; CNMP_bin | 86.7 | |
| 1ep0_A | 185 | DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; race | 85.99 | |
| 1vrb_A | 342 | Putative asparaginyl hydroxylase; 2636534, structu | 85.46 | |
| 1tq5_A | 242 | Protein YHHW; bicupin, pirin, montreal-kingston ba | 85.35 | |
| 2ptm_A | 198 | Hyperpolarization-activated (IH) channel; ION chan | 84.71 | |
| 3of1_A | 246 | CAMP-dependent protein kinase regulatory subunit; | 84.3 | |
| 1dgw_X | 79 | Canavalin; duplicated swiss-roll beta barrels, loo | 83.95 | |
| 1yud_A | 170 | Hypothetical protein SO0799; SOR12, Q8E1N8, PSI, p | 83.39 | |
| 2ixk_A | 184 | DTDP-4-dehydrorhamnose 3,5-epimerase; isomerase, l | 83.31 | |
| 3dl3_A | 119 | Tellurite resistance protein B; X-RAY NESG VFR98 Q | 83.26 | |
| 4diq_A | 489 | Lysine-specific demethylase NO66; structural genom | 83.21 | |
| 3ukn_A | 212 | Novel protein similar to vertebrate potassium VOL | 82.61 | |
| 1qwr_A | 319 | Mannose-6-phosphate isomerase; structural genomics | 81.6 | |
| 2yu1_A | 451 | JMJC domain-containing histone demethylation PROT; | 81.56 | |
| 2qcs_B | 291 | CAMP-dependent protein kinase type I-alpha regula | 81.16 | |
| 3eln_A | 200 | Cysteine dioxygenase type 1; peroxysulfenate, non- | 80.7 | |
| 3shr_A | 299 | CGMP-dependent protein kinase 1; cyclic nucleotide | 80.26 | |
| 2qdr_A | 303 | Uncharacterized protein; double-stranded beta-heli | 80.09 | |
| 2p17_A | 277 | Pirin-like protein; GK1651, structural genomics, s | 80.06 |
| >3myx_A Uncharacterized protein pspto_0244; protein of unknown function (DUF861), cupin_3 (PF05899), STR genomics; HET: MSE; 1.30A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
Probab=99.91 E-value=2.2e-24 Score=176.87 Aligned_cols=112 Identities=21% Similarity=0.379 Sum_probs=99.5
Q ss_pred ceeeecCCCCCCCCcccCCCcccccccCCccccceeeeEEEeeCCChhhhhhcCCceeeeEecCCccc-cccCCCceEEE
Q 031987 22 PLIIPIPKSKPTTPRVSKSKPVMASTTTTTAATAEIFGVKIEKNPPQSKLSELGVTSWPKWGCPPSKF-PWTFTATETMY 100 (149)
Q Consensus 22 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~V~i~~~ps~~~L~~lGv~~~giWe~~pg~f-~~h~~~dE~~y 100 (149)
|-+++|+.+..+.|. ..|+++++.++++.+..+..+.- ..|..+||+|+|+||.+ .++|+++|+||
T Consensus 125 ~~~~~i~~~~~l~P~-~~p~p~~~l~G~P~~~~~~~~~~------------~~g~~~~GiW~~tpG~~~~~~~~~~E~~~ 191 (238)
T 3myx_A 125 SGITALDRLALLTPS-SPPDPSIMISPLPQCRSNNLFED------------TASTLRIGVWDSTPYERISRPHKIHELMN 191 (238)
T ss_dssp CSEEEECTTCCCEEE-CCCCGGGBSSCCCCEEEEEEEEC------------SSSSCEEEEEEECCEEBCCEECSSCEEEE
T ss_pred CccEEecCCCCCCCC-CCCChhheecCCchheeeEEEEC------------CCCCEEEeEEEeCCCEEECCcCCCCEEEE
Confidence 457899999999997 78999999999988777665431 25778899999999874 57889999999
Q ss_pred EEEeEEEEEECCcceEEEEcCCcEEEEcCCcEEEEEEcCceEEEEEe
Q 031987 101 LLEGKVIVYVDGREGSFEIGTGDLVVFPKGMKITWDVIEAVNKHYSL 147 (149)
Q Consensus 101 VLEG~v~vt~dgg~~~~~i~aGD~v~~PkG~~~tW~v~e~vrK~Yvi 147 (149)
||||+++++.++| +.++++|||+++||+|+.++|++.+++||+|+|
T Consensus 192 ILeG~v~lt~~~G-~~~~~~aGD~~~~P~G~~~tWev~e~vrK~Yvi 237 (238)
T 3myx_A 192 LIEGRVVLSLENG-SSLTVNTGDTVFVAQGAPCKWTSTGYVRKFYAV 237 (238)
T ss_dssp EEECCEEEEETTS-CEEEECTTCEEEECTTCEEEEEESSCEEEEEEE
T ss_pred EEEeEEEEEeCCC-CEEEECCCCEEEECCCCEEEEEECccEEEEEEe
Confidence 9999999999988 889999999999999999999999999999997
|
| >3es4_A Uncharacterized protein DUF861 with A RMLC-like C; 17741406, protein of unknown function (DUF861) with A RMLC-L fold; HET: MSE; 1.64A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3bcw_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.60A {Bordetella bronchiseptica RB50} | Back alignment and structure |
|---|
| >1o5u_A Novel thermotoga maritima enzyme TM1112; cupin, structural genomics center for structural genomics, JCSG, protein structure INI PSI; 1.83A {Thermotoga maritima} SCOP: b.82.1.8 PDB: 1lkn_A 2k9z_A | Back alignment and structure |
|---|
| >2pyt_A Ethanolamine utilization protein EUTQ; structural genomics, joint center for structural genomics, J protein structure initiative; 1.90A {Salmonella typhimurium LT2} SCOP: b.82.1.24 | Back alignment and structure |
|---|
| >4axo_A EUTQ, ethanolamine utilization protein; structural protein, bacterial microcompartment, BMC; 1.00A {Clostridium difficile} | Back alignment and structure |
|---|
| >3myx_A Uncharacterized protein pspto_0244; protein of unknown function (DUF861), cupin_3 (PF05899), STR genomics; HET: MSE; 1.30A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3lwc_A Uncharacterized protein; structural genomics, unknown function, joint center for STRU genomics, JCSG, protein structure initiative; HET: MSE; 1.40A {Rhizobium leguminosarum} | Back alignment and structure |
|---|
| >2i45_A Hypothetical protein; neisseria meningitidis cupin domain, structural genomics, PS protein structure initiative; 2.50A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >3fjs_A Uncharacterized protein with RMLC-like cupin fold; structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.90A {Ralstonia eutropha JMP134} | Back alignment and structure |
|---|
| >2pfw_A Cupin 2, conserved barrel domain protein; cupin domain, struc genomics, joint center for structural genomics, JCSG; 1.90A {Shewanella frigidimarina} | Back alignment and structure |
|---|
| >1v70_A Probable antibiotics synthesis protein; structural genomics, thermus thermophilus HB8, riken structu genomics/proteomics initiative, RSGI; 1.30A {Thermus thermophilus} SCOP: b.82.1.9 PDB: 2dct_A | Back alignment and structure |
|---|
| >3h8u_A Uncharacterized conserved protein with double-STR beta-helix domain; YP_001338853.1; HET: 2PE; 1.80A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3l2h_A Putative sugar phosphate isomerase; AFE_0303, structural GEN joint center for structural genomics, JCSG; HET: MSE CXS; 1.85A {Acidithiobacillus ferrooxidans} | Back alignment and structure |
|---|
| >4e2g_A Cupin 2 conserved barrel domain protein; MCSG, PSI-biology, structural genomics, GEBA, midwest center structural genomics; HET: MSE; 1.86A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >2gu9_A Tetracenomycin polyketide synthesis protein; X-RAY diffraction, cupin, immune system; 1.40A {Xanthomonas campestris} PDB: 2ilb_A 3h50_A | Back alignment and structure |
|---|
| >1yhf_A Hypothetical protein SPY1581; structural genomics, conserved hypothetical protein, PSI, PR structure initiative; 2.00A {Streptococcus pyogenes} SCOP: b.82.1.9 | Back alignment and structure |
|---|
