Citrus Sinensis ID: 032027

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------15
MLDILEWTLDVIGVTYRRLDGSTQVTERQAIVDAFNNDTSIFACLLSTRAGGQGLNLTGADTVVIHDMDFNPQIDRQAEDRCHRIGQTRPVTIYRLVTKGTVDENVYEIAKRKLILDAAVLESGVEVDNEGDTSDKTMGEILSSILMG
cHHHHHHHHHHcccEEEEEcccccHHHHHHHHHHHccccccEEEEEEccccccccccccccEEEEEcccccccHHHHHHHHHHHccccccEEEEEEEccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHcc
ccHHHHHHHHHcccEEEEEcccccHHHHHHHHHHHcccccEEEEEEEccccccEEEEccccEEEEEEccccHHHHHHHHHHHHHccccccEEEEEEEEcccHHHHHHHHHHHHHHHcHEEEEccccccccccccHHHHHHHHHHHHcc
MLDILEWTLDVIGVTyrrldgstqvTERQAIVDAFNNDTSIFACLLStraggqglnltgadtvvihdmdfnpqidrqaedrchrigqtrpVTIYRLVTKGTVDENVYEIAKRKLILDAAVLEsgvevdnegdtsdkTMGEILSSILMG
MLDILEWTLDVIGvtyrrldgstqVTERQAIVDAFNNDTSIFACLLSTRAGGQGLNLTGADTVVIHDMDFNPQIDRqaedrchrigqtrpvtiyrlvtkgtvdenvYEIAKRKLIldaavlesgvevdnegdtsdktmGEILSSILMG
MLDILEWTLDVIGVTYRRLDGSTQVTERQAIVDAFNNDTSIFACLLSTRAGGQGLNLTGADTVVIHDMDFNPQIDRQAEDRCHRIGQTRPVTIYRLVTKGTVDENVYEIAKRKLILDAAVLESGVEVDNEGDTSDKTMGEILSSILMG
**DILEWTLDVIGVTYRRLDGSTQVTERQAIVDAFNNDTSIFACLLSTRAGGQGLNLTGADTVVIHDMDFNPQIDRQAEDRCHRIGQTRPVTIYRLVTKGTVDENVYEIAKRKLILDAAVLESGV***********************
MLDILEWTLDVIGVTYRRLDGSTQVTERQAIVDAFNNDTSIFACLLSTRAGGQGLNLTGADTVVIHDMDFNPQIDRQAEDRCHRIGQTRPVTIYRLVTKGTVDENVYEIAKRKLILDAAV*********************LSSILMG
MLDILEWTLDVIGVTYRRLDGSTQVTERQAIVDAFNNDTSIFACLLSTRAGGQGLNLTGADTVVIHDMDFNPQIDRQAEDRCHRIGQTRPVTIYRLVTKGTVDENVYEIAKRKLILDAAVLESGVEVDNEGDTSDKTMGEILSSILMG
MLDILEWTLDVIGVTYRRLDGSTQVTERQAIVDAFNNDTSIFACLLSTRAGGQGLNLTGADTVVIHDMDFNPQIDRQAEDRCHRIGQTRPVTIYRLVTKGTVDENVYEIAKRKLILDAAVLESGVEVD**GDTSDKTMGEILSSILMG
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLDILEWTLDVIGVTYRRLDGSTQVTERQAIVDAFNNDTSIFACLLSTRAGGQGLNLTGADTVVIHDMDFNPQIDRQAEDRCHRIGQTRPVTIYRLVTKGTVDENVYEIAKRKLILDAAVLESGVEVDNEGDTSDKTMGEILSSILMG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query148 2.2.26 [Sep-21-2011]
Q6ZRS2 3230 Helicase SRCAP OS=Homo sa yes no 0.837 0.038 0.564 3e-35
Q4WAS9 1695 Helicase swr1 OS=Neosarto yes no 0.837 0.073 0.532 1e-34
Q5ARK3 1698 Helicase swr1 OS=Emericel yes no 0.837 0.073 0.532 1e-34
Q4IAK7 1691 Helicase SWR1 OS=Gibberel yes no 0.837 0.073 0.540 3e-34
Q7S133 1845 Helicase swr-1 OS=Neurosp N/A no 0.837 0.067 0.532 4e-34
Q6CA87 1772 Helicase SWR1 OS=Yarrowia yes no 0.837 0.069 0.508 2e-33
Q9NDJ2 3198 Helicase domino OS=Drosop yes no 0.837 0.038 0.540 3e-33
G5EDG2989 SWI/SNF-related matrix-as yes no 0.824 0.123 0.540 3e-33
Q9VL72844 SWI/SNF-related matrix-as no no 0.810 0.142 0.558 5e-33
O13682 1288 Helicase swr1 OS=Schizosa yes no 0.837 0.096 0.532 1e-32
>sp|Q6ZRS2|SRCAP_HUMAN Helicase SRCAP OS=Homo sapiens GN=SRCAP PE=1 SV=3 Back     alignment and function desciption
 Score =  146 bits (369), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 70/124 (56%), Positives = 92/124 (74%)

Query: 1    MLDILEWTLDVIGVTYRRLDGSTQVTERQAIVDAFNNDTSIFACLLSTRAGGQGLNLTGA 60
            MLD+LE  L   G  Y RLDGST+V +RQA+++ FN D  IF  +LSTR+GG G+NLTGA
Sbjct: 2071 MLDVLEQFLTYHGHLYLRLDGSTRVEQRQALMERFNADKRIFCFILSTRSGGVGVNLTGA 2130

Query: 61   DTVVIHDMDFNPQIDRQAEDRCHRIGQTRPVTIYRLVTKGTVDENVYEIAKRKLILDAAV 120
            DTVV +D D+NP +D QA+DRCHRIGQTR V IYRL+++ TV+EN+ + A +K +L    
Sbjct: 2131 DTVVFYDSDWNPTMDAQAQDRCHRIGQTRDVHIYRLISERTVEENILKKANQKRMLGDMA 2190