| >3i7d_A Sugar phosphate isomerase; YP_168127.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; 2.30A {Ruegeria pomeroyi dss-3} | Back alignment and structure |
|---|
| >2ozj_A Cupin 2, conserved barrel; cupin superfamily protein, struct genomics, joint center for structural genomics, JCSG; HET: MSE; 1.60A {Desulfitobacterium hafniense} | Back alignment and structure |
|---|
| >3ibm_A Cupin 2, conserved barrel domain protein; cupin 2 family, metal-binding site, beta barrel, PSI-2, NYSG structural genomics; 2.00A {Halorhodospira halophila SL1} | Back alignment and structure |
|---|
| >2q30_A Uncharacterized protein; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: MSE; 1.94A {Desulfovibrio desulfuricans subsp} | Back alignment and structure |
|---|
| >2vpv_A Protein MIF2, MIF2P; nucleus, mitosis, centromere, cell cycle, DNA-binding, kinetochore, cell division, phosphoprotein, jelly-roll fold; 2.7A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2opk_A Hypothetical protein; putative mannose-6-phosphate isomerase, structural genomics, center for structural genomics, JCSG; 2.10A {Ralstonia eutropha} | Back alignment and structure |
|---|
| >2fqp_A Hypothetical protein BP2299; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: 1PE; 1.80A {Bordetella pertussis tohama I} | Back alignment and structure |
|---|
| >3d82_A Cupin 2, conserved barrel domain protein; structural genomics, joint center for structural genomics; 2.05A {Shewanella frigidimarina ncimb 400} | Back alignment and structure |
|---|
| >2bnm_A Epoxidase; oxidoreductase, cupin, HTH, cation-dependant, zinc, fosfomycin; 1.7A {Streptomyces wedmorensis} SCOP: a.35.1.3 b.82.1.10 PDB: 1zz7_A 1zz8_A 1zz9_A 1zzb_A 1zz6_A 1zzc_A 2bnn_A 2bno_A 3scf_A 3scg_A 3sch_A | Back alignment and structure |
|---|
| >3ht1_A REMF protein; cupin fold, Zn-binding, antibiotic biosynthesis, resistomycin, metalloprotein, cyclase, lyase; 1.20A {Streptomyces resistomycificus} PDB: 3ht2_A | Back alignment and structure |
|---|
| >2o8q_A Hypothetical protein; cpuin-like fold, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.55A {Burkholderia xenovorans} | Back alignment and structure |
|---|
| >3es1_A Cupin 2, conserved barrel domain protein; YP_001165807.1; HET: MSE; 1.91A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID} | Back alignment and structure |
|---|
| >3kgz_A Cupin 2 conserved barrel domain protein; metalloprotein, structural genomics, PSI-2, protein structur initiative; 1.85A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >3rns_A Cupin 2 conserved barrel domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 2.07A {Leptotrichia buccalis} | Back alignment and structure |
|---|
| >2oa2_A BH2720 protein; 10175341, structural genomics, joint center for STRU genomics, JCSG, protein structure initiative, PSI-2, unknow function; HET: MSE; 1.41A {Bacillus halodurans} | Back alignment and structure |
|---|
| >2b8m_A Hypothetical protein MJ0764; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.70A {Methanocaldococcus jannaschii} SCOP: b.82.1.18 | Back alignment and structure |
|---|
| >3rns_A Cupin 2 conserved barrel domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 2.07A {Leptotrichia buccalis} | Back alignment and structure |
|---|
| >1o4t_A Putative oxalate decarboxylase; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; 1.95A {Thermotoga maritima} SCOP: b.82.1.9 | Back alignment and structure |
|---|
| >3jzv_A Uncharacterized protein RRU_A2000; structural genomics, cupin-2 fold, unknown function, PSI-2, structure initiative; HET: MSE; 2.30A {Rhodospirillum rubrum} | Back alignment and structure |
|---|
| >4h7l_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, cupin, unknown function; 2.45A {Planctomyces limnophilus} | Back alignment and structure |
|---|
| >4i4a_A Similar to unknown protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 1.35A {Photorhabdus luminescens subsp} | Back alignment and structure |
|---|
| >3cew_A Uncharacterized cupin protein; all beta-protein, jelly-roll (cupin-2), structural genomics, protein structure initiative; 2.31A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >1lr5_A Auxin binding protein 1; beta jellyroll, double stranded beta helix, germin-like PROT protein binding; HET: NAG BMA MAN; 1.90A {Zea mays} SCOP: b.82.1.2 PDB: 1lrh_A* | Back alignment and structure |
|---|
| >1vj2_A Novel manganese-containing cupin TM1459; structural genomics, joint for structural genomics, JCSG; 1.65A {Thermotoga maritima} SCOP: b.82.1.10 | Back alignment and structure |
|---|
| >1sfn_A Conserved hypothetical protein; structural genomics, nysgxrc target T1583, PSI, protein STRU initiative; 2.46A {Deinococcus radiodurans} SCOP: b.82.1.11 | Back alignment and structure |
|---|
| >1juh_A Quercetin 2,3-dioxygenase; cupin, glycoprotein, beta sandwich, oxidoreduct; HET: NAG BMA MAN; 1.60A {Aspergillus japonicus} SCOP: b.82.1.5 PDB: 1gqh_A* 1h1i_A* 1h1m_A* 1gqg_A* | Back alignment and structure |
|---|
| >1y9q_A Transcriptional regulator, HTH_3 family; transcriptional regulaator, strucutral genomics, protein structure initiative, PSI; 1.90A {Vibrio cholerae} SCOP: a.35.1.8 b.82.1.15 | Back alignment and structure |
|---|
| >1rc6_A Hypothetical protein YLBA; structural genomics, NYSGXRC, SGX clone NAME 3174C1TCT3B1, T T1521, PSI, protein initiative; 2.60A {Escherichia coli} SCOP: b.82.1.11 | Back alignment and structure |
|---|
| >4b29_A Dimethylsulfoniopropionate lyase; hydrolase, dimethylsulfide, sulphur cycle; 1.72A {Roseovarius nubinhibens ism} | Back alignment and structure |
|---|
| >1dgw_A Canavalin; duplicated swiss-roll beta barrels, loops with alpha helices merohedral/ hemihedral twinning, plant protein; 1.70A {Canavalia ensiformis} SCOP: b.82.1.2 PDB: 1dgr_A 1cau_A 1cav_A 1caw_A 1cax_A | Back alignment and structure |
|---|
| >1y3t_A Hypothetical protein YXAG; BI cupin, dioxygenase, oxidoreductase; 2.40A {Bacillus subtilis} SCOP: b.82.1.5 PDB: 2h0v_A* | Back alignment and structure |
|---|
| >1fi2_A Oxalate oxidase, germin; beta-jellyroll, oxidoreductase; 1.60A {Hordeum vulgare} SCOP: b.82.1.2 PDB: 2et1_A 2ete_A* 2et7_A | Back alignment and structure |
|---|
| >2vqa_A SLL1358 protein, MNCA; periplasmic binding protein, metal-binding protein, cupin, BI-cupin, oxalate decarboxylase; 2.95A {Synechocystis SP} | Back alignment and structure |