Query: 121  LESG 124
            +E G
Sbjct: 2191 IEGG 2194
Catalytic component of the SRCAP complex which mediates the ATP-dependent exchange of histone H2AZ/H2B dimers for nucleosomal H2A/H2B, leading to transcriptional regulation of selected genes by chromatin remodeling. Acts as a coactivator for CREB-mediated transcription, steroid receptor-mediated transcription, and Notch-mediated transcription.
Homo sapiens (taxid: 9606)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: -
>sp|Q4WAS9|SWR1_ASPFU Helicase swr1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=swr1 PE=3 SV=1 Back     alignment and function description
>sp|Q5ARK3|SWR1_EMENI Helicase swr1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=swr1 PE=3 SV=2 Back     alignment and function description
>sp|Q4IAK7|SWR1_GIBZE Helicase SWR1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=SWR1 PE=3 SV=1 Back     alignment and function description
>sp|Q7S133|SWR1_NEUCR Helicase swr-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=swr-1 PE=3 SV=1 Back     alignment and function description
>sp|Q6CA87|SWR1_YARLI Helicase SWR1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SWR1 PE=3 SV=1 Back     alignment and function description
>sp|Q9NDJ2|DOM_DROME Helicase domino OS=Drosophila melanogaster GN=dom PE=1 SV=2 Back     alignment and function description
>sp|G5EDG2|SMRCD_CAEEL SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 homolog OS=Caenorhabditis elegans GN=M03C11.8 PE=3 SV=1 Back     alignment and function description
>sp|Q9VL72|SMRCD_DROME SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 homolog OS=Drosophila melanogaster GN=Etl1 PE=1 SV=1 Back     alignment and function description
>sp|O13682|SWR1_SCHPO Helicase swr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=swr1 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query148
255561731 756 ATP binding protein, putative [Ricinus c 1.0 0.195 0.932 4e-76
449445276 741 PREDICTED: SWI/SNF-related matrix-associ 1.0 0.199 0.905 4e-75
359473688 728 PREDICTED: helicase SWR1-like [Vitis vin 1.0 0.203 0.912 2e-73
229914880 768 SWI/SNF helicase-like protein [Eutrema h 1.0 0.192 0.885 2e-73
15226870 763 SNF2 and helicase domain-containing prot 1.0 0.193 0.885 2e-73
297814462 764 CHR19/ETL1 [Arabidopsis lyrata subsp. ly 1.0 0.193 0.885 2e-73
224108163 752 chromatin remodeling complex subunit [Po 0.979 0.192 0.925 3e-73
356521080 754 PREDICTED: helicase swr1-like [Glycine m 0.993 0.194 0.885 8e-71
356577572 752 PREDICTED: helicase SWR1-like [Glycine m 0.993 0.195 0.871 9e-70
312190395 763 unknown [Eutrema parvulum] 0.986 0.191 0.858 1e-68
>gi|255561731|ref|XP_002521875.1| ATP binding protein, putative [Ricinus communis] gi|223538913|gb|EEF40511.1| ATP binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  288 bits (738), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 138/148 (93%), Positives = 144/148 (97%)

Query: 1   MLDILEWTLDVIGVTYRRLDGSTQVTERQAIVDAFNNDTSIFACLLSTRAGGQGLNLTGA 60
           MLDILEWTLDVIG+TYRRLDGST VTERQ IVDAFNNDTSIFACLLSTRAGGQGLNLTGA
Sbjct: 609 MLDILEWTLDVIGLTYRRLDGSTPVTERQTIVDAFNNDTSIFACLLSTRAGGQGLNLTGA 668

Query: 61  DTVVIHDMDFNPQIDRQAEDRCHRIGQTRPVTIYRLVTKGTVDENVYEIAKRKLILDAAV 120
           DTVVIHDMDFNPQIDRQAEDRCHRIGQT+PVTIYRLVTKGTVDEN+YEIAKRKL LDAAV
Sbjct: 669 DTVVIHDMDFNPQIDRQAEDRCHRIGQTKPVTIYRLVTKGTVDENIYEIAKRKLTLDAAV 728

Query: 121 LESGVEVDNEGDTSDKTMGEILSSILMG 148
           LESGVEVD+ GDTS+KTMGEILSS+LMG
Sbjct: 729 LESGVEVDDAGDTSEKTMGEILSSLLMG 756

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|449445276|ref|XP_004140399.1| PREDICTED: SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1B-like [Cucumis sativus] gi|449487891|ref|XP_004157852.1| PREDICTED: SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1B-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|359473688|ref|XP_003631348.1| PREDICTED: helicase SWR1-like [Vitis vinifera] gi|297738311|emb|CBI27512.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|229914880|gb|ACQ90605.1| SWI/SNF helicase-like protein [Eutrema halophilum] Back     alignment and taxonomy information
>gi|15226870|ref|NP_178318.1| SNF2 and helicase domain-containing protein [Arabidopsis thaliana] gi|4038042|gb|AAC97224.1| putative helicase [Arabidopsis thaliana] gi|16648975|gb|AAL24339.1| SNF2/RAD54 family (ETL1 subfamily) protein [Arabidopsis thaliana] gi|27311941|gb|AAO00936.1| SNF2/RAD54 family (ETL1 subfamily) protein [Arabidopsis thaliana] gi|330250451|gb|AEC05545.1| SNF2 and helicase domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297814462|ref|XP_002875114.1| CHR19/ETL1 [Arabidopsis lyrata subsp. lyrata] gi|297320952|gb|EFH51373.1| CHR19/ETL1 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|224108163|ref|XP_002314744.1| chromatin remodeling complex subunit [Populus trichocarpa] gi|222863784|gb|EEF00915.1| chromatin remodeling complex subunit [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356521080|ref|XP_003529186.1| PREDICTED: helicase swr1-like [Glycine max] Back     alignment and taxonomy information
>gi|356577572|ref|XP_003556898.1| PREDICTED: helicase SWR1-like [Glycine max] Back     alignment and taxonomy information
>gi|312190395|gb|ADQ43195.1| unknown [Eutrema parvulum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query148
TAIR|locus:2051678763 ETL1 [Arabidopsis thaliana (ta 1.0 0.193 0.885 7.2e-68
TAIR|locus:2087780 2055 PIE1 "PHOTOPERIOD-INDEPENDENT 0.871 0.062 0.523 9.2e-32
ASPGD|ASPL0000041040 1698 AN9077 [Emericella nidulans (t 0.837 0.073 0.532 1.9e-31
DICTYBASE|DDB_G0267638 3069 DDB_G0267638 "CHR group protei 0.837 0.040 0.540 4.1e-31
UNIPROTKB|J9P9W7 1470 SRCAP "Uncharacterized protein 0.837 0.084 0.564 4.1e-31
DICTYBASE|DDB_G02675561159 DDB_G0267556 "CHR group protei 0.979 0.125 0.503 5.9e-31
RGD|1565642 3182 Srcap "Snf2-related CREBBP act 0.837 0.038 0.564 1.1e-30
UNIPROTKB|Q6ZRS2 3230 SRCAP "Helicase SRCAP" [Homo s 0.837 0.038 0.564 1.1e-30
UNIPROTKB|F1RG74 3230 SRCAP "Uncharacterized protein 0.837 0.038 0.564 1.1e-30
UNIPROTKB|E1BC33 3242 LOC788113 "Uncharacterized pro 0.837 0.038 0.564 1.2e-30
TAIR|locus:2051678 ETL1 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 689 (247.6 bits), Expect = 7.2e-68, P = 7.2e-68
 Identities = 131/148 (88%), Positives = 141/148 (95%)

Query:     1 MLDILEWTLDVIGVTYRRLDGSTQVTERQAIVDAFNNDTSIFACLLSTRAGGQGLNLTGA 60
             MLDILEWTLDVIGVTYRRLDGSTQVT+RQ IVD FNND SIFACLLSTRAGGQGLNLTGA
Sbjct:   616 MLDILEWTLDVIGVTYRRLDGSTQVTDRQTIVDTFNNDKSIFACLLSTRAGGQGLNLTGA 675

Query:    61 DTVVIHDMDFNPQIDRQAEDRCHRIGQTRPVTIYRLVTKGTVDENVYEIAKRKLILDAAV 120
             DTV+IHDMDFNPQIDRQAEDRCHRIGQT+PVTI+RLVTK TVDEN+YEIAKRKL+LDAAV
Sbjct:   676 DTVIIHDMDFNPQIDRQAEDRCHRIGQTKPVTIFRLVTKSTVDENIYEIAKRKLVLDAAV 735

Query:   121 LESGVEVDNEGDTSDKTMGEILSSILMG 148
             LESGV VD+ GDT +KTMGEIL+S+LMG
Sbjct:   736 LESGVHVDDNGDTPEKTMGEILASLLMG 763
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0003677 "DNA binding" evidence=IEA;ISS
GO:0004386 "helicase activity" evidence=IEA;ISS
GO:0005524 "ATP binding" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=ISM
TAIR|locus:2087780 PIE1 "PHOTOPERIOD-INDEPENDENT EARLY FLOWERING 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ASPGD|ASPL0000041040 AN9077 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0267638 DDB_G0267638 "CHR group protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|J9P9W7 SRCAP "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0267556 DDB_G0267556 "CHR group protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
RGD|1565642 Srcap "Snf2-related CREBBP activator protein" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q6ZRS2 SRCAP "Helicase SRCAP" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1RG74 SRCAP "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E1BC33 LOC788113 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query148
PLN03142 1033 PLN03142, PLN03142, Probable chromatin-remodeling 4e-39
COG0553866 COG0553, HepA, Superfamily II DNA/RNA helicases, S 2e-37
pfam0027178 pfam00271, Helicase_C, Helicase conserved C-termin 4e-20
smart0049082 smart00490, HELICc, helicase superfamily c-termina 1e-19
cd00079131 cd00079, HELICc, Helicase superfamily c-terminal d 2e-17
COG1111542 COG1111, MPH1, ERCC4-like helicases [DNA replicati 0.003
>gnl|CDD|215601 PLN03142, PLN03142, Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information 
 Score =  139 bits (352), Expect = 4e-39
 Identities = 64/125 (51%), Positives = 85/125 (68%), Gaps = 1/125 (0%)

Query: 1   MLDILEWTLDVIGVTYRRLDGSTQVTERQAIVDAFNNDTS-IFACLLSTRAGGQGLNLTG 59
           +LDILE  L   G  Y R+DG+T   +R A +DAFN   S  F  LLSTRAGG G+NL  
Sbjct: 499 LLDILEDYLMYRGYQYCRIDGNTGGEDRDASIDAFNKPGSEKFVFLLSTRAGGLGINLAT 558

Query: 60  ADTVVIHDMDFNPQIDRQAEDRCHRIGQTRPVTIYRLVTKGTVDENVYEIAKRKLILDAA 119
           AD V+++D D+NPQ+D QA+DR HRIGQ + V ++R  T+ T++E V E A +KL LDA 
Sbjct: 559 ADIVILYDSDWNPQVDLQAQDRAHRIGQKKEVQVFRFCTEYTIEEKVIERAYKKLALDAL 618