|---|
| >2f4p_A Hypothetical protein TM1010; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: UNL; 1.90A {Thermotoga maritima} SCOP: b.82.1.9 | Back alignment and structure |
|---|
| >1x82_A Glucose-6-phosphate isomerase; cupin superfamily, hyperthermophIle, phosphoglucose isomerase, extremeophIle; HET: PA5; 1.50A {Pyrococcus furiosus} SCOP: b.82.1.7 PDB: 1x7n_A* 1x8e_A 1qxr_A* 1qxj_A* 1qy4_A* 2gc1_A* 2gc0_A* 2gc2_A* 2gc3_A* 3sxw_A 1j3q_A 1j3p_A 1j3r_A* | Back alignment and structure |
|---|
| >1rc6_A Hypothetical protein YLBA; structural genomics, NYSGXRC, SGX clone NAME 3174C1TCT3B1, T T1521, PSI, protein initiative; 2.60A {Escherichia coli} SCOP: b.82.1.11 | Back alignment and structure |
|---|
| >4e2q_A Ureidoglycine aminohydrolase; BI-cupin, manganese binding, endoplasmic RET hydrolase; 2.50A {Arabidopsis thaliana} PDB: 4e2s_A | Back alignment and structure |
|---|
| >2arc_A ARAC, arabinose operon regulatory protein; transcription factor, carbohydrate binding, coiled-coil, jelly roll; HET: ARA; 1.50A {Escherichia coli} SCOP: b.82.4.1 PDB: 2aac_A* 1xja_A 2ara_A | Back alignment and structure |
|---|
| >1sq4_A GLXB, glyoxylate-induced protein; structural genomics, double beta barrel protein, PSI, protei structure initiative; 2.70A {Pseudomonas aeruginosa} SCOP: b.82.1.11 | Back alignment and structure |
|---|
| >2cav_A Protein (canavalin); vicilin, 7S SEED protein, domain duplication, swiss roll, PL protein; 2.00A {Canavalia ensiformis} SCOP: b.82.1.2 b.82.1.2 PDB: 2cau_A 1cau_B 1cav_B 1caw_B 1cax_B | Back alignment and structure |
|---|
| >3h7j_A Bacilysin biosynthesis protein BACB; YWFC, bacilysin synthesis, anticapsin synthesis, BI-Cu double stranded beta helix, antibiotic biosynthesis; HET: PPY; 1.87A {Bacillus subtilis} PDB: 3h7y_A* 3h9a_A* | Back alignment and structure |
|---|
| >1sef_A Conserved hypothetical protein; structural genomics, nysgxrc target T1582, PSI, protein STRU initiative; 2.05A {Enterococcus faecalis} SCOP: b.82.1.11 | Back alignment and structure |
|---|
| >1y3t_A Hypothetical protein YXAG; BI cupin, dioxygenase, oxidoreductase; 2.40A {Bacillus subtilis} SCOP: b.82.1.5 PDB: 2h0v_A* | Back alignment and structure |
|---|
| >1yfu_A 3-hydroxyanthranilate-3,4-dioxygenase; cupin, oxidoreductase; 1.90A {Cupriavidus metallidurans} SCOP: b.82.1.20 PDB: 1yfw_A* 1yfx_A* 1yfy_A* | Back alignment and structure |
|---|
| >1sef_A Conserved hypothetical protein; structural genomics, nysgxrc target T1582, PSI, protein STRU initiative; 2.05A {Enterococcus faecalis} SCOP: b.82.1.11 | Back alignment and structure |
|---|
| >3h7j_A Bacilysin biosynthesis protein BACB; YWFC, bacilysin synthesis, anticapsin synthesis, BI-Cu double stranded beta helix, antibiotic biosynthesis; HET: PPY; 1.87A {Bacillus subtilis} PDB: 3h7y_A* 3h9a_A* | Back alignment and structure |
|---|
| >1zvf_A 3-hydroxyanthranilate 3,4-dioxygenase; jellyroll beta-barrel, oxidoreductase; 2.41A {Saccharomyces cerevisiae} SCOP: b.82.1.20 | Back alignment and structure |
|---|
| >1juh_A Quercetin 2,3-dioxygenase; cupin, glycoprotein, beta sandwich, oxidoreduct; HET: NAG BMA MAN; 1.60A {Aspergillus japonicus} SCOP: b.82.1.5 PDB: 1gqh_A* 1h1i_A* 1h1m_A* 1gqg_A* | Back alignment and structure |
|---|
| >2ea7_A 7S globulin-1; beta barrel, cupin superfamily, plant protein; 1.80A {Vigna angularis} PDB: 2eaa_A* 2cv6_A 1uik_A | Back alignment and structure |
|---|
| >1uij_A Beta subunit of beta conglycinin; double-stranded beta helix, SEED storage protein, sugar binding protein; 2.50A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ipk_A 1ipj_A* | Back alignment and structure |
|---|
| >2xlg_A SLL1785 protein, CUCA; metal binding protein, cupin; 1.80A {Synechocystis SP} PDB: 2xl7_A 2xl9_A 2xlf_A* 2xla_A | Back alignment and structure |
|---|
| >2oyz_A UPF0345 protein VPA0057; unknown function, structural genomi 2, protein structure initiative, midwest center for structu genomics, MCSG; 1.71A {Vibrio parahaemolyticus} SCOP: b.82.1.22 | Back alignment and structure |
|---|
| >1sfn_A Conserved hypothetical protein; structural genomics, nysgxrc target T1583, PSI, protein STRU initiative; 2.46A {Deinococcus radiodurans} SCOP: b.82.1.11 | Back alignment and structure |
|---|
| >1vr3_A Acireductone dioxygenase; 13543033, structural genomics, JOI for structural genomics, JCSG, protein structure initiative oxidoreductase; 2.06A {Mus musculus} SCOP: b.82.1.6 | Back alignment and structure |
|---|
| >2vqa_A SLL1358 protein, MNCA; periplasmic binding protein, metal-binding protein, cupin, BI-cupin, oxalate decarboxylase; 2.95A {Synechocystis SP} | Back alignment and structure |
|---|
| >1j58_A YVRK protein; cupin, decarboxyklase, oxalate, manganese, formate, metal BI protein; 1.75A {Bacillus subtilis} SCOP: b.82.1.2 PDB: 1l3j_A 1uw8_A 2uyb_A 2uy9_A 2uy8_A 2v09_A 2uya_A 3s0m_A | Back alignment and structure |
|---|
| >3d0j_A Uncharacterized protein CA_C3497; beta-barrel, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.53A {Clostridium acetobutylicum atcc 824} | Back alignment and structure |
|---|
| >1j58_A YVRK protein; cupin, decarboxyklase, oxalate, manganese, formate, metal BI protein; 1.75A {Bacillus subtilis} SCOP: b.82.1.2 PDB: 1l3j_A 1uw8_A 2uyb_A 2uy9_A 2uy8_A 2v09_A 2uya_A 3s0m_A | Back alignment and structure |
|---|
| >3lag_A Uncharacterized protein RPA4178; functionally unknown protein, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.15A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >1sq4_A GLXB, glyoxylate-induced protein; structural genomics, double beta barrel protein, PSI, protei structure initiative; 2.70A {Pseudomonas aeruginosa} SCOP: b.82.1.11 | Back alignment and structure |
|---|
| >2d40_A Z3393, putative gentisate 1,2-dioxygenase; gentisic acid, bicupin, tetramer, montreal- bacterial structural genomics initiative, BSGI; 2.41A {Escherichia coli} SCOP: b.82.1.23 | Back alignment and structure |
|---|
| >1zrr_A E-2/E-2' protein; nickel, cupin, beta helix, methionine salvage, oxidoreductase; NMR {Klebsiella oxytoca} SCOP: b.82.1.6 PDB: 2hji_A | Back alignment and structure |
|---|
| >1fxz_A Glycinin G1; proglycinin, legumin, SEED storage protein, plant protein; 2.80A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ud1_A 1ucx_A | Back alignment and structure |
|---|