Query: 120 VLESG 124
           V++ G
Sbjct: 619 VIQQG 623

Length = 1033
>gnl|CDD|223627 COG0553, HepA, Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|201125 pfam00271, Helicase_C, Helicase conserved C-terminal domain Back     alignment and domain information
>gnl|CDD|197757 smart00490, HELICc, helicase superfamily c-terminal domain Back     alignment and domain information
>gnl|CDD|238034 cd00079, HELICc, Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>gnl|CDD|224036 COG1111, MPH1, ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 148
KOG0384 1373 consensus Chromodomain-helicase DNA-binding protei 100.0
PLN03142 1033 Probable chromatin-remodeling complex ATPase chain 100.0
KOG0390776 consensus DNA repair protein, SNF2 family [Replica 99.98
KOG0385 971 consensus Chromatin remodeling complex WSTF-ISWI, 99.98
KOG0387 923 consensus Transcription-coupled repair protein CSB 99.98
KOG0389941 consensus SNF2 family DNA-dependent ATPase [Chroma 99.98
KOG0391 1958 consensus SNF2 family DNA-dependent ATPase [Genera 99.97
KOG03921549 consensus SNF2 family DNA-dependent ATPase domain- 99.97
KOG1002791 consensus Nucleotide excision repair protein RAD16 99.97
KOG03881185 consensus SNF2 family DNA-dependent ATPase [Replic 99.95
KOG4439901 consensus RNA polymerase II transcription terminat 99.94
COG0553866 HepA Superfamily II DNA/RNA helicases, SNF2 family 99.93
PRK04914 956 ATP-dependent helicase HepA; Validated 99.93
KOG1015 1567 consensus Transcription regulator XNP/ATRX, DEAD-b 99.92
KOG1000689 consensus Chromatin remodeling protein HARP/SMARCA 99.92
KOG0386 1157 consensus Chromatin remodeling complex SWI/SNF, co 99.9
KOG1001674 consensus Helicase-like transcription factor HLTF/ 99.87
KOG1016 1387 consensus Predicted DNA helicase, DEAD-box superfa 99.84
PF0027178 Helicase_C: Helicase conserved C-terminal domain; 99.82
smart0049082 HELICc helicase superfamily c-terminal domain. 99.76
cd00079131 HELICc Helicase superfamily c-terminal domain; ass 99.72
PRK13766 773 Hef nuclease; Provisional 99.71
KOG0328400 consensus Predicted ATP-dependent RNA helicase FAL 99.63
TIGR00603732 rad25 DNA repair helicase rad25. All proteins in t 99.61
PTZ00110545 helicase; Provisional 99.61
KOG0331519 consensus ATP-dependent RNA helicase [RNA processi 99.6
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 99.58
COG0513513 SrmB Superfamily II DNA and RNA helicases [DNA rep 99.58
KOG0333673 consensus U5 snRNP-like RNA helicase subunit [RNA 99.58
TIGR00614470 recQ_fam ATP-dependent DNA helicase, RecQ family. 99.57
KOG0330476 consensus ATP-dependent RNA helicase [RNA processi 99.56
PRK10590456 ATP-dependent RNA helicase RhlE; Provisional 99.56
PRK11776460 ATP-dependent RNA helicase DbpA; Provisional 99.56
PRK11192434 ATP-dependent RNA helicase SrmB; Provisional 99.55
PLN00206518 DEAD-box ATP-dependent RNA helicase; Provisional 99.54
PHA02558501 uvsW UvsW helicase; Provisional 99.53
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 99.53
PRK04537 572 ATP-dependent RNA helicase RhlB; Provisional 99.52
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 99.52
COG1111542 MPH1 ERCC4-like helicases [DNA replication, recomb 99.52
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 99.51
TIGR01389 591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 99.49
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 99.47
PTZ00424401 helicase 45; Provisional 99.47
KOG02981394 consensus DEAD box-containing helicase-like transc 99.46
KOG0335482 consensus ATP-dependent RNA helicase [RNA processi 99.43
KOG0332477 consensus ATP-dependent RNA helicase [RNA processi 99.41
KOG0341610 consensus DEAD-box protein abstrakt [RNA processin 99.39
KOG0342543 consensus ATP-dependent RNA helicase pitchoune [RN 99.34
COG0514 590 RecQ Superfamily II DNA helicase [DNA replication, 99.32
KOG0348 708 consensus ATP-dependent RNA helicase [RNA processi 99.31
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 99.31
KOG0336629 consensus ATP-dependent RNA helicase [RNA processi 99.3
KOG0340442 consensus ATP-dependent RNA helicase [RNA processi 99.26
KOG0345 567 consensus ATP-dependent RNA helicase [RNA processi 99.26
TIGR01587358 cas3_core CRISPR-associated helicase Cas3. This mo 99.24
KOG0327397 consensus Translation initiation factor 4F, helica 99.24
KOG0326459 consensus ATP-dependent RNA helicase [RNA processi 99.2
TIGR00643630 recG ATP-dependent DNA helicase RecG. 99.19
KOG0344593 consensus ATP-dependent RNA helicase [RNA processi 99.18
TIGR00580 926 mfd transcription-repair coupling factor (mfd). Al 99.17
KOG0350620 consensus DEAD-box ATP-dependent RNA helicase [RNA 99.17
PRK10917681 ATP-dependent DNA helicase RecG; Provisional 99.16
KOG0338 691 consensus ATP-dependent RNA helicase [RNA processi 99.14
PRK12898656 secA preprotein translocase subunit SecA; Reviewed 99.13
PRK09200 790 preprotein translocase subunit SecA; Reviewed 99.12
PRK13767 876 ATP-dependent helicase; Provisional 99.12
PRK10689 1147 transcription-repair coupling factor; Provisional 99.11
KOG0343 758 consensus RNA Helicase [RNA processing and modific 99.1
TIGR00631655 uvrb excinuclease ABC, B subunit. This family is b 99.1
KOG0347731 consensus RNA helicase [RNA processing and modific 99.08
PF13871 278 Helicase_C_4: Helicase_C-like 99.06
KOG4284 980 consensus DEAD box protein [Transcription] 99.06
TIGR00963 745 secA preprotein translocase, SecA subunit. The pro 99.05
PRK05298652 excinuclease ABC subunit B; Provisional 99.03
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Trans 99.02
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 98.99
KOG0339 731 consensus ATP-dependent RNA helicase [RNA processi 98.98
TIGR03714 762 secA2 accessory Sec system translocase SecA2. Memb 98.96
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 98.95
KOG0349725 consensus Putative DEAD-box RNA helicase DDX1 [RNA 98.93
PRK12906 796 secA preprotein translocase subunit SecA; Reviewed 98.91
PHA02653 675 RNA helicase NPH-II; Provisional 98.9
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 98.84
PRK02362 737 ski2-like helicase; Provisional 98.82
KOG0351 941 consensus ATP-dependent DNA helicase [Replication, 98.81
KOG0334 997 consensus RNA helicase [RNA processing and modific 98.81
KOG0354 746 consensus DEAD-box like helicase [General function 98.8
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 98.75
KOG0346 569 consensus RNA helicase [RNA processing and modific 98.71
KOG0953 700 consensus Mitochondrial RNA helicase SUV3, DEAD-bo 98.68
PRK12900 1025 secA preprotein translocase subunit SecA; Reviewed 98.68
PRK01172 674 ski2-like helicase; Provisional 98.67
KOG0352 641 consensus ATP-dependent DNA helicase [Replication, 98.61
COG1202 830 Superfamily II helicase, archaea-specific [General 98.6
PRK00254 720 ski2-like helicase; Provisional 98.6
KOG0337 529 consensus ATP-dependent RNA helicase [RNA processi 98.59
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 98.57
KOG1123776 consensus RNA polymerase II transcription initiati 98.55
PRK11448 1123 hsdR type I restriction enzyme EcoKI subunit R; Pr 98.5
TIGR00595505 priA primosomal protein N'. All proteins in this f 98.34
PRK09401 1176 reverse gyrase; Reviewed 98.33
PRK05580679 primosome assembly protein PriA; Validated 98.32
PRK13104 896 secA preprotein translocase subunit SecA; Reviewed 98.31
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 98.29
PRK12904 830 preprotein translocase subunit SecA; Reviewed 98.27
COG0556663 UvrB Helicase subunit of the DNA excision repair c 98.25
PRK09694 878 helicase Cas3; Provisional 98.23
PRK13107 908 preprotein translocase subunit SecA; Reviewed 98.22
PRK14701 1638 reverse gyrase; Provisional 98.18
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. 98.18
COG1201 814 Lhr Lhr-like helicases [General function predictio 98.17
COG1200677 RecG RecG-like helicase [DNA replication, recombin 98.12
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 98.03
COG1203 733 CRISPR-associated helicase Cas3 [Defense mechanism 98.0
KOG0353 695 consensus ATP-dependent DNA helicase [General func 97.89
COG1197 1139 Mfd Transcription-repair coupling factor (superfam 97.88
KOG0329387 consensus ATP-dependent RNA helicase [RNA processi 97.48
PRK12903 925 secA preprotein translocase subunit SecA; Reviewed 97.48
KOG0383696 consensus Predicted helicase [General function pre 97.44
KOG1513 1300 consensus Nuclear helicase MOP-3/SNO (DEAD-box sup 97.39
TIGR00348667 hsdR type I site-specific deoxyribonuclease, HsdR 97.32
PRK12326 764 preprotein translocase subunit SecA; Reviewed 97.3
COG4889 1518 Predicted helicase [General function prediction on 97.25
COG1205 851 Distinct helicase family with a unique C-terminal 97.18
PRK12899 970 secA preprotein translocase subunit SecA; Reviewed 97.13
COG4098441 comFA Superfamily II DNA/RNA helicase required for 97.05
smart00491142 HELICc2 helicase superfamily c-terminal domain. 97.03
PRK12901 1112 secA preprotein translocase subunit SecA; Reviewed 96.88
KOG0922 674 consensus DEAH-box RNA helicase [RNA processing an 96.73
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombi 96.68
KOG4150 1034 consensus Predicted ATP-dependent RNA helicase [RN 96.62
PRK13103 913 secA preprotein translocase subunit SecA; Reviewed 96.52
TIGR01407850 dinG_rel DnaQ family exonuclease/DinG family helic 96.28
PF13307167 Helicase_C_2: Helicase C-terminal domain; PDB: 4A1 96.21
smart00492141 HELICc3 helicase superfamily c-terminal domain. 96.15
PRK08074928 bifunctional ATP-dependent DNA helicase/DNA polyme 96.12
COG1204 766 Superfamily II helicase [General function predicti 96.05
PF06862442 DUF1253: Protein of unknown function (DUF1253); In 95.92
COG1198730 PriA Primosomal protein N' (replication factor Y) 95.76
COG4096 875 HsdR Type I site-specific restriction-modification 95.7
PF11496297 HDA2-3: Class II histone deacetylase complex subun 95.6
COG1199654 DinG Rad3-related DNA helicases [Transcription / D 95.6
TIGR00596 814 rad1 DNA repair protein (rad1). This family is bas 95.5
CHL00122 870 secA preprotein translocase subunit SecA; Validate 95.44
KOG0949 1330 consensus Predicted helicase, DEAD-box superfamily 95.38
KOG0924 1042 consensus mRNA splicing factor ATP-dependent RNA h 95.14
KOG0952 1230 consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup 94.92
KOG0950 1008 consensus DNA polymerase theta/eta, DEAD-box super 94.71
PRK07246820 bifunctional ATP-dependent DNA helicase/DNA polyme 94.62
TIGR00604705 rad3 DNA repair helicase (rad3). All proteins in t 94.47
PRK11747697 dinG ATP-dependent DNA helicase DinG; Provisional 94.13
KOG0926 1172 consensus DEAH-box RNA helicase [RNA processing an 93.49
KOG0923 902 consensus mRNA splicing factor ATP-dependent RNA h 91.99
PF10593239 Z1: Z1 domain; InterPro: IPR018310 This entry repr 91.79
KOG0947 1248 consensus Cytoplasmic exosomal RNA helicase SKI2, 91.75
TIGR03117636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 90.96
KOG0951 1674 consensus RNA helicase BRR2, DEAD-box superfamily 90.91
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 90.9
COG4581 1041 Superfamily II RNA helicase [DNA replication, reco 90.13
PRK10917 681 ATP-dependent DNA helicase RecG; Provisional 88.33
KOG0920 924 consensus ATP-dependent RNA helicase A [RNA proces 86.42
COG0653 822 SecA Preprotein translocase subunit SecA (ATPase, 86.13
TIGR00643 630 recG ATP-dependent DNA helicase RecG. 85.34
COG0610 962 Type I site-specific restriction-modification syst 84.66
PRK12902 939 secA preprotein translocase subunit SecA; Reviewed 83.99
PF02399 824 Herpes_ori_bp: Origin of replication binding prote 82.34
>KOG0384 consensus Chromodomain-helicase DNA-binding protein [Transcription] Back     alignment and domain information 
Probab=100.00  E-value=8.8e-33  Score=232.04  Aligned_cols=144  Identities=48%  Similarity=0.674  Sum_probs=129.4

Q ss_pred             CHHHHHHHHHhcCCeEEEEeCCCCHHHHHHHHHHhcCCC-CcceeeeeccccccCcCCCCCCeEEEeCCCCCcchHHHHH
Q 032027            1 MLDILEWTLDVIGVTYRRLDGSTQVTERQAIVDAFNNDT-SIFACLLSTRAGGQGLNLTGADTVVIHDMDFNPQIDRQAE   79 (148)
Q Consensus         1 ~l~~l~~~L~~~~~~~~~~~G~~~~~~r~~~~~~F~~~~-~~~vll~s~~~~~~Glnl~~a~~vi~~d~~~~~~~~~Q~~   79 (148)
                      |||+|+++|..++++|-+++|+++.+-|+++|++|+.++ .-+|+|+||+|||.||||..|++||+||.+|||-...||.
T Consensus       711 mLDIL~eYL~~r~ypfQRLDGsvrgelRq~AIDhFnap~SddFvFLLSTRAGGLGINLatADTVIIFDSDWNPQNDLQAq  790 (1373)
T KOG0384|consen  711 MLDILAEYLSLRGYPFQRLDGSVRGELRQQAIDHFNAPDSDDFVFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQAQ  790 (1373)
T ss_pred             HHHHHHHHHHHcCCcceeccCCcchHHHHHHHHhccCCCCCceEEEEecccCcccccccccceEEEeCCCCCcchHHHHH
Confidence            699999999999999999999999999999999999865 4689999999999999999999999999999999999999


Q ss_pred             HhhhhcCCCCcEEEEEEEeCCCHHHHHHHHHHHHHHHHHHHHhcCcc---cCCCCCCchhHHHHHHHh
Q 032027           80 DRCHRIGQTRPVTIYRLVTKGTVDENVYEIAKRKLILDAAVLESGVE---VDNEGDTSDKTMGEILSS  144 (148)
Q Consensus        80 gR~~R~Gq~~~v~v~~l~~~~t~ee~i~~~~~~K~~~~~~~~~~~~~---~~~~~~~~~~~~~~~l~~  144 (148)
                      +|||||||++.|.||||++++|+|+.|+++..+|+.+..++++.+..   .......+..++.+||+.
T Consensus       791 ARaHRIGQkk~VnVYRLVTk~TvEeEilERAk~KmvLD~aVIQ~m~t~~~~s~~~~f~K~ELsaILKf  858 (1373)
T KOG0384|consen  791 ARAHRIGQKKHVNVYRLVTKNTVEEEILERAKLKMVLDHAVIQRMDTKGKTSKSNPFSKEELSAILKF  858 (1373)
T ss_pred             HHHHhhcccceEEEEEEecCCchHHHHHHHHHHHhhhHHHHHHhhccccccCCCCCCCHHHHHHHHHh
Confidence            99999999999999999999999999999999999999999998874   111222233556666653