| >2qnk_A 3-hydroxyanthranilate 3,4-dioxygenase; bicupin fold, cupin barrel, extradiol dioxygenase, metalloen trytophan catabolism, NAD+ synthesis; HET: MSE; 1.60A {Homo sapiens} PDB: 3fe5_A | Back alignment and structure |
|---|
| >3fz3_A Prunin; TREE NUT allergen, allergy, amandin, almond, 11S SEED storage protein, allergen; 2.40A {Prunus dulcis} PDB: 3ehk_A | Back alignment and structure |
|---|
| >2d40_A Z3393, putative gentisate 1,2-dioxygenase; gentisic acid, bicupin, tetramer, montreal- bacterial structural genomics initiative, BSGI; 2.41A {Escherichia coli} SCOP: b.82.1.23 | Back alignment and structure |
|---|
| >3c3v_A Arachin ARAH3 isoform; peanut allergen, allergy, glycinin; 1.73A {Arachis hypogaea} | Back alignment and structure |
|---|
| >2phl_A Phaseolin; plant SEED storage protein(vicilin); HET: NAG; 2.20A {Phaseolus vulgaris} SCOP: b.82.1.2 b.82.1.2 PDB: 1phs_A* | Back alignment and structure |
|---|
| >4e2q_A Ureidoglycine aminohydrolase; BI-cupin, manganese binding, endoplasmic RET hydrolase; 2.50A {Arabidopsis thaliana} PDB: 4e2s_A | Back alignment and structure |
|---|
| >3nw4_A Gentisate 1,2-dioxygenase; beta-barrel, oxidoreductase; HET: GTQ; 2.00A {Pseudaminobacter salicylatoxidans} PDB: 3nvc_A* 3nst_A* 3njz_A* 2phd_A* 3nkt_A* 3nl1_A* 4fag_A* 4fbf_A 4fah_A | Back alignment and structure |
|---|
| >3bu7_A Gentisate 1,2-dioxygenase; cupin domain, oxidoreductase, plasmid; 2.80A {Silicibacter pomeroyi} SCOP: b.82.1.23 | Back alignment and structure |
|---|
| >3s7i_A Allergen ARA H 1, clone P41B; bicupin, vicilin, storage SEED protein; 2.35A {Arachis hypogaea} PDB: 3s7e_A 3smh_A | Back alignment and structure |
|---|
| >3bu7_A Gentisate 1,2-dioxygenase; cupin domain, oxidoreductase, plasmid; 2.80A {Silicibacter pomeroyi} SCOP: b.82.1.23 | Back alignment and structure |
|---|
| >2e9q_A 11S globulin subunit beta; cucubitin, pumpkin SEED storage globulin, plant protein; 2.20A {Cucurbita maxima} PDB: 2evx_A | Back alignment and structure |
|---|
| >2phl_A Phaseolin; plant SEED storage protein(vicilin); HET: NAG; 2.20A {Phaseolus vulgaris} SCOP: b.82.1.2 b.82.1.2 PDB: 1phs_A* | Back alignment and structure |
|---|
| >3eo6_A Protein of unknown function (DUF1255); AFE_2634, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 0.97A {Acidithiobacillus ferrooxidans ATCC23270} | Back alignment and structure |
|---|
| >2d5f_A Glycinin A3B4 subunit; soybean, globulin, 11S,SEED storage protein, plant; 1.90A {Glycine max} PDB: 2d5h_A 1od5_A | Back alignment and structure |
|---|
| >2e9q_A 11S globulin subunit beta; cucubitin, pumpkin SEED storage globulin, plant protein; 2.20A {Cucurbita maxima} PDB: 2evx_A | Back alignment and structure |
|---|
| >1uij_A Beta subunit of beta conglycinin; double-stranded beta helix, SEED storage protein, sugar binding protein; 2.50A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ipk_A 1ipj_A* | Back alignment and structure |
|---|
| >1fxz_A Glycinin G1; proglycinin, legumin, SEED storage protein, plant protein; 2.80A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ud1_A 1ucx_A | Back alignment and structure |
|---|
| >2o1q_A Putative acetyl/propionyl-COA carboxylase, alpha; putative acetylacetone dioxygenase, structural genomics; HET: MSE PG4; 1.50A {Methylibium petroleiphilum} SCOP: b.82.1.21 | Back alignment and structure |
|---|
| >3qac_A 11S globulin SEED storage protein; 11S SEED storage protein (globulins) family, SEED storage PR plant protein; 2.27A {Amaranthus hypochondriacus} | Back alignment and structure |
|---|
| >3nw4_A Gentisate 1,2-dioxygenase; beta-barrel, oxidoreductase; HET: GTQ; 2.00A {Pseudaminobacter salicylatoxidans} PDB: 3nvc_A* 3nst_A* 3njz_A* 2phd_A* 3nkt_A* 3nl1_A* 4fag_A* 4fbf_A 4fah_A | Back alignment and structure |
|---|
| >3ksc_A LEGA class, prolegumin; PEA prolegumin, 11S SEED storage protein, pisum sativum L., SEED storage protein, storage protein, plant protein; 2.61A {Pisum sativum} | Back alignment and structure |
|---|
| >3qac_A 11S globulin SEED storage protein; 11S SEED storage protein (globulins) family, SEED storage PR plant protein; 2.27A {Amaranthus hypochondriacus} | Back alignment and structure |
|---|
| >3kgl_A Cruciferin; 11S SEED globulin, rapeseed, SEED storage protein, storage protein, plant protein; 2.98A {Brassica napus} | Back alignment and structure |
|---|
| >2ea7_A 7S globulin-1; beta barrel, cupin superfamily, plant protein; 1.80A {Vigna angularis} PDB: 2eaa_A* 2cv6_A 1uik_A | Back alignment and structure |
|---|
| >3hqx_A UPF0345 protein aciad0356; DUF1255,PF06865,PSI2,MCSG, structural genomics, protein STRU initiative, midwest center for structural genomics; 1.66A {Acinetobacter SP} SCOP: b.82.1.0 | Back alignment and structure |
|---|
| >3ksc_A LEGA class, prolegumin; PEA prolegumin, 11S SEED storage protein, pisum sativum L., SEED storage protein, storage protein, plant protein; 2.61A {Pisum sativum} | Back alignment and structure |
|---|
| >3c3v_A Arachin ARAH3 isoform; peanut allergen, allergy, glycinin; 1.73A {Arachis hypogaea} | Back alignment and structure |
|---|
| >3cjx_A Protein of unknown function with A cupin-like FOL; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 2.60A {Ralstonia eutropha} | Back alignment and structure |
|---|
| >2cav_A Protein (canavalin); vicilin, 7S SEED protein, domain duplication, swiss roll, PL protein; 2.00A {Canavalia ensiformis} SCOP: b.82.1.2 b.82.1.2 PDB: 2cau_A 1cau_B 1cav_B 1caw_B 1cax_B | Back alignment and structure |
|---|
| >2qnk_A 3-hydroxyanthranilate 3,4-dioxygenase; bicupin fold, cupin barrel, extradiol dioxygenase, metalloen trytophan catabolism, NAD+ synthesis; HET: MSE; 1.60A {Homo sapiens} PDB: 3fe5_A | Back alignment and structure |
|---|
| >2y0o_A Probable D-lyxose ketol-isomerase; carbohydrate metabolism, metal-binding, sugar ISO stress response; HET: MSE; 1.23A {Bacillus subtilis subsp} | Back alignment and structure |
|---|
| >3s7i_A Allergen ARA H 1, clone P41B; bicupin, vicilin, storage SEED protein; 2.35A {Arachis hypogaea} PDB: 3s7e_A 3smh_A | Back alignment and structure |
|---|
| >3kgl_A Cruciferin; 11S SEED globulin, rapeseed, SEED storage protein, storage protein, plant protein; 2.98A {Brassica napus} | Back alignment and structure |
|---|
| >3ebr_A Uncharacterized RMLC-like cupin; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.60A {Ralstonia eutropha JMP134} | Back alignment and structure |
|---|
| >3gbg_A TCP pilus virulence regulatory protein; cupin, helix-turn-helix, ARAC family, activator, DNA-binding transcription, transcription regulation; HET: PAM; 1.90A {Vibrio cholerae} | Back alignment and structure |
|---|
| >1eyb_A Homogentisate 1,2-dioxygenase; jelly roll, beta sandwich, oxidoreductase; 1.90A {Homo sapiens} SCOP: b.82.1.4 PDB: 1ey2_A | Back alignment and structure |
|---|
| >3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A | Back alignment and structure |
|---|
| >3o14_A Anti-ecfsigma factor, CHRR; cupin, structural genomics, joint center for structura genomics, JCSG, protein structure initiative; HET: MSE; 1.70A {Marinobacter aquaeolei} | Back alignment and structure |
|---|
| >3bal_A Acetylacetone-cleaving enzyme; jelly roll, tetramer, dioxygenase, iron, metal-binding, oxidoreductase; 1.95A {Acinetobacter johnsonii} | Back alignment and structure |
|---|
| >2wfp_A Mannose-6-phosphate isomerase; APO-structure, metal-binding; 1.67A {Salmonella typhimurium} PDB: 3h1w_A 3h1m_A 3h1y_A* | Back alignment and structure |
|---|
| >2qjv_A Uncharacterized IOLB-like protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MLY MSE; 1.90A {Salmonella typhimurium LT2} | Back alignment and structure |
|---|
| >2pa7_A DTDP-6-deoxy-3,4-keto-hexulose isomerase; deoxysugar biosynthesis, S-layer biosynthesis, ketoisomerase; HET: TYD; 1.50A {Aneurinibacillus thermoaerophilus} SCOP: b.82.1.1 PDB: 2pae_A* 2pak_A* 2pam_A* | Back alignment and structure |
|---|
| >1qwr_A Mannose-6-phosphate isomerase; structural genomics, D-mannose 6-phosphate, PSI, protein structure initiative; 1.80A {Bacillus subtilis} SCOP: b.82.1.3 | Back alignment and structure |
|---|
| >1zx5_A Mannosephosphate isomerase, putative; STRU genomics, PSI, protein structure initiative, midwest center structural genomics, MCSG; HET: LFR; 2.30A {Archaeoglobus fulgidus} SCOP: b.82.1.3 | Back alignment and structure |
|---|
| >4gjz_A Lysine-specific demethylase 8; JMJC, beta barrel, Fe(II) and 2-oxoglutarate binding, oxidor; HET: AKG BME; 1.05A {Homo sapiens} PDB: 4gjy_A* 4aap_A* 3uyj_A* | Back alignment and structure |
|---|
| >3fz3_A Prunin; TREE NUT allergen, allergy, amandin, almond, 11S SEED storage protein, allergen; 2.40A {Prunus dulcis} PDB: 3ehk_A | Back alignment and structure |
|---|
| >1pmi_A PMI, phosphomannose isomerase; aldose-ketose isomerase; 1.70A {Candida albicans} SCOP: b.82.1.3 | Back alignment and structure |
|---|
| >3bb6_A Uncharacterized protein YEAR; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Escherichia coli} SCOP: b.82.2.13 | Back alignment and structure |
|---|
| >3eqe_A Putative cystein deoxygenase; YUBC, SR112, NESG, structural genomics, PSI-2, protein structure initiative; 2.82A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3ejk_A DTDP sugar isomerase; YP_390184.1, structural genomics, JOIN for structural genomics, JCSG; HET: CIT; 1.95A {Desulfovibrio desulfuricans subsp} | Back alignment and structure |
|---|
| >1ywk_A 4-deoxy-L-threo-5-hexosulose-uronate ketol- isomerase 1; structural genomics, nysgxrc target T1814, PSI, protein structure initiative; 2.95A {Enterococcus faecalis} SCOP: b.82.1.13 | Back alignment and structure |
|---|
| >3o14_A Anti-ecfsigma factor, CHRR; cupin, structural genomics, joint center for structura genomics, JCSG, protein structure initiative; HET: MSE; 1.70A {Marinobacter aquaeolei} | Back alignment and structure |
|---|
| >2vec_A YHAK, pirin-like protein YHAK; ROS, bicupin, sulfenic acid, reactive cysteine, cytosolic protein; 1.85A {Escherichia coli} | Back alignment and structure |
|---|
| >2vec_A YHAK, pirin-like protein YHAK; ROS, bicupin, sulfenic acid, reactive cysteine, cytosolic protein; 1.85A {Escherichia coli} | Back alignment and structure |
|---|
| >2gm6_A Cysteine dioxygenase type I; structural genomics, J center for structural genomics, JCSG, protein structure INI PSI-2, oxidoreductase; 1.84A {Ralstonia eutropha} SCOP: b.82.1.19 | Back alignment and structure |
|---|
| >1xru_A 4-deoxy-L-threo-5-hexosulose-uronate ketol-isomer; beta barrel, cupin, isomerase; HET: 1PE; 1.94A {Escherichia coli} SCOP: b.82.1.13 PDB: 1x8m_A | Back alignment and structure |
|---|
| >3bpz_A Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2; CNBD, C-linker, pacemaker, HCN, HCN2, CAP, PKA, CAMP, ION channel; HET: CMP; 1.65A {Mus musculus} PDB: 3ffq_A 1q3e_A* 1q43_A* 1q5o_A* 3u10_A* 2q0a_A* 3etq_A* 3u11_A* 3otf_A* 3u0z_A* | Back alignment and structure |
|---|
| >3ocp_A PRKG1 protein; serine/threonine kinase, TF2I and IRAG, transferase; HET: CMP; 2.49A {Homo sapiens} PDB: 3od0_A* 3ogj_A* | Back alignment and structure |
|---|
| >2xdv_A MYC-induced nuclear antigen; ribosome biogenesis, nuclear protein; HET: OGA; 2.57A {Homo sapiens} | Back alignment and structure |
|---|
| >3pna_A CAMP-dependent protein kinase type I-alpha regula subunit; beta-barrel, CAMP-binding, catalytic subunit, transferase; HET: CMP; 1.50A {Bos taurus} PDB: 3fhi_B* 3iia_A 3plq_A* 1u7e_B* 3pvb_B* | Back alignment and structure |
|---|
| >1tq5_A Protein YHHW; bicupin, pirin, montreal-kingston bacterial structural genomics initiative, BSGI, structural genomics, unknown function; 1.76A {Escherichia coli} SCOP: b.82.1.12 | Back alignment and structure |
|---|
| >4f8a_A Potassium voltage-gated channel subfamily H membe; probable regulatory domain of potassium channel, membrane PR transport protein; 2.20A {Mus musculus} | Back alignment and structure |
|---|
| >2d93_A RAP guanine nucleotide exchange factor 6; CNMP_binding domain, PDZ domain containing guanine nucleotide exchange factor 2, PDZ-GEF2, RA-GEF-2; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ep0_A DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; racemase, DTDP-4-dehydrorhamnose epimerase, structural genomics, PSI; 1.50A {Methanothermobacterthermautotrophicus} SCOP: b.82.1.1 PDB: 1epz_A* | Back alignment and structure |
|---|
| >1vrb_A Putative asparaginyl hydroxylase; 2636534, structural genomi center for structural genomics, JCSG, protein structure INI PSI, oxidoreductase; 2.60A {Bacillus subtilis} SCOP: b.82.2.11 | Back alignment and structure |
|---|
| >1tq5_A Protein YHHW; bicupin, pirin, montreal-kingston bacterial structural genomics initiative, BSGI, structural genomics, unknown function; 1.76A {Escherichia coli} SCOP: b.82.1.12 | Back alignment and structure |
|---|
| >2ptm_A Hyperpolarization-activated (IH) channel; ION channel, cyclic nucleotide binding domain, C-linker, CAM SPHCN1, HCN; HET: CMP; 1.93A {Strongylocentrotus purpuratus} | Back alignment and structure |
|---|
| >3of1_A CAMP-dependent protein kinase regulatory subunit; cyclic nucleotide binding domain, evolution, PKA signaling, transfer; HET: CMP; 2.21A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1dgw_X Canavalin; duplicated swiss-roll beta barrels, loops with alpha helices merohedral/ hemihedral twinning, plant protein; 1.70A {Canavalia ensiformis} SCOP: b.82.1.2 PDB: 1dgr_X | Back alignment and structure |
|---|
| >1yud_A Hypothetical protein SO0799; SOR12, Q8E1N8, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.70A {Shewanella oneidensis} SCOP: b.82.1.16 | Back alignment and structure |
|---|
| >2ixk_A DTDP-4-dehydrorhamnose 3,5-epimerase; isomerase, lipopolysaccharide biosynthesis, epimerise, epimerize; HET: TDO; 1.7A {Pseudomonas aeruginosa} PDB: 2ixi_A* 2ixh_A* 1rtv_A* 2ixj_A* | Back alignment and structure |
|---|
| >3dl3_A Tellurite resistance protein B; X-RAY NESG VFR98 Q5E3X2_VIBF1, structural genomics, PSI-2, protein structure initiative; 2.30A {Vibrio fischeri ES114} SCOP: b.82.2.13 | Back alignment and structure |
|---|
| >4diq_A Lysine-specific demethylase NO66; structural genomics, structural genomics consortium, SGC, HI demethylase, oxidoreductase; HET: PD2; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3ukn_A Novel protein similar to vertebrate potassium VOL channel, subfamily H (EAG-related)...; KCNH, ELK, ERG, CNBD, CNBHD, C-linker, ION channel; 2.20A {Danio rerio} PDB: 3ukt_B 3ukv_B | Back alignment and structure |
|---|
| >1qwr_A Mannose-6-phosphate isomerase; structural genomics, D-mannose 6-phosphate, PSI, protein structure initiative; 1.80A {Bacillus subtilis} SCOP: b.82.1.3 | Back alignment and structure |
|---|
| >2yu1_A JMJC domain-containing histone demethylation PROT; JMJC-domain-containing histone demethylases, oxidoreductase; HET: AKG; 2.70A {Homo sapiens} PDB: 2yu2_A | Back alignment and structure |
|---|
| >2qcs_B CAMP-dependent protein kinase type I-alpha regula subunit, CAMP-dependent protein kinase, alpha-catalytic SU; cyclic adenosine monophosphate; HET: SEP TPO ANP TAM; 2.20A {Bos taurus} PDB: 1rl3_A* 1rgs_A* 1ne6_A* 1ne4_A* | Back alignment and structure |
|---|
| >3eln_A Cysteine dioxygenase type 1; peroxysulfenate, non-heme dioxygenases, Fe2+ metalloenzyme, taurine, thioether, iron, metal- binding; 1.42A {Rattus norvegicus} SCOP: b.82.1.19 PDB: 2gh2_A 2b5h_A 2atf_A* 2q4s_A 2ic1_A | Back alignment and structure |
|---|
| >3shr_A CGMP-dependent protein kinase 1; cyclic nucleotide binding domains, cyclic nucleotide protein transferase, PKG; HET: CMP; 2.50A {Bos taurus} | Back alignment and structure |
|---|
| >2qdr_A Uncharacterized protein; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: MSE EPE; 2.60A {Nostoc punctiforme} | Back alignment and structure |
|---|
| >2p17_A Pirin-like protein; GK1651, structural genomics, south collaboratory for structural genomics, protein structure in secsg; 1.52A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 149 | ||||
| d1o5ua_ | 88 | b.82.1.8 (A:) Hypothetical protein TM1112 {Thermot | 3e-33 | |
| d2pyta1 | 128 | b.82.1.24 (A:100-227) Ethanolamine utilization pro | 1e-12 | |
| d1j58a_ | 372 | b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {B | 3e-04 | |
| d1j58a_ | 372 | b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {B | 0.002 | |
| d1uija1 | 170 | b.82.1.2 (A:6-175) Seed storage 7S protein {Soybea | 3e-04 | |
| d1y3ta1 | 330 | b.82.1.5 (A:5-334) Hypothetical protein YxaG {Baci | 5e-04 | |
| d1uika1 | 203 | b.82.1.2 (A:148-350) Seed storage 7S protein {Soyb | 7e-04 | |
| d1sq4a_ | 273 | b.82.1.11 (A:) Glyoxylate-induced protein PA1140 { | 0.001 | |
| d1sq4a_ | 273 | b.82.1.11 (A:) Glyoxylate-induced protein PA1140 { | 0.001 | |
| d1sefa_ | 250 | b.82.1.11 (A:) Hypothetical protein EF2996 {Entero | 0.001 | |
| d1dgwa_ | 178 | b.82.1.2 (A:) Seed storage 7S protein {Jack bean ( | 0.003 | |
| g1dgw.1 | 168 | b.82.1.2 (X:,Y:) Seed storage 7S protein {Jack bea | 0.003 |
| >d1o5ua_ b.82.1.8 (A:) Hypothetical protein TM1112 {Thermotoga maritima [TaxId: 2336]} Length = 88 | Back information, alignment and structure |
|---|
class: All beta proteins fold: Double-stranded beta-helix superfamily: RmlC-like cupins family: Hypothetical protein TM1112 domain: Hypothetical protein TM1112 species: Thermotoga maritima [TaxId: 2336]
Score = 110 bits (276), Expect = 3e-33
Identities = 43/88 (48%), Positives = 53/88 (60%), Gaps = 2/88 (2%)
Query: 60 VKIEKNPPQSKLSELGVTSWPKWGCPPSKFPWTFTATETMYLLEGKVIVYVDGREGSFEI 119
VKIEK P KL EL V WP W S+F W + ET Y+LEGKV V + + + I
Sbjct: 2 VKIEK-PTPEKLKELSVEKWPIWEKEVSEFDWYYDTNETCYILEGKVEVTTEDGK-KYVI 59
Query: 120 GTGDLVVFPKGMKITWDVIEAVNKHYSL 147
GDLV FPKG++ W V+E V KHY+L
Sbjct: 60 EKGDLVTFPKGLRCRWKVLEPVRKHYNL 87
|
| >d2pyta1 b.82.1.24 (A:100-227) Ethanolamine utilization protein EutQ {Salmonella typhimurium [TaxId: 90371]} Length = 128 | Back information, alignment and structure |
|---|
| >d1j58a_ b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {Bacillus subtilis [TaxId: 1423]} Length = 372 | Back information, alignment and structure |
|---|
| >d1j58a_ b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {Bacillus subtilis [TaxId: 1423]} Length = 372 | Back information, alignment and structure |
|---|
| >d1uija1 b.82.1.2 (A:6-175) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin beta subunit [TaxId: 3847]} Length = 170 | Back information, alignment and structure |
|---|
| >d1y3ta1 b.82.1.5 (A:5-334) Hypothetical protein YxaG {Bacillus subtilis [TaxId: 1423]} Length = 330 | Back information, alignment and structure |
|---|
| >d1uika1 b.82.1.2 (A:148-350) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]} Length = 203 | Back information, alignment and structure |
|---|
| >d1sq4a_ b.82.1.11 (A:) Glyoxylate-induced protein PA1140 {Pseudomonas aeruginosa [TaxId: 287]} Length = 273 | Back information, alignment and structure |
|---|
| >d1sq4a_ b.82.1.11 (A:) Glyoxylate-induced protein PA1140 {Pseudomonas aeruginosa [TaxId: 287]} Length = 273 | Back information, alignment and structure |
|---|
| >d1sefa_ b.82.1.11 (A:) Hypothetical protein EF2996 {Enterococcus faecalis [TaxId: 1351]} Length = 250 | Back information, alignment and structure |
|---|
| >d1dgwa_ b.82.1.2 (A:) Seed storage 7S protein {Jack bean (Canavalia ensiformis), canavalin/vinculin [TaxId: 3823]} Length = 178 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 149 | |||
| d1o5ua_ | 88 | Hypothetical protein TM1112 {Thermotoga maritima [ | 99.97 | |
| d2pyta1 | 128 | Ethanolamine utilization protein EutQ {Salmonella | 99.71 | |
| d1v70a_ | 105 | Hypothetical protein TTHA0104 {Thermus thermophilu | 98.96 | |
| d2b8ma1 | 108 | Hypothetical protein MJ0764 {Archaeon Methanococcu | 98.95 | |
| d1yhfa1 | 112 | Hypothetical protein SPy1581 {Streptococcus pyogen | 98.9 | |
| d1vj2a_ | 114 | Hypothetical protein TM1459 {Thermotoga maritima [ | 98.83 | |
| d1y9qa2 | 99 | Probable transcriptional regulator VC1968, C-termi | 98.78 | |
| d1o4ta_ | 115 | Hypothetical protein TM1287 {Thermotoga maritima [ | 98.71 | |
| d1y3ta1 | 330 | Hypothetical protein YxaG {Bacillus subtilis [TaxI | 98.68 | |
| d1y3ta1 | 330 | Hypothetical protein YxaG {Bacillus subtilis [TaxI | 98.64 | |
| d1dgwa_ | 178 | Seed storage 7S protein {Jack bean (Canavalia ensi | 98.6 | |
| d2bnma2 | 122 | Hydroxypropylphosphonic acid epoxidase Fom4, C-ter | 98.56 | |
| d1juha_ | 348 | Quercetin 2,3-dioxygenase {Aspergillus japonicus [ | 98.56 | |
| d1juha_ | 348 | Quercetin 2,3-dioxygenase {Aspergillus japonicus [ | 98.54 | |
| d1uika1 | 203 | Seed storage 7S protein {Soybean (Glycine max), be | 98.52 | |
| d1rc6a_ | 253 | Hypothetical protein YlbA {Escherichia coli [TaxId | 98.52 | |
| d1uija1 | 170 | Seed storage 7S protein {Soybean (Glycine max), be | 98.47 | |
| d1lr5a_ | 160 | Auxin binding protein {Maize (Zea mays) [TaxId: 45 | 98.46 | |
| d1sefa_ | 250 | Hypothetical protein EF2996 {Enterococcus faecalis | 98.44 | |
| d2f4pa1 | 134 | Hypothetical protein TM1010 {Thermotoga maritima [ | 98.44 | |
| d1sq4a_ | 273 | Glyoxylate-induced protein PA1140 {Pseudomonas aer | 98.42 | |
| d1sfna_ | 245 | Hypothetical protein DR1152 {Deinococcus radiodura | 98.41 | |
| g1dgw.1 | 168 | Seed storage 7S protein {Jack bean (Canavalia ensi | 98.39 | |
| d1sfna_ | 245 | Hypothetical protein DR1152 {Deinococcus radiodura | 98.35 | |
| d1fxza2 | 174 | Seed storage 7S protein {Soybean (Glycine max), pr | 98.34 | |
| d1sefa_ | 250 | Hypothetical protein EF2996 {Enterococcus faecalis | 98.34 | |
| d1j58a_ | 372 | Oxalate decarboxylase OxdC (YvrK) {Bacillus subtil | 98.31 | |
| d1od5a2 | 173 | Seed storage 7S protein {Soybean (Glycine max), gl | 98.27 | |
| d1x82a_ | 190 | Glucose-6-phosphate isomerase, GPI {Archaeon Pyroc | 98.26 | |
| d1rc6a_ | 253 | Hypothetical protein YlbA {Escherichia coli [TaxId | 98.22 | |
| d2et1a1 | 201 | Germin {Barley (Hordeum vulgare) [TaxId: 4513]} | 98.21 | |
| d1sq4a_ | 273 | Glyoxylate-induced protein PA1140 {Pseudomonas aer | 98.11 | |
| d1uika2 | 185 | Seed storage 7S protein {Soybean (Glycine max), be | 98.1 | |
| d2phla2 | 162 | Seed storage 7S protein {French bean (Phaseolus vu | 98.06 | |
| d2phla1 | 200 | Seed storage 7S protein {French bean (Phaseolus vu | 98.05 | |
| d2d40a1 | 308 | Gentisate 1,2-dioxygenase {Escherichia coli [TaxId | 98.05 | |
| d2d40a1 | 308 | Gentisate 1,2-dioxygenase {Escherichia coli [TaxId | 98.02 | |
| d2arca_ | 161 | Regulatory protein AraC {Escherichia coli [TaxId: | 97.98 | |
| d1j58a_ | 372 | Oxalate decarboxylase OxdC (YvrK) {Bacillus subtil | 97.91 | |
| d3bu7a1 | 355 | Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [ | 97.72 | |
| d1zrra1 | 179 | Acireductone dioxygenase {Klebsiella pneumoniae [T | 97.65 | |
| d1vr3a1 | 179 | Acireductone dioxygenase {Mouse (Mus musculus) [Ta | 97.63 | |
| d2phda1 | 351 | Gentisate 1,2-dioxygenase {Pseudaminobacter salicy | 97.6 | |
| d2phda1 | 351 | Gentisate 1,2-dioxygenase {Pseudaminobacter salicy | 97.58 | |
| d2oyza1 | 93 | Uncharacterized protein VPA0057 {Vibrio parahaemol | 97.56 | |
| d3bu7a1 | 355 | Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [ | 97.22 | |
| d1eyba_ | 439 | Homogentisate dioxygenase {Human (Homo sapiens) [T | 97.17 | |
| d1fxza1 | 239 | Seed storage 7S protein {Soybean (Glycine max), pr | 96.71 | |
| d1yfua1 | 174 | 3-hydroxyanthranilate-3,4-dioxygenase {Ralstonia m | 96.58 | |
| d2o1qa1 | 144 | Putative acetyl/propionyl-CoA carboxylase subunit | 96.46 | |
| d1od5a1 | 245 | Seed storage 7S protein {Soybean (Glycine max), gl | 96.33 | |
| d1zvfa1 | 175 | 3-hydroxyanthranilate-3,4-dioxygenase {Baker's yea | 96.29 | |
| d1qwra_ | 315 | Mannose-6-phosphate isomerase ManA {Bacillus subti | 96.26 | |
| d2pa7a1 | 135 | dTDP-6-deoxy-3,4-keto-hexulose isomerase FdtA {Ane | 94.85 | |
| d1pmia_ | 440 | Phosphomannose isomerase {Yeast (Candida albicans) | 94.54 | |
| d1zx5a1 | 299 | Putative mannosephosphate isomerase AF0035 {Archae | 93.1 | |
| d1vrba1 | 319 | Putative asparaginyl hydroxylase YxbC {Bacillus su | 92.01 | |
| d1h2ka_ | 335 | Hypoxia-inducible factor HIF ihhibitor (FIH1) {Hum | 91.31 | |
| d1q3ea_ | 193 | HCN pacemaker channel {Mouse (Mus musculus) [TaxId | 88.26 | |
| d1ne6a1 | 136 | Regulatory subunit of Protein kinase A {Cow (Bos t | 87.81 | |
| d1ywka1 | 260 | 5-keto-4-deoxyuronate isomerase KduI {Enterococcus | 87.47 | |
| d1tq5a1 | 231 | Hypothetical protein YhhW {Escherichia coli [TaxId | 86.12 | |
| d1xrua1 | 277 | 5-keto-4-deoxyuronate isomerase KduI {Escherichia | 83.51 | |
| d1o7fa3 | 124 | Regulatory domain of Epac2, domains 1 and 3 {Mouse | 83.17 | |
| d3dl3a1 | 96 | Tellurite resistance protein B, TehB {Vibrio fisch | 81.93 |
| >d1o5ua_ b.82.1.8 (A:) Hypothetical protein TM1112 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: Double-stranded beta-helix superfamily: RmlC-like cupins family: Hypothetical protein TM1112 domain: Hypothetical protein TM1112 species: Thermotoga maritima [TaxId: 2336]
Probab=99.97 E-value=4.8e-31 Score=185.75 Aligned_cols=87 Identities=49% Similarity=0.917 Sum_probs=83.4
Q ss_pred eEEEeeCCChhhhhhcCCceeeeEecCCccccccCCCceEEEEEEeEEEEEECCcceEEEEcCCcEEEEcCCcEEEEEEc
Q 031987 59 GVKIEKNPPQSKLSELGVTSWPKWGCPPSKFPWTFTATETMYLLEGKVIVYVDGREGSFEIGTGDLVVFPKGMKITWDVI 138 (149)
Q Consensus 59 ~V~i~~~ps~~~L~~lGv~~~giWe~~pg~f~~h~~~dE~~yVLEG~v~vt~dgg~~~~~i~aGD~v~~PkG~~~tW~v~ 138 (149)
+|+|++ |++++|.++|+.+||+|+|+||+|+|+|++||+||||||+++++.+|| ++++++|||+++||+|+.++|++.
T Consensus 1 ~i~i~~-~~~~~l~~lGv~~~gvW~~~pg~f~~~y~~~E~~~ileG~v~i~~~~G-~~~~~~aGD~~~~p~G~~~~W~v~ 78 (88)
T d1o5ua_ 1 EVKIEK-PTPEKLKELSVEKWPIWEKEVSEFDWYYDTNETCYILEGKVEVTTEDG-KKYVIEKGDLVTFPKGLRCRWKVL 78 (88)
T ss_dssp CCEEEC-CCHHHHHHHTGGGSCEEEECSEEEEEECSSCEEEEEEEEEEEEEETTC-CEEEEETTCEEEECTTCEEEEEEE
T ss_pred CcEEec-CCHHHHHhcCCcccceEeecCcEEEEEcCccEEEEEEEeEEEEEcCCC-CEEEEeCCCEEEECCCCEEEEEEC
Confidence 478887 699999999999999999999999999999999999999999999988 889999999999999999999999
Q ss_pred CceEEEEEe
Q 031987 139 EAVNKHYSL 147 (149)
Q Consensus 139 e~vrK~Yvi 147 (149)
+++||+|++
T Consensus 79 e~v~K~yvi 87 (88)
T d1o5ua_ 79 EPVRKHYNL 87 (88)
T ss_dssp EEEEEEEEE
T ss_pred ceEEEEEEe
Confidence 999999986
|
| >d2pyta1 b.82.1.24 (A:100-227) Ethanolamine utilization protein EutQ {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1v70a_ b.82.1.9 (A:) Hypothetical protein TTHA0104 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2b8ma1 b.82.1.18 (A:1-108) Hypothetical protein MJ0764 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1yhfa1 b.82.1.9 (A:1-112) Hypothetical protein SPy1581 {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1vj2a_ b.82.1.10 (A:) Hypothetical protein TM1459 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1y9qa2 b.82.1.15 (A:83-181) Probable transcriptional regulator VC1968, C-terminal domain {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1o4ta_ b.82.1.9 (A:) Hypothetical protein TM1287 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1y3ta1 b.82.1.5 (A:5-334) Hypothetical protein YxaG {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1y3ta1 b.82.1.5 (A:5-334) Hypothetical protein YxaG {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1dgwa_ b.82.1.2 (A:) Seed storage 7S protein {Jack bean (Canavalia ensiformis), canavalin/vinculin [TaxId: 3823]} | Back information, alignment and structure |
|---|
| >d2bnma2 b.82.1.10 (A:77-198) Hydroxypropylphosphonic acid epoxidase Fom4, C-terminal domain {Streptomyces wedmorensis [TaxId: 43759]} | Back information, alignment and structure |
|---|
| >d1juha_ b.82.1.5 (A:) Quercetin 2,3-dioxygenase {Aspergillus japonicus [TaxId: 34381]} | Back information, alignment and structure |
|---|
| >d1juha_ b.82.1.5 (A:) Quercetin 2,3-dioxygenase {Aspergillus japonicus [TaxId: 34381]} | Back information, alignment and structure |
|---|
| >d1uika1 b.82.1.2 (A:148-350) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1rc6a_ b.82.1.11 (A:) Hypothetical protein YlbA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1uija1 b.82.1.2 (A:6-175) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin beta subunit [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1lr5a_ b.82.1.2 (A:) Auxin binding protein {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1sefa_ b.82.1.11 (A:) Hypothetical protein EF2996 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2f4pa1 b.82.1.9 (A:2-135) Hypothetical protein TM1010 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1sq4a_ b.82.1.11 (A:) Glyoxylate-induced protein PA1140 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1sfna_ b.82.1.11 (A:) Hypothetical protein DR1152 {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d1sfna_ b.82.1.11 (A:) Hypothetical protein DR1152 {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d1fxza2 b.82.1.2 (A:297-470) Seed storage 7S protein {Soybean (Glycine max), proglycinin [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1sefa_ b.82.1.11 (A:) Hypothetical protein EF2996 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1j58a_ b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1od5a2 b.82.1.2 (A:321-493) Seed storage 7S protein {Soybean (Glycine max), glycinin A3B4 [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1x82a_ b.82.1.7 (A:) Glucose-6-phosphate isomerase, GPI {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1rc6a_ b.82.1.11 (A:) Hypothetical protein YlbA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2et1a1 b.82.1.2 (A:1-201) Germin {Barley (Hordeum vulgare) [TaxId: 4513]} | Back information, alignment and structure |
|---|
| >d1sq4a_ b.82.1.11 (A:) Glyoxylate-induced protein PA1140 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1uika2 b.82.1.2 (A:351-535) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d2phla2 b.82.1.2 (A:220-381) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d2phla1 b.82.1.2 (A:11-210) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d2d40a1 b.82.1.23 (A:35-342) Gentisate 1,2-dioxygenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2d40a1 b.82.1.23 (A:35-342) Gentisate 1,2-dioxygenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2arca_ b.82.4.1 (A:) Regulatory protein AraC {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1j58a_ b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d3bu7a1 b.82.1.23 (A:19-373) Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [TaxId: 89184]} | Back information, alignment and structure |
|---|
| >d1zrra1 b.82.1.6 (A:1-179) Acireductone dioxygenase {Klebsiella pneumoniae [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d1vr3a1 b.82.1.6 (A:1-179) Acireductone dioxygenase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2phda1 b.82.1.23 (A:17-367) Gentisate 1,2-dioxygenase {Pseudaminobacter salicylatoxidans [TaxId: 93369]} | Back information, alignment and structure |
|---|
| >d2phda1 b.82.1.23 (A:17-367) Gentisate 1,2-dioxygenase {Pseudaminobacter salicylatoxidans [TaxId: 93369]} | Back information, alignment and structure |
|---|
| >d2oyza1 b.82.1.22 (A:2-94) Uncharacterized protein VPA0057 {Vibrio parahaemolyticus [TaxId: 670]} | Back information, alignment and structure |
|---|
| >d3bu7a1 b.82.1.23 (A:19-373) Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [TaxId: 89184]} | Back information, alignment and structure |
|---|
| >d1eyba_ b.82.1.4 (A:) Homogentisate dioxygenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fxza1 b.82.1.2 (A:10-248) Seed storage 7S protein {Soybean (Glycine max), proglycinin [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1yfua1 b.82.1.20 (A:1-174) 3-hydroxyanthranilate-3,4-dioxygenase {Ralstonia metallidurans [TaxId: 119219]} | Back information, alignment and structure |
|---|
| >d2o1qa1 b.82.1.21 (A:1-144) Putative acetyl/propionyl-CoA carboxylase subunit alpha Mpe_A3659 {Rubrivivax gelatinosus [TaxId: 28068]} | Back information, alignment and structure |
|---|
| >d1od5a1 b.82.1.2 (A:7-251) Seed storage 7S protein {Soybean (Glycine max), glycinin A3B4 [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1zvfa1 b.82.1.20 (A:1-175) 3-hydroxyanthranilate-3,4-dioxygenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1qwra_ b.82.1.3 (A:) Mannose-6-phosphate isomerase ManA {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2pa7a1 b.82.1.1 (A:2-136) dTDP-6-deoxy-3,4-keto-hexulose isomerase FdtA {Aneurinibacillus thermoaerophilus [TaxId: 143495]} | Back information, alignment and structure |
|---|
| >d1pmia_ b.82.1.3 (A:) Phosphomannose isomerase {Yeast (Candida albicans) [TaxId: 5476]} | Back information, alignment and structure |
|---|
| >d1zx5a1 b.82.1.3 (A:1-299) Putative mannosephosphate isomerase AF0035 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1vrba1 b.82.2.11 (A:8-326) Putative asparaginyl hydroxylase YxbC {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1h2ka_ b.82.2.6 (A:) Hypoxia-inducible factor HIF ihhibitor (FIH1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q3ea_ b.82.3.2 (A:) HCN pacemaker channel {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ne6a1 b.82.3.2 (A:109-244) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1ywka1 b.82.1.13 (A:1001-1260) 5-keto-4-deoxyuronate isomerase KduI {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1tq5a1 b.82.1.12 (A:1-231) Hypothetical protein YhhW {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xrua1 b.82.1.13 (A:1-277) 5-keto-4-deoxyuronate isomerase KduI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1o7fa3 b.82.3.2 (A:322-445) Regulatory domain of Epac2, domains 1 and 3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d3dl3a1 b.82.2.13 (A:5-100) Tellurite resistance protein B, TehB {Vibrio fischeri [TaxId: 668]} | Back information, alignment and structure |
|---|