>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>KOG0390 consensus DNA repair protein, SNF2 family [Replication, recombination and repair] Back     alignment and domain information
>KOG0385 consensus Chromatin remodeling complex WSTF-ISWI, small subunit [Transcription] Back     alignment and domain information
>KOG0387 consensus Transcription-coupled repair protein CSB/RAD26 (contains SNF2 family DNA-dependent ATPase domain) [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0389 consensus SNF2 family DNA-dependent ATPase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0391 consensus SNF2 family DNA-dependent ATPase [General function prediction only] Back     alignment and domain information
>KOG0392 consensus SNF2 family DNA-dependent ATPase domain-containing protein [Transcription] Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>KOG0388 consensus SNF2 family DNA-dependent ATPase [Replication, recombination and repair] Back     alignment and domain information
>KOG4439 consensus RNA polymerase II transcription termination factor TTF2/lodestar, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>KOG1015 consensus Transcription regulator XNP/ATRX, DEAD-box superfamily [Transcription] Back     alignment and domain information
>KOG1000 consensus Chromatin remodeling protein HARP/SMARCAL1, DEAD-box superfamily [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0386 consensus Chromatin remodeling complex SWI/SNF, component SWI2 and related ATPases (DNA/RNA helicase superfamily) [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG1016 consensus Predicted DNA helicase, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins Back     alignment and domain information
>smart00490 HELICc helicase superfamily c-terminal domain Back     alignment and domain information
>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>KOG0328 consensus Predicted ATP-dependent RNA helicase FAL1, involved in rRNA maturation, DEAD-box superfamily [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>KOG0331 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0333 consensus U5 snRNP-like RNA helicase subunit [RNA processing and modification] Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>KOG0330 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair] Back     alignment and domain information
>KOG0335 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0332 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0341 consensus DEAD-box protein abstrakt [RNA processing and modification] Back     alignment and domain information
>KOG0342 consensus ATP-dependent RNA helicase pitchoune [RNA processing and modification] Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0348 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>KOG0336 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0340 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0345 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>KOG0327 consensus Translation initiation factor 4F, helicase subunit (eIF-4A) and related helicases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0326 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>KOG0344 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>KOG0350 consensus DEAD-box ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>KOG0338 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>KOG0343 consensus RNA Helicase [RNA processing and modification] Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>KOG0347 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>PF13871 Helicase_C_4: Helicase_C-like Back     alignment and domain information
>KOG4284 consensus DEAD box protein [Transcription] Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>KOG0339 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>KOG0349 consensus Putative DEAD-box RNA helicase DDX1 [RNA processing and modification] Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>KOG0351 consensus ATP-dependent DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>KOG0334 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0354 consensus DEAD-box like helicase [General function prediction only] Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>KOG0346 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0953 consensus Mitochondrial RNA helicase SUV3, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>KOG0352 consensus ATP-dependent DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>KOG0337 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>KOG1123 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, 3'-5' helicase subunit SSL2 [Transcription; Replication, recombination and repair] Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>PRK13107 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>KOG0353 consensus ATP-dependent DNA helicase [General function prediction only] Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>KOG0329 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK12903 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0383 consensus Predicted helicase [General function prediction only] Back     alignment and domain information
>KOG1513 consensus Nuclear helicase MOP-3/SNO (DEAD-box superfamily) [Transcription; Signal transduction mechanisms] Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family Back     alignment and domain information
>PRK12326 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG4889 Predicted helicase [General function prediction only] Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>smart00491 HELICc2 helicase superfamily c-terminal domain Back     alignment and domain information
>PRK12901 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0922 consensus DEAH-box RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG4150 consensus Predicted ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK13103 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>PF13307 Helicase_C_2: Helicase C-terminal domain; PDB: 4A15_A 2VSF_A 3CRV_A 3CRW_1 2VL7_A Back     alignment and domain information
>smart00492 HELICc3 helicase superfamily c-terminal domain Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>PF06862 DUF1253: Protein of unknown function (DUF1253); InterPro: IPR010678 This family is defined by a C-terminal region of approximately 500 residues, Digestive organ expansion factor (DEF) is thought to Regulate the p53 pathway to control the expansion growth of digestive organs and is required for the expansion growth of intestine, liver and exocrine pancreas, but not endocrine pancreas [, ] Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>PF11496 HDA2-3: Class II histone deacetylase complex subunits 2 and 3; InterPro: IPR021006 This entry contains the class II histone deacetylase complex subunits HDA2 and HDA3 is found in fungi Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00596 rad1 DNA repair protein (rad1) Back     alignment and domain information
>CHL00122 secA preprotein translocase subunit SecA; Validated Back     alignment and domain information
>KOG0949 consensus Predicted helicase, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>KOG0924 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0950 consensus DNA polymerase theta/eta, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>KOG0926 consensus DEAH-box RNA helicase [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0923 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PF10593 Z1: Z1 domain; InterPro: IPR018310 This entry represents the Z1 domain of unknown function that is found in a group of putative endonucleases Back     alignment and domain information
>KOG0947 consensus Cytoplasmic exosomal RNA helicase SKI2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>KOG0920 consensus ATP-dependent RNA helicase A [RNA processing and modification] Back     alignment and domain information
>COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>PRK12902 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query148
3mwy_W800 Crystal Structure Of The Chromodomain-atpase Portio 8e-31
1z3i_X644 Structure Of The Swi2SNF2 CHROMATIN REMODELING DOMA 3e-19
1z5z_A271 Sulfolobus Solfataricus Swi2SNF2 ATPASE C-Terminal 1e-16
1z63_A500 Sulfolobus Solfataricus Swi2SNF2 ATPASE CORE IN COM 5e-16
1z6a_A500 Sulfolobus Solfataricus Swi2SNF2 ATPASE CORE DOMAIN 5e-16
>pdb|3MWY|W Chain W, Crystal Structure Of The Chromodomain-atpase Portion Of The Yeast Chd1 Chromatin Remodeler Length = 800 Back     alignment and structure 
Iteration: 1

 Score =  129 bits (323), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 71/147 (48%), Positives = 97/147 (65%), Gaps = 1/147 (0%)
Query: 1   MLDILEWTLDVIGVTYRRLDGSTQVTERQAIVDAFNN-DTSIFACLLSTRAGGQGLNLTG 59
           MLDIL   L + G+ ++RLDG+    +R+  +D FN+ D++ F  LLSTRAGG G+NL  
Sbjct: 584 MLDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNSPDSNDFVFLLSTRAGGLGINLMT 643
Query: 60  ADTVVIHDMDFNPQIDRQAEDRCHRIGQTRPVTIYRLVTKGTVDENVYEIAKRKLILDAA 119
           ADTVVI D D+NPQ D QA  R HRIGQ   V +YRLV+K TV+E V E A++K+IL+ A
Sbjct: 644 ADTVVIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEYA 703
Query: 120 VLESGVEVDNEGDTSDKTMGEILSSIL 146
           ++  GV   N+    ++     LS+IL
Sbjct: 704 IISLGVTDGNKYTKKNEPNAGELSAIL 730
>pdb|1Z3I|X Chain X, Structure Of The Swi2SNF2 CHROMATIN REMODELING DOMAIN OF EUKARYOTIC Rad54 Length = 644 Back     alignment and structure
>pdb|1Z5Z|A Chain A, Sulfolobus Solfataricus Swi2SNF2 ATPASE C-Terminal Domain Length = 271 Back     alignment and structure
>pdb|1Z63|A Chain A, Sulfolobus Solfataricus Swi2SNF2 ATPASE CORE IN COMPLEX With Dsdna Length = 500 Back     alignment and structure
>pdb|1Z6A|A Chain A, Sulfolobus Solfataricus Swi2SNF2 ATPASE CORE DOMAIN Length = 500 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query148
1z3i_X644 Similar to RAD54-like; recombination ATPase helica 3e-58
3mwy_W800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 8e-58
1z5z_A271 Helicase of the SNF2/RAD54 family; hydrolase, reco 5e-44
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 2e-43
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 3e-33
3hgt_A328 HDA1 complex subunit 3; RECA-like domain, SWI2/SNF 2e-26
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 3e-10
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Length = 644 Back     alignment and structure
 Score =  190 bits (484), Expect = 3e-58
 Identities = 50/136 (36%), Positives = 76/136 (55%), Gaps = 1/136 (0%)

Query: 1   MLDILEWTLDVIGVTYRRLDGSTQVTERQAIVDAFNNDTSI-FACLLSTRAGGQGLNLTG 59
            LD+ E         Y RLDG+  + +R  IV+ FNN +S  F  +LS++AGG GLNL G
Sbjct: 428 TLDLFEKLCRNRRYLYVRLDGTMSIKKRAKIVERFNNPSSPEFIFMLSSKAGGCGLNLIG 487

Query: 60  ADTVVIHDMDFNPQIDRQAEDRCHRIGQTRPVTIYRLVTKGTVDENVYEIAKRKLILDAA 119
           A+ +V+ D D+NP  D QA  R  R GQ +   IYRL++ GT++E + +    K  L + 
Sbjct: 488 ANRLVMFDPDWNPANDEQAMARVWRDGQKKTCYIYRLLSTGTIEEKILQRQAHKKALSSC 547

Query: 120 VLESGVEVDNEGDTSD 135
           V++   +V+      +
Sbjct: 548 VVDEEQDVERHFSLGE 563
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Length = 800 Back     alignment and structure
>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 Length = 271 Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Length = 500 Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Length = 968 Back     alignment and structure
>3hgt_A HDA1 complex subunit 3; RECA-like domain, SWI2/SNF2 helical domain, chromatin regulator, coiled coil, nucleus, repressor, transcription; 2.20A {Saccharomyces cerevisiae} PDB: 3hgq_A Length = 328 Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Length = 494 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query148
1z5z_A271 Helicase of the SNF2/RAD54 family; hydrolase, reco 100.0
3mwy_W800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 99.97
1z3i_X644 Similar to RAD54-like; recombination ATPase helica 99.97
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 99.96
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 99.87
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 99.85
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 99.8
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 99.8
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 99.79
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 99.78
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 99.78
3hgt_A328 HDA1 complex subunit 3; RECA-like domain, SWI2/SNF 99.76
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 99.75
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 99.74
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 99.58
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 99.73
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 99.73
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 99.69
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 99.69
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 99.68
3i32_A 300 Heat resistant RNA dependent ATPase; RNA helicase, 99.68
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 99.67
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 99.67
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 99.66
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 99.65
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 99.64
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 99.64
4gl2_A 699 Interferon-induced helicase C domain-containing P; 99.63
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 99.63
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 99.63
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 99.62
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 99.58
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 99.57
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 99.57
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 99.55
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 99.55
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 99.55
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 99.54
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 99.53
3h1t_A590 Type I site-specific restriction-modification syst 99.46
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 99.45
3rc3_A 677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 99.39
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 99.37
1c4o_A664 DNA nucleotide excision repair enzyme UVRB; uvrabc 99.3
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 99.29
2d7d_A661 Uvrabc system protein B; helicase, protein-DNA-ADP 99.29
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 99.28
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 99.25
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 99.2
1gm5_A780 RECG; helicase, replication restart; HET: DNA ADP; 99.2
1tf5_A 844 Preprotein translocase SECA subunit; ATPase, helic 99.19
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 99.18
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 99.16
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 99.15
3jux_A 822 Protein translocase subunit SECA; protein transloc 99.13
2jlq_A451 Serine protease subunit NS3; ribonucleoprotein, nu 99.09
1yks_A440 Genome polyprotein [contains: flavivirin protease 99.09
2wv9_A673 Flavivirin protease NS2B regulatory subunit, FLAV 99.07
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 99.07
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 99.06
2z83_A459 Helicase/nucleoside triphosphatase; hydrolase, mem 99.05
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 99.04
2fsf_A 853 Preprotein translocase SECA subunit; ATPase, DNA-R 99.04
2whx_A618 Serine protease/ntpase/helicase NS3; transcription 99.03
2v6i_A431 RNA helicase; membrane, hydrolase, transmembrane, 99.01
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 99.0
1nkt_A 922 Preprotein translocase SECA 1 subunit; preprotein 98.99
3o8b_A 666 HCV NS3 protease/helicase; ntpase, RNA, translocat 98.8
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 98.26
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 98.22
2w00_A 1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 98.02
2vl7_A540 XPD; helicase, unknown function; 2.25A {Sulfolobus 96.3
2ipc_A 997 Preprotein translocase SECA subunit; nucleotide bi 94.15
4a15_A620 XPD helicase, ATP-dependent DNA helicase TA0057; h 92.74
1gm5_A 780 RECG; helicase, replication restart; HET: DNA ADP; 80.24
>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 Back     alignment and structure
Probab=100.00  E-value=5.2e-34  Score=213.45  Aligned_cols=140  Identities=31%  Similarity=0.443  Sum_probs=111.7

Q ss_pred             HHHHHHHHHhc-CCeEEEEeCCCCHHHHHHHHHHhcCCCCcceeeeeccccccCcCCCCCCeEEEeCCCCCcchHHHHHH
Q 032027            2 LDILEWTLDVI-GVTYRRLDGSTQVTERQAIVDAFNNDTSIFACLLSTRAGGQGLNLTGADTVVIHDMDFNPQIDRQAED   80 (148)
Q Consensus         2 l~~l~~~L~~~-~~~~~~~~G~~~~~~r~~~~~~F~~~~~~~vll~s~~~~~~Glnl~~a~~vi~~d~~~~~~~~~Q~~g   80 (148)
                      ++.|...|... |+++..++|+++.++|.+++++|++++.+.|+|++++++|+|+||+.|++||+||+||||..+.||+|
T Consensus       125 ~~~l~~~L~~~~g~~~~~l~G~~~~~~R~~~i~~F~~~~~~~v~L~st~~~g~Glnl~~a~~VI~~d~~wnp~~~~Q~~g  204 (271)
T 1z5z_A          125 GKIIRNIIEKELNTEVPFLYGELSKKERDDIISKFQNNPSVKFIVLSVKAGGFGINLTSANRVIHFDRWWNPAVEDQATD  204 (271)
T ss_dssp             HHHHHHHHHHHHCSCCCEECTTSCHHHHHHHHHHHHHCTTCCEEEEECCTTCCCCCCTTCSEEEECSCCSCTTTC-----
T ss_pred             HHHHHHHHHHhcCCcEEEEECCCCHHHHHHHHHHhcCCCCCCEEEEehhhhcCCcCcccCCEEEEECCCCChhHHHHHHH
Confidence            67889999885 99999999999999999999999998777889999999999999999999999999999999999999


Q ss_pred             hhhhcCCCCcEEEEEEEeCCCHHHHHHHHHHHHHHHHHHHHhcCcccCCCCCCchhHHHHHHH
Q 032027           81 RCHRIGQTRPVTIYRLVTKGTVDENVYEIAKRKLILDAAVLESGVEVDNEGDTSDKTMGEILS  143 (148)
Q Consensus        81 R~~R~Gq~~~v~v~~l~~~~t~ee~i~~~~~~K~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~  143 (148)
                      |+||+||+++|.||++++++|+|+++++++..|..+++.+++.+.....  ..+.+++.+++.
T Consensus       205 R~~R~Gq~~~v~v~~li~~~TiEe~i~~~~~~K~~l~~~~~~~~~~~~~--~~~~~~l~~l~~  265 (271)
T 1z5z_A          205 RVYRIGQTRNVIVHKLISVGTLEEKIDQLLAFKRSLFKDIISSGDSWIT--ELSTEELRKVIE  265 (271)
T ss_dssp             ---------CCEEEEEEETTSHHHHHHHHHHHCHHHHTTGGGGTTHHHH--TSCHHHHHHHHS
T ss_pred             hccccCCCCceEEEEEeeCCCHHHHHHHHHHHHHHHHHHHHccCchhhh--cCCHHHHHHHhc
Confidence            9999999999999999999999999999999999999999987643322  233455665554
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>3hgt_A HDA1 complex subunit 3; RECA-like domain, SWI2/SNF2 helical domain, chromatin regulator, coiled coil, nucleus, repressor, transcription; 2.20A {Saccharomyces cerevisiae} PDB: 3hgq_A Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 148
d1z3ix1346 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fi 7e-25
d1z5za1244 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 h 1e-24
d1wp9a2286 c.37.1.19 (A:201-486) putative ATP-dependent RNA h 6e-15
d2fwra1200 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Ar 1e-09
>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Length = 346 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Rad54-like, Rad54L
species: Zebra fish (Danio rerio) [TaxId: 7955]

 Score = 95.4 bits (236), Expect = 7e-25
 Identities = 36/107 (33%), Positives = 59/107 (55%)

Query: 29  QAIVDAFNNDTSIFACLLSTRAGGQGLNLTGADTVVIHDMDFNPQIDRQAEDRCHRIGQT 88
           + +    N  +  F  +LS++AGG GLNL GA+ +V+ D D+NP  D QA  R  R GQ 
Sbjct: 159 KIVERFNNPSSPEFIFMLSSKAGGCGLNLIGANRLVMFDPDWNPANDEQAMARVWRDGQK 218

Query: 89  RPVTIYRLVTKGTVDENVYEIAKRKLILDAAVLESGVEVDNEGDTSD 135
           +   IYRL++ GT++E + +    K  L + V++   +V+      +
Sbjct: 219 KTCYIYRLLSTGTIEEKILQRQAHKKALSSCVVDEEQDVERHFSLGE 265
>d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Length = 244 Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 286 Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 200 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query148
d1z3ix1346 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 100.0
d1z5za1244 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 100.0
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.84
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.84
d2fwra1200 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.83
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 99.83
d1wp9a2286 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.82
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human ( 99.82
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 99.82
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 99.78
d1oywa3200 RecQ helicase domain {Escherichia coli [TaxId: 562 99.74
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 99.7
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 99.66
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 99.4
d1gm5a4206 RecG helicase domain {Thermotoga maritima [TaxId: 99.23
d2p6ra4201 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.19
d1gkub2248 Helicase-like "domain" of reverse gyrase {Archaeon 99.08
d1a1va2299 HCV helicase domain {Human hepatitis C virus (HCV) 99.02
d2eyqa5211 Transcription-repair coupling factor, TRCF {Escher 98.91
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 98.5
d1yksa2299 YFV helicase domain {Yellow fever virus [TaxId: 11 98.16
d1tf5a4175 Translocation ATPase SecA, nucleotide-binding doma 98.07
d1nkta4219 Translocation ATPase SecA, nucleotide-binding doma 97.19
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 91.21
d1byka_255 Trehalose repressor, C-terminal domain {Escherichi 83.95
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 80.39
>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Rad54-like, Rad54L
species: Zebra fish (Danio rerio) [TaxId: 7955]

Probab=100.00  E-value=1.2e-34  Score=221.59  Aligned_cols=139  Identities=37%  Similarity=0.581  Sum_probs=123.9

Q ss_pred             CHHHHHHHHHhcCCeEEEEeCCCCHHHHHHHHHHhcCCCC-cceeeeeccccccCcCCCCCCeEEEeCCCCCcchHHHHH
Q 032027            1 MLDILEWTLDVIGVTYRRLDGSTQVTERQAIVDAFNNDTS-IFACLLSTRAGGQGLNLTGADTVVIHDMDFNPQIDRQAE   79 (148)
Q Consensus         1 ~l~~l~~~L~~~~~~~~~~~G~~~~~~r~~~~~~F~~~~~-~~vll~s~~~~~~Glnl~~a~~vi~~d~~~~~~~~~Q~~   79 (148)
                      ++++|+.+|..+|++++.++|+++..+|.+++++|+++.. ..|+|+++.++|+|+||+.|++||+||++|||..+.||+
T Consensus       130 ~ld~l~~~l~~~g~~~~~l~G~~~~~~R~~~i~~F~~~~~~~~vlLls~~agg~GlnL~~a~~vi~~d~~wnp~~~~Qa~  209 (346)
T d1z3ix1         130 TLDLFEKLCRNRRYLYVRLDGTMSIKKRAKIVERFNNPSSPEFIFMLSSKAGGCGLNLIGANRLVMFDPDWNPANDEQAM  209 (346)
T ss_dssp             HHHHHHHHHHHHTCCEEEECSSCCHHHHHHHHHHHHSTTCCCCEEEEEGGGSCTTCCCTTEEEEEECSCCSSHHHHHHHH
T ss_pred             hhHHHHHHHhhhhccccccccchhHHHHHHHHHhhhcccccceeeeecchhhhhccccccceEEEEecCCCccchHhHhh
Confidence            3789999999999999999999999999999999998654 568999999999999999999999999999999999999


Q ss_pred             HhhhhcCCCCcEEEEEEEeCCCHHHHHHHHHHHHHHHHHHHHhcCcccCCCCCCchhHHHHH
Q 032027           80 DRCHRIGQTRPVTIYRLVTKGTVDENVYEIAKRKLILDAAVLESGVEVDNEGDTSDKTMGEI  141 (148)
Q Consensus        80 gR~~R~Gq~~~v~v~~l~~~~t~ee~i~~~~~~K~~~~~~~~~~~~~~~~~~~~~~~~~~~~  141 (148)
                      ||+||+||+++|+||+|+++||+||+|++++..|..++..+++...+....  ...+++.++
T Consensus       210 ~R~~R~GQ~~~V~v~rli~~~TiEe~i~~~~~~K~~l~~~v~~~~~~~~~~--~~~~~l~~l  269 (346)
T d1z3ix1         210 ARVWRDGQKKTCYIYRLLSTGTIEEKILQRQAHKKALSSCVVDEEQDVERH--FSLGELREL  269 (346)
T ss_dssp             TTSSSTTCCSCEEEEEEEETTSHHHHHHHHHHHHHHTSCCCCSCSSSCCCS--SCHHHHHHH
T ss_pred             hcccccCCCCceEEEEEEeCCCHHHHHHHHHHHHHHHHHHHhCCchhhhhc--CCHHHHHHH
Confidence            999999999999999999999999999999999999999988865443332  233444444
>d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1nkta4 c.37.1.19 (A:397-615) Translocation ATPase SecA, nucleotide-binding domains {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1byka_ c.93.1.1 (A:) Trehalose repressor, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure