Citrus Sinensis ID: 032094

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------
MFNNSKRPNSVRTVSRGTIPVLASSNGSATSRRKDDSSVREPSTVFEEENPNGDSTDAPIVGIIMESDLDLPVMNDAARTLSDFGVPYEIKILPPHQNCKEALSYALSAKERGIKIIIVGDGVEAHLSGTCSCCKFSNTCYSCSFIK
ccccccccccccccccccEEEEcccHHHHHHHcccccccccccccccccccccccccccEEEEEEcccccHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHcccEEEEEcccccccHHHHHHHHHcccccccccccc
cccccccccccccccEEEEEEEcccHHHHHHHHHHHHccccccccccccccccccccccEEEEEEccHHHHHHHHHHHHHHHHcccEEEEEEccccccHHHHHHHHHHcccccccEEEEEEEccccHHHcEEEEEcccccEcccccc
mfnnskrpnsvrtvsrgtipvlassngsatsrrkddssvrepstvfeeenpngdstdapivgiimesdldlpvmndaartlsdfgvpyeikilpphqncKEALSYALSAKERGIKIIIVGDgveahlsgtcscckfsntcyscsfik
mfnnskrpnsvrtvsrgtipvlassngsatsrrkddssvrepstvfeeenpngdstdapIVGIIMESDLDLPVMNDAARTLSDFGVPYEIKILPPHQNCKEALSYALSAKERGIKIIIVGDGVEAHLSgtcscckfsntcyscsfik
MFNNSKRPNSVRTVSRGTIPVLASSNGSATSRRKDDSSVREPSTVFEEENPNGDSTDAPIVGIIMESDLDLPVMNDAARTLSDFGVPYEIKILPPHQNCKEALSYALSAKERGIKIIIVGDGVEAHLSGTCSCCKFSNTCYSCSFIK
***********************************************************IVGIIMESDLDLPVMNDAARTLSDFGVPYEIKILPPHQNCKEALSYALSAKERGIKIIIVGDGVEAHLSGTCSCCKFSNTCYSCSFI*
MFN**********VSRGTIPVLASSNGSAT*******************************GIIMESDLDLPVMNDAARTLSDFGVPYEIKILPPHQNCKEALSYALSAKERGIKIIIVGDGVEAHLSGTCSCCKFSNTCYSCSFIK
*************VSRGTIPVLA****************************NGDSTDAPIVGIIMESDLDLPVMNDAARTLSDFGVPYEIKILPPHQNCKEALSYALSAKERGIKIIIVGDGVEAHLSGTCSCCKFSNTCYSCSFIK
*****KRPNSVRTVSRGTIPVLASSNGSATSRRKDDSSVR****************DAPIVGIIMESDLDLPVMNDAARTLSDFGVPYEIKILPPHQNCKEALSYALSAKERGIKIIIVGDGVEAHLSGTCSCCKFSNTCYSCSFIK
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFNNSKRPNSVRTVSRGTIPVLASSNGSATSRRKDDSSVREPSTVFEEENPNGDSTDAPIVGIIMESDLDLPVMNDAARTLSDFGVPYEIKILPPHQNCKEALSYALSAKERGIKIIIVGDGVEAHLSGTCSCCKFSNTCYSCSFIK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query147 2.2.26 [Sep-21-2011]
O58058177 N5-carboxyaminoimidazole yes no 0.537 0.446 0.531 5e-18
P21264571 Phosphoribosylaminoimidaz yes no 0.877 0.225 0.380 1e-15
Q9UY68174 N5-carboxyaminoimidazole yes no 0.517 0.436 0.5 1e-14
Q92210568 Phosphoribosylaminoimidaz N/A no 0.802 0.207 0.404 1e-14
Q9WYS7171 N5-carboxyaminoimidazole yes no 0.517 0.444 0.5 3e-14
P50504557 Phosphoribosylaminoimidaz N/A no 0.836 0.220 0.368 4e-14
P15567552 Phosphoribosylaminoimidaz yes no 0.517 0.137 0.473 1e-13
O74197570 Phosphoribosylaminoimidaz yes no 0.557 0.143 0.439 9e-13
Q87KE1161 N5-carboxyaminoimidazole yes no 0.496 0.453 0.506 2e-12
Q44679177 N5-carboxyaminoimidazole N/A no 0.523 0.435 0.428 2e-12
>sp|O58058|PURE_PYRHO N5-carboxyaminoimidazole ribonucleotide mutase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=purE PE=3 SV=1 Back     alignment and function desciption
 Score = 89.7 bits (221), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 54/79 (68%)

Query: 56  TDAPIVGIIMESDLDLPVMNDAARTLSDFGVPYEIKILPPHQNCKEALSYALSAKERGIK 115
           ++ P+VGIIM SD DLPVM +AAR L +FGVPYEI I+  H+  + A  YA  A+ERGI+
Sbjct: 7   SEKPLVGIIMGSDSDLPVMKEAARILEEFGVPYEITIISAHRTPERAYEYAKKAEERGIE 66

Query: 116 IIIVGDGVEAHLSGTCSCC 134
           +II G G  AHL G  +  
Sbjct: 67  VIIAGAGGAAHLPGIIASL 85
Catalyzes the conversion of N5-carboxyaminoimidazole ribonucleotide (N5-CAIR) to 4-carboxy-5-aminoimidazole ribonucleotide (CAIR).
Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (taxid: 70601)
EC: 5EC: .EC: 4EC: .EC: 9EC: 9EC: .EC: 1EC: 8
>sp|P21264|PUR6_YEAST Phosphoribosylaminoimidazole carboxylase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADE2 PE=1 SV=1 Back     alignment and function description
>sp|Q9UY68|PURE_PYRAB N5-carboxyaminoimidazole ribonucleotide mutase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=purE PE=3 SV=1 Back     alignment and function description
>sp|Q92210|PUR6_CANAL Phosphoribosylaminoimidazole carboxylase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ADE2 PE=3 SV=2 Back     alignment and function description
>sp|Q9WYS7|PURE_THEMA N5-carboxyaminoimidazole ribonucleotide mutase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=purE PE=1 SV=1 Back     alignment and function description
>sp|P50504|PUR6_SCHOC Phosphoribosylaminoimidazole carboxylase OS=Schwanniomyces occidentalis GN=ADE2 PE=3 SV=1 Back     alignment and function description
>sp|P15567|PUR6_SCHPO Phosphoribosylaminoimidazole carboxylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ade6 PE=3 SV=1 Back     alignment and function description
>sp|O74197|PUR6_CANGA Phosphoribosylaminoimidazole carboxylase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ADE2 PE=3 SV=2 Back     alignment and function description
>sp|Q87KE1|PURE_VIBPA N5-carboxyaminoimidazole ribonucleotide mutase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=purE PE=3 SV=1 Back     alignment and function description
>sp|Q44679|PURE_CORAM N5-carboxyaminoimidazole ribonucleotide mutase OS=Corynebacterium ammoniagenes GN=purE PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query147
37983592 621 phosphoribosylaminoimidazole carboxylase 0.775 0.183 0.430 9e-18
13173434 623 phosphoribosylaminoimidazole carboxylase 0.775 0.182 0.430 9e-18
14590237177 phosphoribosylaminoimidazole carboxylase 0.537 0.446 0.531 3e-16
154249773178 phosphoribosylaminoimidazole carboxylase 0.517 0.426 0.526 5e-15
410667200164 phosphoribosylaminoimidazole carboxylase 0.551 0.493 0.465 5e-15
193215447176 phosphoribosylaminoimidazole carboxylase 0.585 0.488 0.441 6e-15
268316597171 phosphoribosylaminoimidazole carboxylase 0.544 0.467 0.487 7e-15
238581649 501 hypothetical protein MPER_11161 [Monilio 0.802 0.235 0.387 8e-15
449442114 586 PREDICTED: phosphoribosylaminoimidazole 0.517 0.129 0.537 1e-14
449490248 586 PREDICTED: phosphoribosylaminoimidazole 0.517 0.129 0.537 1e-14
>gi|37983592|gb|AAR06291.1| phosphoribosylaminoimidazole carboxylase, partial [Nicotiana tabacum] Back     alignment and taxonomy information
 Score = 95.1 bits (235), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 53/123 (43%), Positives = 71/123 (57%), Gaps = 9/123 (7%)

Query: 7   RPNSVRTVSRGTIPVLASSNGSATSRRKDDSSVREPSTVFEEENPNGDSTDAPIVGIIME 66
           +P   R    G I ++  S G   ++ +          +  EE+ NG    AP VGIIM 
Sbjct: 411 KPEMRRQRKMGHITIVGPSMGIVEAQLR---------VILNEESVNGHPAVAPRVGIIMG 461

Query: 67  SDLDLPVMNDAARTLSDFGVPYEIKILPPHQNCKEALSYALSAKERGIKIIIVGDGVEAH 126
           SD DLPVM DAA+ L++F VP E+KI+  H+  +   SYALSA+ERGI++II G G  AH
Sbjct: 462 SDSDLPVMKDAAKILNEFDVPAEVKIVSAHRTPEMMFSYALSARERGIQVIIAGAGGAAH 521

Query: 127 LSG 129
           L G
Sbjct: 522 LPG 524

Source: Nicotiana tabacum

Species: Nicotiana tabacum

Genus: Nicotiana

Family: Solanaceae

Order: Solanales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|13173434|gb|AAK14408.1| phosphoribosylaminoimidazole carboxylase [Nicotiana tabacum] Back     alignment and taxonomy information
>gi|14590237|ref|NP_142303.1| phosphoribosylaminoimidazole carboxylase catalytic subunit [Pyrococcus horikoshii OT3] gi|3914493|sp|O58058.1|PURE_PYRHO RecName: Full=N5-carboxyaminoimidazole ribonucleotide mutase; Short=N5-CAIR mutase; AltName: Full=5-(carboxyamino)imidazole ribonucleotide mutase gi|3256711|dbj|BAA29394.1| 177aa long hypothetical phosphoribosylaminoimidazole carboxylase catalytic subunit [Pyrococcus horikoshii OT3] Back     alignment and taxonomy information
>gi|154249773|ref|YP_001410598.1| phosphoribosylaminoimidazole carboxylase, catalytic subunit [Fervidobacterium nodosum Rt17-B1] gi|154153709|gb|ABS60941.1| phosphoribosylaminoimidazole carboxylase, catalytic subunit [Fervidobacterium nodosum Rt17-B1] Back     alignment and taxonomy information
>gi|410667200|ref|YP_006919571.1| phosphoribosylaminoimidazole carboxylase catalytic subunit PurE [Thermacetogenium phaeum DSM 12270] gi|409104947|gb|AFV11072.1| phosphoribosylaminoimidazole carboxylase catalytic subunit PurE [Thermacetogenium phaeum DSM 12270] Back     alignment and taxonomy information
>gi|193215447|ref|YP_001996646.1| phosphoribosylaminoimidazole carboxylase catalytic subunit [Chloroherpeton thalassium ATCC 35110] gi|193088924|gb|ACF14199.1| phosphoribosylaminoimidazole carboxylase, catalytic subunit [Chloroherpeton thalassium ATCC 35110] Back     alignment and taxonomy information
>gi|268316597|ref|YP_003290316.1| phosphoribosylaminoimidazole carboxylase catalytic subunit [Rhodothermus marinus DSM 4252] gi|262334131|gb|ACY47928.1| phosphoribosylaminoimidazole carboxylase, catalytic subunit [Rhodothermus marinus DSM 4252] Back     alignment and taxonomy information
>gi|238581649|ref|XP_002389678.1| hypothetical protein MPER_11161 [Moniliophthora perniciosa FA553] gi|215452204|gb|EEB90608.1| hypothetical protein MPER_11161 [Moniliophthora perniciosa FA553] Back     alignment and taxonomy information
>gi|449442114|ref|XP_004138827.1| PREDICTED: phosphoribosylaminoimidazole carboxylase, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449490248|ref|XP_004158550.1| PREDICTED: phosphoribosylaminoimidazole carboxylase, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query147
SGD|S000005654571 ADE2 "Phosphoribosylaminoimida 0.850 0.218 0.392 2e-15
CGD|CAL0003241568 ADE2 [Candida albicans (taxid: 0.721 0.186 0.443 1.1e-13
UNIPROTKB|Q92210568 ADE2 "Phosphoribosylaminoimida 0.721 0.186 0.443 1.1e-13
UNIPROTKB|P96880174 purE "N5-carboxyaminoimidazole 0.496 0.419 0.465 2.7e-13
POMBASE|SPCC1322.13552 ade6 "phosphoribosylaminoimida 0.517 0.137 0.473 9.4e-13
TAIR|locus:2040771642 AT2G37690 [Arabidopsis thalian 0.496 0.113 0.506 1.2e-12
TIGR_CMR|GSU_0611169 GSU_0611 "phosphoribosylaminoi 0.482 0.420 0.492 1.5e-12
DICTYBASE|DDB_G0283987 997 purC/E "PAICS" [Dictyostelium 0.863 0.127 0.343 2.9e-12
UNIPROTKB|Q9KVT7161 purE "N5-carboxyaminoimidazole 0.469 0.428 0.507 8.2e-12
TIGR_CMR|VC_0052161 VC_0052 "phosphoribosylaminoim 0.469 0.428 0.507 8.2e-12
SGD|S000005654 ADE2 "Phosphoribosylaminoimidazole carboxylase" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
 Score = 203 (76.5 bits), Expect = 2.0e-15, P = 2.0e-15
 Identities = 51/130 (39%), Positives = 71/130 (54%)

Query:     1 MFNNSKRPNSVRTVSRGTIPVLASSNGSATSRRKDDSSVRE-PSTVFEEENPNGDSTDAP 59
             ++    RPN  R V  G I ++ASS      R    +   + P  +   +  + ++   P
Sbjct:   348 LYGKESRPN--RKV--GHINIIASSMAECEQRLNYITGRTDIPIKISVAQKLDLEAMVKP 403

Query:    60 IVGIIMESDLDLPVMNDAARTLSDFGVPYEIKILPPHQNCKEALSYALSAKERGIKIIIV 119
             +VGIIM SD DLPVM+ A   L DFGVP+E+ I+  H+      +YA+SA +RGIK II 
Sbjct:   404 LVGIIMGSDSDLPVMSAACAVLKDFGVPFEVTIVSAHRTPHRMSAYAISASKRGIKTIIA 463

Query:   120 GDGVEAHLSG 129
             G G  AHL G
Sbjct:   464 GAGGAAHLPG 473
GO:0006189 "'de novo' IMP biosynthetic process" evidence=IEA;TAS
GO:0006164 "purine nucleotide biosynthetic process" evidence=IEA;TAS
GO:0005524 "ATP binding" evidence=IEA
GO:0034023 "5-(carboxyamino)imidazole ribonucleotide mutase activity" evidence=IEA
GO:0003824 "catalytic activity" evidence=IEA
GO:0004638 "phosphoribosylaminoimidazole carboxylase activity" evidence=IEA;IMP
GO:0046872 "metal ion binding" evidence=IEA
GO:0006144 "purine nucleobase metabolic process" evidence=IMP;TAS
GO:0005737 "cytoplasm" evidence=IDA
GO:0016829 "lyase activity" evidence=IEA
GO:0016831 "carboxy-lyase activity" evidence=IEA
GO:0000166 "nucleotide binding" evidence=IEA
CGD|CAL0003241 ADE2 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
UNIPROTKB|Q92210 ADE2 "Phosphoribosylaminoimidazole carboxylase" [Candida albicans SC5314 (taxid:237561)] Back     alignment and assigned GO terms
UNIPROTKB|P96880 purE "N5-carboxyaminoimidazole ribonucleotide mutase" [Mycobacterium tuberculosis (taxid:1773)] Back     alignment and assigned GO terms
POMBASE|SPCC1322.13 ade6 "phosphoribosylaminoimidazole carboxylase Ade6" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
TAIR|locus:2040771 AT2G37690 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_0611 GSU_0611 "phosphoribosylaminoimidazole carboxylase, catalytic subunit" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0283987 purC/E "PAICS" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|Q9KVT7 purE "N5-carboxyaminoimidazole ribonucleotide mutase" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms
TIGR_CMR|VC_0052 VC_0052 "phosphoribosylaminoimidazole carboxylase, catalytic subunit" [Vibrio cholerae O1 biovar El Tor (taxid:686)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer5.4.99LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
purE
phosphoribosylaminoimidazole carboxylase catalytic subunit; This subunit can alone transform AIR to CAIR, but in association with purK, which possesses an ATPase activity, an enzyme complex is produced which is capable of converting AIR to CAIR efficiently under physiological condition (By similarity) (177 aa)
(Pyrococcus horikoshii)
Predicted Functional Partners:
purC
phosphoribosylaminoimidazole-succinocarboxamide synthase (238 aa)
•• • •• 0.999
purD
phosphoribosylamine--glycine ligase (438 aa)
••••••• 0.999
purT
phosphoribosylglycinamide formyltransferase 2; Catalyzes two reactions- the first one is the pr [...] (433 aa)
•• • •• 0.999
purF
amidophosphoribosyltransferase (449 aa)
• ••••• 0.998
purM
phosphoribosylaminoimidazole synthetase (334 aa)
• ••••• 0.997
purB
adenylosuccinate lyase (450 aa)
•  •••• 0.996
purQ
phosphoribosylformylglycinamidine synthase I (227 aa)
•  • •• 0.982
glnA
glutamine synthetase (443 aa)
•     • 0.976
purL
phosphoribosylformylglycinamidine synthase II (705 aa)
•    •• 0.964
purA
adenylosuccinate synthetase; Plays an important role in the de novo pathway of purine nucleotid [...] (339 aa)
•  •  • 0.961

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query147
PLN02948577 PLN02948, PLN02948, phosphoribosylaminoimidazole c 6e-26
pfam00731150 pfam00731, AIRC, AIR carboxylase 2e-23
COG0041162 COG0041, PurE, Phosphoribosylcarboxyaminoimidazole 4e-23
smart01001152 smart01001, AIRC, AIR carboxylase 7e-23
TIGR01162156 TIGR01162, purE, phosphoribosylaminoimidazole carb 9e-21
>gnl|CDD|178534 PLN02948, PLN02948, phosphoribosylaminoimidazole carboxylase Back     alignment and domain information 
 Score =  101 bits (254), Expect = 6e-26
 Identities = 45/115 (39%), Positives = 58/115 (50%), Gaps = 11/115 (9%)

Query: 17  GTIPVLASSNGSATSRRKD--DSSVREPSTVFEEENPNGDSTDAPIVGIIMESDLDLPVM 74
           G I V+  S     +R          +P  + +           P+VGIIM SD DLP M
Sbjct: 376 GHITVVGPSAAEVEARLDQLLAEESADPDALPK---------GTPLVGIIMGSDSDLPTM 426

Query: 75  NDAARTLSDFGVPYEIKILPPHQNCKEALSYALSAKERGIKIIIVGDGVEAHLSG 129
            DAA  L  FGVPYE+ I+  H+  +   SYA SA  RG+++II G G  AHL G
Sbjct: 427 KDAAEILDSFGVPYEVTIVSAHRTPERMFSYARSAHSRGLQVIIAGAGGAAHLPG 481

Length = 577
>gnl|CDD|144362 pfam00731, AIRC, AIR carboxylase Back     alignment and domain information
>gnl|CDD|223119 COG0041, PurE, Phosphoribosylcarboxyaminoimidazole (NCAIR) mutase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|214965 smart01001, AIRC, AIR carboxylase Back     alignment and domain information
>gnl|CDD|130230 TIGR01162, purE, phosphoribosylaminoimidazole carboxylase, PurE protein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 147
COG0041162 PurE Phosphoribosylcarboxyaminoimidazole (NCAIR) m 100.0
PLN02948577 phosphoribosylaminoimidazole carboxylase 99.97
TIGR01162156 purE phosphoribosylaminoimidazole carboxylase, Pur 99.97
PF00731150 AIRC: AIR carboxylase; InterPro: IPR000031 Phospho 99.96
COG1691254 NCAIR mutase (PurE)-related proteins [General func 99.63
KOG2835373 consensus Phosphoribosylamidoimidazole-succinocarb 99.17
KOG2835373 consensus Phosphoribosylamidoimidazole-succinocarb 98.4
PRK10076213 pyruvate formate lyase II activase; Provisional 95.94
cd08170 351 GlyDH Glycerol dehydrogenases (GlyDH) catalyzes ox 95.34
cd08550 349 GlyDH-like Glycerol_dehydrogenase-like. Families o 95.11
cd08185 380 Fe-ADH1 Iron-containing alcohol dehydrogenases-lik 94.58
PF06258311 Mito_fiss_Elm1: Mitochondrial fission ELM1; InterP 94.53
cd08183 374 Fe-ADH2 Iron-containing alcohol dehydrogenases-lik 93.89
cd08551 370 Fe-ADH iron-containing alcohol dehydrogenases (Fe- 93.89
cd08171 345 GlyDH-like2 Glycerol dehydrogenase-like. Glycerol 93.67
cd08195 345 DHQS Dehydroquinate synthase (DHQS) catalyzes the 93.67
PRK09423 366 gldA glycerol dehydrogenase; Provisional 93.62
cd08175 348 G1PDH Glycerol-1-phosphate dehydrogenase (G1PDH) c 93.27
TIGR01357 344 aroB 3-dehydroquinate synthase. This model represe 93.2
PRK00843 350 egsA NAD(P)-dependent glycerol-1-phosphate dehydro 93.2
cd0302890 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-inte 93.04
cd08186 383 Fe-ADH8 Iron-containing alcohol dehydrogenase. Typ 92.97
cd08176 377 LPO Lactadehyde:propanediol oxidoreductase (LPO) c 92.83
cd08182 367 HEPD Hydroxyethylphosphoate dehydrogenase (HEPD) c 92.8
cd08194 375 Fe-ADH6 Iron-containing alcohol dehydrogenases-lik 92.7
TIGR0036597 monothiol glutaredoxin, Grx4 family. The gene for 92.46
cd08178 398 AAD_C C-terminal alcohol dehydrogenase domain of t 92.29
PRK00002 358 aroB 3-dehydroquinate synthase; Reviewed 92.2
TIGR02638 379 lactal_redase lactaldehyde reductase. This clade o 92.12
PF00465 366 Fe-ADH: Iron-containing alcohol dehydrogenase ; In 92.06
cd08187 382 BDH Butanol dehydrogenase catalyzes the conversion 91.99
cd08197 355 DOIS 2-deoxy-scyllo-inosose synthase (DOIS) cataly 91.99
cd08181 357 PPD-like 1,3-propanediol dehydrogenase-like (PPD). 91.85
PF00763117 THF_DHG_CYH: Tetrahydrofolate dehydrogenase/cycloh 91.77
cd08173 339 Gro1PDH Sn-glycerol-1-phosphate dehydrogenase (Gro 91.72
cd08192 370 Fe-ADH7 Iron-containing alcohol dehydrogenases-lik 91.52
cd03786 363 GT1_UDP-GlcNAc_2-Epimerase Bacterial members of th 91.26
cd08188 377 Fe-ADH4 Iron-containing alcohol dehydrogenases-lik 91.2
cd08189 374 Fe-ADH5 Iron-containing alcohol dehydrogenases-lik 91.18
cd08179 375 NADPH_BDH NADPH-dependent butanol dehydrogenase in 91.14
PRK10624 382 L-1,2-propanediol oxidoreductase; Provisional 90.98
PRK11914 306 diacylglycerol kinase; Reviewed 90.78
cd08193 376 HVD 5-hydroxyvalerate dehydrogenase (HVD) catalyze 90.59
cd07766 332 DHQ_Fe-ADH Dehydroquinate synthase-like (DHQ-like) 90.44
TIGR03702 293 lip_kinase_YegS lipid kinase YegS. Members of this 90.37
cd08190 414 HOT Hydroxyacid-oxoacid transhydrogenase (HOT) inv 90.19
cd08199 354 EEVS 2-epi-5-epi-valiolone synthase (EEVS). 2-epi- 90.18
PF10096 243 DUF2334: Uncharacterized protein conserved in bact 90.14
PRK15454 395 ethanol dehydrogenase EutG; Provisional 89.8
PRK09860 383 putative alcohol dehydrogenase; Provisional 89.03
cd08549 332 G1PDH_related Glycerol-1-phosphate_dehydrogenase a 89.02
PF13407 257 Peripla_BP_4: Periplasmic binding protein domain; 88.74
PRK01372 304 ddl D-alanine--D-alanine ligase; Reviewed 88.59
COG069580 GrxC Glutaredoxin and related proteins [Posttransl 88.5
cd0302773 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Eg 88.44
PRK10653 295 D-ribose transporter subunit RbsB; Provisional 88.41
PLN02834 433 3-dehydroquinate synthase 87.95
cd01988132 Na_H_Antiporter_C The C-terminal domain of a subfa 87.74
cd01391 269 Periplasmic_Binding_Protein_Type_1 Type 1 periplas 87.59
PRK13055 334 putative lipid kinase; Reviewed 87.4
PRK13337 304 putative lipid kinase; Reviewed 87.24
PRK15138 387 aldehyde reductase; Provisional 87.0
cd01539 303 PBP1_GGBP Periplasmic glucose/galactose-binding pr 86.71
PF0046260 Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Gl 86.41
cd0086091 ThrRS_anticodon ThrRS Threonyl-anticodon binding d 86.35
cd08191 386 HHD 6-hydroxyhexanoate dehydrogenase (HHD) catalyz 86.28
PF04392 294 ABC_sub_bind: ABC transporter substrate binding pr 86.13
PRK13054 300 lipid kinase; Reviewed 86.01
cd08177 337 MAR Maleylacetate reductase is involved in many ar 85.17
cd01452187 VWA_26S_proteasome_subunit 26S proteasome plays a 85.0
PRK10703 341 DNA-binding transcriptional repressor PurR; Provis 84.59
PRK10014 342 DNA-binding transcriptional repressor MalI; Provis 84.11
PRK00861 300 putative lipid kinase; Reviewed 83.97
cd08180 332 PDD 1,3-propanediol dehydrogenase (PPD) catalyzes 83.51
cd06318 282 PBP1_ABC_sugar_binding_like_9 Periplasmic sugar-bi 83.1
cd06305 273 PBP1_methylthioribose_binding_like Methylthioribos 82.55
COG1454 377 EutG Alcohol dehydrogenase, class IV [Energy produ 81.8
COG2984 322 ABC-type uncharacterized transport system, peripla 81.04
cd0341875 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX b 80.95
PLN02958 481 diacylglycerol kinase/D-erythro-sphingosine kinase 80.93
cd0479587 SIS SIS domain. SIS (Sugar ISomerase) domains are 80.59
>COG0041 PurE Phosphoribosylcarboxyaminoimidazole (NCAIR) mutase [Nucleotide transport and metabolism] Back     alignment and domain information 
Probab=100.00  E-value=4.9e-34  Score=224.81  Aligned_cols=79  Identities=42%  Similarity=0.678  Sum_probs=77.8

Q ss_pred             eEEEEecCCCCHHHHHHHHHHHHHhCCCeEEEEEcCCCChHHHHHHHHHHhhCCceEEEEecCCCCchhhhhhccccCc
Q 032094           60 IVGIIMESDLDLPVMNDAARTLSDFGVPYEIKILPPHQNCKEALSYALSAKERGIKIIIVGDGVEAHLSGTCSCCKFSN  138 (147)
Q Consensus        60 ~V~IimGS~SDl~~~~~a~~~L~~fGI~~ev~V~SAHRtp~~l~~~~~~~~~~g~~ViIAvAG~aAhLpGvvAg~T~~~  138 (147)
                      +|+|||||+|||++|++|+++|++|||+||++|+||||||+++.+|+++++++|++||||+||++||||||+|++|..+
T Consensus         4 ~V~IIMGS~SD~~~mk~Aa~~L~~fgi~ye~~VvSAHRTPe~m~~ya~~a~~~g~~viIAgAGgAAHLPGmvAa~T~lP   82 (162)
T COG0041           4 KVGIIMGSKSDWDTMKKAAEILEEFGVPYEVRVVSAHRTPEKMFEYAEEAEERGVKVIIAGAGGAAHLPGMVAAKTPLP   82 (162)
T ss_pred             eEEEEecCcchHHHHHHHHHHHHHcCCCeEEEEEeccCCHHHHHHHHHHHHHCCCeEEEecCcchhhcchhhhhcCCCC
Confidence            8999999999999999999999999999999999999999999999999999999999999999999999999999876

>PLN02948 phosphoribosylaminoimidazole carboxylase Back     alignment and domain information
>TIGR01162 purE phosphoribosylaminoimidazole carboxylase, PurE protein Back     alignment and domain information
>PF00731 AIRC: AIR carboxylase; InterPro: IPR000031 Phosphoribosylaminoimidazole carboxylase is a fusion protein in plants and fungi, but consists of two non-interacting proteins in bacteria, PurK and PurE Back     alignment and domain information
>COG1691 NCAIR mutase (PurE)-related proteins [General function prediction only] Back     alignment and domain information
>KOG2835 consensus Phosphoribosylamidoimidazole-succinocarboxamide synthase [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG2835 consensus Phosphoribosylamidoimidazole-succinocarboxamide synthase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK10076 pyruvate formate lyase II activase; Provisional Back     alignment and domain information
>cd08170 GlyDH Glycerol dehydrogenases (GlyDH) catalyzes oxidation of glycerol to dihydroxyacetone in glycerol dissmilation Back     alignment and domain information
>cd08550 GlyDH-like Glycerol_dehydrogenase-like Back     alignment and domain information
>cd08185 Fe-ADH1 Iron-containing alcohol dehydrogenases-like Back     alignment and domain information
>PF06258 Mito_fiss_Elm1: Mitochondrial fission ELM1; InterPro: IPR009367 This family consists of several hypothetical eukaryotic and prokaryotic proteins Back     alignment and domain information
>cd08183 Fe-ADH2 Iron-containing alcohol dehydrogenases-like Back     alignment and domain information
>cd08551 Fe-ADH iron-containing alcohol dehydrogenases (Fe-ADH)-like Back     alignment and domain information
>cd08171 GlyDH-like2 Glycerol dehydrogenase-like Back     alignment and domain information
>cd08195 DHQS Dehydroquinate synthase (DHQS) catalyzes the conversion of DAHP to DHQ in shikimate pathway for aromatic compounds synthesis Back     alignment and domain information
>PRK09423 gldA glycerol dehydrogenase; Provisional Back     alignment and domain information
>cd08175 G1PDH Glycerol-1-phosphate dehydrogenase (G1PDH) catalyzes the reversible reduction of dihydroxyacetone phosphate (DHAP) to glycerol-1-phosphate (G1P) in an NADH-dependent manner Back     alignment and domain information
>TIGR01357 aroB 3-dehydroquinate synthase Back     alignment and domain information
>PRK00843 egsA NAD(P)-dependent glycerol-1-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>cd03028 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-interacting cousin of TRX (PICOT)-like subfamily; composed of PICOT and GRX-PICOT-like proteins Back     alignment and domain information
>cd08186 Fe-ADH8 Iron-containing alcohol dehydrogenase Back     alignment and domain information
>cd08176 LPO Lactadehyde:propanediol oxidoreductase (LPO) catalyzes the interconversion between L-lactaldehyde and L-1,2-propanediol in Escherichia coli and other enterobacteria Back     alignment and domain information
>cd08182 HEPD Hydroxyethylphosphoate dehydrogenase (HEPD) catalyzes the reduction of phosphonoacetaldehyde (PnAA) to hydroxyethylphosphoate (HEP) Back     alignment and domain information
>cd08194 Fe-ADH6 Iron-containing alcohol dehydrogenases-like Back     alignment and domain information
>TIGR00365 monothiol glutaredoxin, Grx4 family Back     alignment and domain information
>cd08178 AAD_C C-terminal alcohol dehydrogenase domain of the acetaldehyde dehydrogenase-alcohol dehydrogenase bifunctional two-domain protein (AAD) Back     alignment and domain information
>PRK00002 aroB 3-dehydroquinate synthase; Reviewed Back     alignment and domain information
>TIGR02638 lactal_redase lactaldehyde reductase Back     alignment and domain information
>PF00465 Fe-ADH: Iron-containing alcohol dehydrogenase ; InterPro: IPR001670 Alcohol dehydrogenase (1 Back     alignment and domain information
>cd08187 BDH Butanol dehydrogenase catalyzes the conversion of butyraldehyde to butanol with the cofactor NAD(P)H being oxidized in the process Back     alignment and domain information
>cd08197 DOIS 2-deoxy-scyllo-inosose synthase (DOIS) catalyzes carbocycle formation from D-glucose-6-phosphate to 2-deoxy-scyllo-inosose through a multistep reaction in the biosynthesis of aminoglycoside antibiotics Back     alignment and domain information
>cd08181 PPD-like 1,3-propanediol dehydrogenase-like (PPD) Back     alignment and domain information
>PF00763 THF_DHG_CYH: Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain; InterPro: IPR020630 Enzymes that participate in the transfer of one-carbon units require the coenzyme tetrahydrofolate (THF) Back     alignment and domain information
>cd08173 Gro1PDH Sn-glycerol-1-phosphate dehydrogenase (Gro1PDH) catalyzes the reversible conversion between dihydroxyacetone phosphate and glycerol-1-phosphate using either NADH or NADPH as a coenzyme Back     alignment and domain information
>cd08192 Fe-ADH7 Iron-containing alcohol dehydrogenases-like, involved in the linear alkylbenzenesulfonate (LAS) degradation pathway Back     alignment and domain information
>cd03786 GT1_UDP-GlcNAc_2-Epimerase Bacterial members of the UDP-N-Acetylglucosamine (GlcNAc) 2-Epimerase family are known to catalyze the reversible interconversion of UDP-GlcNAc and UDP-N-acetylmannosamine (UDP-ManNAc) Back     alignment and domain information
>cd08188 Fe-ADH4 Iron-containing alcohol dehydrogenases-like Back     alignment and domain information
>cd08189 Fe-ADH5 Iron-containing alcohol dehydrogenases-like Back     alignment and domain information
>cd08179 NADPH_BDH NADPH-dependent butanol dehydrogenase involved in the butanol and ethanol formation pathway in bacteria Back     alignment and domain information
>PRK10624 L-1,2-propanediol oxidoreductase; Provisional Back     alignment and domain information
>PRK11914 diacylglycerol kinase; Reviewed Back     alignment and domain information
>cd08193 HVD 5-hydroxyvalerate dehydrogenase (HVD) catalyzes the oxidation of 5-hydroxyvalerate to 5-oxovalerate with NAD+ as cofactor Back     alignment and domain information
>cd07766 DHQ_Fe-ADH Dehydroquinate synthase-like (DHQ-like) and iron-containing alcohol dehydrogenases (Fe-ADH) Back     alignment and domain information
>TIGR03702 lip_kinase_YegS lipid kinase YegS Back     alignment and domain information
>cd08190 HOT Hydroxyacid-oxoacid transhydrogenase (HOT) involved in gamma-hydroxybutyrate metabolism Back     alignment and domain information
>cd08199 EEVS 2-epi-5-epi-valiolone synthase (EEVS) Back     alignment and domain information
>PF10096 DUF2334: Uncharacterized protein conserved in bacteria (DUF2334); InterPro: IPR018763 This group of proteins has no known function Back     alignment and domain information
>PRK15454 ethanol dehydrogenase EutG; Provisional Back     alignment and domain information
>PRK09860 putative alcohol dehydrogenase; Provisional Back     alignment and domain information
>cd08549 G1PDH_related Glycerol-1-phosphate_dehydrogenase and related proteins Back     alignment and domain information
>PF13407 Peripla_BP_4: Periplasmic binding protein domain; PDB: 3BRS_B 3GBP_A 3GA5_A 1GCG_A 1GCA_A 3H75_A 3D02_A 3L49_B 3EJW_B 3T95_A Back     alignment and domain information
>PRK01372 ddl D-alanine--D-alanine ligase; Reviewed Back     alignment and domain information
>COG0695 GrxC Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03027 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Egl-10, and Pleckstrin (DEP) subfamily; composed of uncharacterized proteins containing a GRX domain and additional domains DEP and DUF547, both of which have unknown functions Back     alignment and domain information
>PRK10653 D-ribose transporter subunit RbsB; Provisional Back     alignment and domain information
>PLN02834 3-dehydroquinate synthase Back     alignment and domain information
>cd01988 Na_H_Antiporter_C The C-terminal domain of a subfamily of Na+ /H+ antiporter existed in bacteria and archea Back     alignment and domain information
>cd01391 Periplasmic_Binding_Protein_Type_1 Type 1 periplasmic binding fold superfamily Back     alignment and domain information
>PRK13055 putative lipid kinase; Reviewed Back     alignment and domain information
>PRK13337 putative lipid kinase; Reviewed Back     alignment and domain information
>PRK15138 aldehyde reductase; Provisional Back     alignment and domain information
>cd01539 PBP1_GGBP Periplasmic glucose/galactose-binding protein (GGBP) involved in chemotaxis towards, and active transport of, glucose and galactose in various bacterial species Back     alignment and domain information
>PF00462 Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors Back     alignment and domain information
>cd00860 ThrRS_anticodon ThrRS Threonyl-anticodon binding domain Back     alignment and domain information
>cd08191 HHD 6-hydroxyhexanoate dehydrogenase (HHD) catalyzes the oxidation of 6-hydroxyhexanoate to 6-oxohexanoate Back     alignment and domain information
>PF04392 ABC_sub_bind: ABC transporter substrate binding protein; InterPro: IPR007487 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>PRK13054 lipid kinase; Reviewed Back     alignment and domain information
>cd08177 MAR Maleylacetate reductase is involved in many aromatic compounds degradation pathways of aerobic microbes Back     alignment and domain information
>cd01452 VWA_26S_proteasome_subunit 26S proteasome plays a major role in eukaryotic protein breakdown, especially for ubiquitin-tagged proteins Back     alignment and domain information
>PRK10703 DNA-binding transcriptional repressor PurR; Provisional Back     alignment and domain information
>PRK10014 DNA-binding transcriptional repressor MalI; Provisional Back     alignment and domain information
>PRK00861 putative lipid kinase; Reviewed Back     alignment and domain information
>cd08180 PDD 1,3-propanediol dehydrogenase (PPD) catalyzes the reduction of 3-hydroxypropionaldehyde (3-HPA) to 1,3-propanediol in glycerol metabolism Back     alignment and domain information
>cd06318 PBP1_ABC_sugar_binding_like_9 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>cd06305 PBP1_methylthioribose_binding_like Methylthioribose-binding protein-like of ABC-type transport systems that belong to a family of pentose/hexose sugar-binding proteins of the type I periplasmic binding protein (PBP1) superfamily Back     alignment and domain information
>COG1454 EutG Alcohol dehydrogenase, class IV [Energy production and conversion] Back     alignment and domain information
>COG2984 ABC-type uncharacterized transport system, periplasmic component [General function prediction only] Back     alignment and domain information
>cd03418 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX bacterial class 1 and 3 (b_1_3)-like subfamily; composed of bacterial GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>PLN02958 diacylglycerol kinase/D-erythro-sphingosine kinase Back     alignment and domain information
>cd04795 SIS SIS domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query147
1o4v_A183 Crystal Structure Of The Catalytic Subunit Of A Pho 3e-15
2fw1_A183 Structure Of Pure (n5-carboxyaminoimidazole Ribonuc 4e-11
1u11_A182 Pure (N5-Carboxyaminoimidazole Ribonucleotide Mutas 4e-11
3lp6_A174 Crystal Structure Of Rv3275c-E60a From Mycobacteriu 4e-11
4grd_A173 Crystal Structure Of Phosphoribosylaminoimidazole C 2e-10
2fwa_A183 Structure Of Pure (n5-carboxyaminoimidazole Ribonuc 4e-10
2fw6_A183 Structure Of Pure (N5-Carboxyaminoimidazole Ribonuc 4e-10
2fwb_A183 Structure Of Pure (N5-Carboxyaminoimidazole Ribonuc 5e-10
2fw9_A183 Structure Of Pure (n5-carboxyaminoimidazole Ribonuc 5e-10
2fwi_A183 Structure Of Pure (n5-carboxyaminoimidazole Ribonuc 6e-10
1xmp_A170 Crystal Structure Of Pure (Ba0288) From Bacillus An 7e-10
4b4k_A181 Crystal Structure Of Bacillus Anthracis Pure Length 8e-10
3oow_A166 Octameric Structure Of The Phosphoribosylaminoimida 4e-08
3opq_A163 Phosphoribosylaminoimidazole Carboxylase With Fruct 5e-08
2fw8_A183 Structure Of Pure (N5-Carboxyaminoimidazole Ribonuc 8e-08
2nsh_A169 E. Coli Pure H45q Mutant Complexed With Nitro-Air L 2e-06
2nsl_A169 E. Coli Pure H45n Mutant Complexed With Cair Length 2e-06
2ate_A169 Structure Of The Complex Of Pure With Nitroair Leng 9e-06
1qcz_A169 Crystal Structure Of E. Coli Pure, An Unusual Mutas 9e-06
1d7a_A161 Crystal Structure Of E. Coli Pure-Mononucleotide Co 1e-05
3kuu_A174 Structure Of The Pure Phosphoribosylaminoimidazole 1e-05
3trh_A169 Structure Of A Phosphoribosylaminoimidazole Carboxy 7e-04
3ors_A163 Crystal Structure Of N5-Carboxyaminoimidazole Ribon 8e-04
>pdb|1O4V|A Chain A, Crystal Structure Of The Catalytic Subunit Of A Phosphoribosylaminoimidazole Mutase (Tm0446) From Thermotoga Maritima At 1.77 A Resolution Length = 183 Back     alignment and structure 
Iteration: 1

 Score = 77.4 bits (189), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 47/76 (61%)
Query: 59  PIVGIIMESDLDLPVMNDAARTLSDFGVPYEIKILPPHQNCKEALSYALSAKERGIKIII 118
           P VGIIM SD DLPVM  AA  L +FG+ YEI I+  H+       YA +A+ERGI++II
Sbjct: 14  PRVGIIMGSDSDLPVMKQAAEILEEFGIDYEITIVSAHRTPDRMFEYAKNAEERGIEVII 73
Query: 119 VGDGVEAHLSGTCSCC 134
            G G  AHL G  +  
Sbjct: 74  AGAGGAAHLPGMVASI 89
>pdb|2FW1|A Chain A, Structure Of Pure (n5-carboxyaminoimidazole Ribonucleotide Mutase) From The Acidophilic Bacterium Acetobacter Aceti, At Ph 8.5 Length = 183 Back     alignment and structure
>pdb|1U11|A Chain A, Pure (N5-Carboxyaminoimidazole Ribonucleotide Mutase) From The Acidophile Acetobacter Aceti Length = 182 Back     alignment and structure
>pdb|3LP6|A Chain A, Crystal Structure Of Rv3275c-E60a From Mycobacterium Tubercu 1.7a Resolution Length = 174 Back     alignment and structure
>pdb|4GRD|A Chain A, Crystal Structure Of Phosphoribosylaminoimidazole Carboxylase Catalytic Subunit From Burkholderia Cenocepacia J2315 Length = 173 Back     alignment and structure
>pdb|2FWA|A Chain A, Structure Of Pure (n5-carboxyaminoimidazole Ribonucleotide Mutase) H89n From The Acidophilic Bacterium Acetobacter Aceti, At Ph 7 Length = 183 Back     alignment and structure
>pdb|2FW6|A Chain A, Structure Of Pure (N5-Carboxyaminoimidazole Ribonucleotide Mutase) Mutant H59n From The Acidophilic Bacterium Acetobacter Aceti, At Ph 5.4 Length = 183 Back     alignment and structure
>pdb|2FWB|A Chain A, Structure Of Pure (N5-Carboxyaminoimidazole Ribonucleotide Mutase) H89f From The Acidophilic Bacterium Acetobacter Aceti, At Ph 8 Length = 183 Back     alignment and structure
>pdb|2FW9|A Chain A, Structure Of Pure (n5-carboxyaminoimidazole Ribonucleotide Mutase) H59f From The Acidophilic Bacterium Acetobacter Aceti, At Ph 8 Length = 183 Back     alignment and structure
>pdb|2FWI|A Chain A, Structure Of Pure (n5-carboxyaminoimidazole Ribonucleotide Mutase) H59d, From The Acidophilic Bacterium Acetobacter Aceti, Complexed With 5-aminoimidazole Ribonucleotide (air) Length = 183 Back     alignment and structure
>pdb|1XMP|A Chain A, Crystal Structure Of Pure (Ba0288) From Bacillus Anthracis At 1.8 Resolution Length = 170 Back     alignment and structure
>pdb|4B4K|A Chain A, Crystal Structure Of Bacillus Anthracis Pure Length = 181 Back     alignment and structure
>pdb|3OOW|A Chain A, Octameric Structure Of The Phosphoribosylaminoimidazole Carboxylase Catalytic Subunit From Francisella Tularensis Subsp. Tularensis Schu S4. Length = 166 Back     alignment and structure
>pdb|3OPQ|A Chain A, Phosphoribosylaminoimidazole Carboxylase With Fructose-6-Phosphate Bound To The Central Channel Of The Octameric Protein Structure. Length = 163 Back     alignment and structure
>pdb|2FW8|A Chain A, Structure Of Pure (N5-Carboxyaminoimidazole Ribonucleotide Mutase) H89g From The Acidophilic Bacterium Acetobacter Aceti, At Ph 8 Length = 183 Back     alignment and structure
>pdb|2NSH|A Chain A, E. Coli Pure H45q Mutant Complexed With Nitro-Air Length = 169 Back     alignment and structure
>pdb|2NSL|A Chain A, E. Coli Pure H45n Mutant Complexed With Cair Length = 169 Back     alignment and structure
>pdb|2ATE|A Chain A, Structure Of The Complex Of Pure With Nitroair Length = 169 Back     alignment and structure
>pdb|1QCZ|A Chain A, Crystal Structure Of E. Coli Pure, An Unusual Mutase That Catalyzes The Conversion Of N5-carboxyaminoimidazole Ribonucleotide (n5-cair) To 4-carboxyaminoimidazole Ribonucleotide (cair) In The Purine Biosynthetic Pathway Length = 169 Back     alignment and structure
>pdb|1D7A|A Chain A, Crystal Structure Of E. Coli Pure-Mononucleotide Complex. Length = 161 Back     alignment and structure
>pdb|3KUU|A Chain A, Structure Of The Pure Phosphoribosylaminoimidazole Carboxylase Catalytic Subunit From Yersinia Pestis Length = 174 Back     alignment and structure
>pdb|3TRH|A Chain A, Structure Of A Phosphoribosylaminoimidazole Carboxylase Catalytic Subunit (Pure) From Coxiella Burnetii Length = 169 Back     alignment and structure
>pdb|3ORS|A Chain A, Crystal Structure Of N5-Carboxyaminoimidazole Ribonucleotide Mutase From Staphylococcus Aureus Length = 163 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query147
1o4v_A183 Phosphoribosylaminoimidazole mutase PURE; structur 1e-27
3lp6_A174 Phosphoribosylaminoimidazole carboxylase catalyti; 7e-27
3trh_A169 Phosphoribosylaminoimidazole carboxylase carboxylt 7e-25
3rg8_A159 Phosphoribosylaminoimidazole carboxylase, PURE PR; 2e-24
3ors_A163 N5-carboxyaminoimidazole ribonucleotide mutase; is 2e-24
4b4k_A181 N5-carboxyaminoimidazole ribonucleotide mutase; is 4e-24
1xmp_A170 PURE, phosphoribosylaminoimidazole carboxylase; pu 6e-24
3kuu_A174 Phosphoribosylaminoimidazole carboxylase catalyti 9e-24
3oow_A166 Phosphoribosylaminoimidazole carboxylase,catalyic; 3e-23
1u11_A182 PURE (N5-carboxyaminoimidazole ribonucleotide MUT; 3e-23
2ywx_A157 Phosphoribosylaminoimidazole carboxylase catalyti; 3e-20
2h31_A425 Multifunctional protein ADE2; alpha-beta-alpha, li 2e-14
>1o4v_A Phosphoribosylaminoimidazole mutase PURE; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; 1.77A {Thermotoga maritima} SCOP: c.23.8.1 Length = 183 Back     alignment and structure
 Score =  100 bits (251), Expect = 1e-27
 Identities = 38/82 (46%), Positives = 48/82 (58%)

Query: 48  EENPNGDSTDAPIVGIIMESDLDLPVMNDAARTLSDFGVPYEIKILPPHQNCKEALSYAL 107
            +  +      P VGIIM SD DLPVM  AA  L +FG+ YEI I+  H+       YA 
Sbjct: 3   SDKIHHHHHHVPRVGIIMGSDSDLPVMKQAAEILEEFGIDYEITIVSAHRTPDRMFEYAK 62

Query: 108 SAKERGIKIIIVGDGVEAHLSG 129
           +A+ERGI++II G G  AHL G
Sbjct: 63  NAEERGIEVIIAGAGGAAHLPG 84
>3lp6_A Phosphoribosylaminoimidazole carboxylase catalyti; alpha and beta protein, structural genomics, PSI-2, protein initiative; 1.70A {Mycobacterium tuberculosis} Length = 174 Back     alignment and structure
>3trh_A Phosphoribosylaminoimidazole carboxylase carboxyltransferase subunit; purines, pyrimidines, nucleosides, nucleotides, lyase; 2.20A {Coxiella burnetii} Length = 169 Back     alignment and structure
>3rg8_A Phosphoribosylaminoimidazole carboxylase, PURE PR; purine biosynthesis, lyase; 1.74A {Treponema denticola} PDB: 3rgg_A* Length = 159 Back     alignment and structure
>3ors_A N5-carboxyaminoimidazole ribonucleotide mutase; isomerase, isomerase,biosynthetic protein; 1.45A {Staphylococcus aureus subsp} Length = 163 Back     alignment and structure
>4b4k_A N5-carboxyaminoimidazole ribonucleotide mutase; isomerase; 2.50A {Bacillus anthracis} Length = 181 Back     alignment and structure
>1xmp_A PURE, phosphoribosylaminoimidazole carboxylase; purine biosynthesis, spine, lyase; 1.80A {Bacillus anthracis} SCOP: c.23.8.1 Length = 170 Back     alignment and structure
>3kuu_A Phosphoribosylaminoimidazole carboxylase catalyti PURE; 3-layer (ABA) sandwich, rossmann fold, csgid, lyase, structu genomics; 1.41A {Yersinia pestis} PDB: 1d7a_A* 1qcz_A 2ate_A* 2nsl_A* 2nsh_A* 2nsj_A* Length = 174 Back     alignment and structure
>3oow_A Phosphoribosylaminoimidazole carboxylase,catalyic; structural genomics, center for structural genomics of infec diseases, csgid; HET: MSE; 1.75A {Francisella tularensis subsp} PDB: 3opq_A* Length = 166 Back     alignment and structure
>1u11_A PURE (N5-carboxyaminoimidazole ribonucleotide MUT; acidophIle, protein stability, lyase; HET: CIT; 1.55A {Acetobacter aceti} SCOP: c.23.8.1 PDB: 2fwj_A* 2fw1_A* 2fwb_A 2fwa_A 2fw9_A 2fw7_A 2fw6_A 2fwp_A* 2fwi_A* 2fw8_A Length = 182 Back     alignment and structure
>2ywx_A Phosphoribosylaminoimidazole carboxylase catalyti; rossmann fold, structural genomics, NPPSFA; 2.31A {Methanocaldococcus jannaschii} Length = 157 Back     alignment and structure
>2h31_A Multifunctional protein ADE2; alpha-beta-alpha, ligase, lyase; 2.80A {Homo sapiens} Length = 425 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query147
4b4k_A181 N5-carboxyaminoimidazole ribonucleotide mutase; is 100.0
2h31_A425 Multifunctional protein ADE2; alpha-beta-alpha, li 100.0
4grd_A173 N5-CAIR mutase, phosphoribosylaminoimidazole carbo 99.98
3ors_A163 N5-carboxyaminoimidazole ribonucleotide mutase; is 99.97
3trh_A169 Phosphoribosylaminoimidazole carboxylase carboxylt 99.97
1xmp_A170 PURE, phosphoribosylaminoimidazole carboxylase; pu 99.97
3lp6_A174 Phosphoribosylaminoimidazole carboxylase catalyti; 99.97
3kuu_A174 Phosphoribosylaminoimidazole carboxylase catalyti 99.97
3rg8_A159 Phosphoribosylaminoimidazole carboxylase, PURE PR; 99.97
1u11_A182 PURE (N5-carboxyaminoimidazole ribonucleotide MUT; 99.97
3oow_A166 Phosphoribosylaminoimidazole carboxylase,catalyic; 99.97
1o4v_A183 Phosphoribosylaminoimidazole mutase PURE; structur 99.97
2ywx_A157 Phosphoribosylaminoimidazole carboxylase catalyti; 99.96
3uhj_A 387 Probable glycerol dehydrogenase; structural genomi 93.86
1jq5_A 370 Glycerol dehydrogenase; oxidoreductase, NAD, glyce 93.32
3bfj_A 387 1,3-propanediol oxidoreductase; opportunistic path 92.57
1o2d_A 371 Alcohol dehydrogenase, iron-containing; TM0920, st 91.62
3okf_A 390 3-dehydroquinate synthase; structural genomics, ce 91.62
3ce9_A 354 Glycerol dehydrogenase; NP_348253.1, 3-dehydroquin 90.52
3ox4_A 383 Alcohol dehydrogenase 2; iron, NAD, oxidoreductase 90.51
3zyw_A111 Glutaredoxin-3; metal binding protein; 1.84A {Homo 90.2
1sg6_A 393 Pentafunctional AROM polypeptide; shikimate pathwa 89.14
1vlj_A 407 NADH-dependent butanol dehydrogenase; TM0820, stru 89.11
1rrm_A 386 Lactaldehyde reductase; structural genomics, dehyd 89.0
1ta9_A 450 Glycerol dehydrogenase; oxidoredu; 1.90A {Schizosa 88.97
3ipz_A109 Monothiol glutaredoxin-S14, chloroplastic; electro 88.92
3h5o_A 339 Transcriptional regulator GNTR; transcription regu 88.56
3msz_A89 Glutaredoxin 1; alpha-beta sandwich, center for st 88.49
3dbi_A 338 Sugar-binding transcriptional regulator, LACI FAM; 87.99
3l49_A 291 ABC sugar (ribose) transporter, periplasmic substr 87.98
3egc_A 291 Putative ribose operon repressor; structural genom 87.5
1aba_A87 Glutaredoxin; electron transport; HET: MES; 1.45A 86.91
1jx6_A 342 LUXP protein; protein-ligand complex, signaling pr 86.4
3m9w_A 313 D-xylose-binding periplasmic protein; xylose bindi 86.4
3o1i_D 304 Periplasmic protein TORT; ligand free, two compone 86.08
3kjx_A 344 Transcriptional regulator, LACI family; LACL famil 85.97
3dlo_A155 Universal stress protein; unknown function, struct 85.87
1tjy_A 316 Sugar transport protein; protein-ligand complex, s 85.66
3l6u_A 293 ABC-type sugar transport system periplasmic compo; 85.27
3e3m_A 355 Transcriptional regulator, LACI family; structural 85.09
4fn4_A 254 Short chain dehydrogenase; NADH-binding, rossmann 85.01
3s99_A 356 Basic membrane lipoprotein; ssgcid, structural gen 84.62
3eth_A355 Phosphoribosylaminoimidazole carboxylase ATPase su 84.43
3jvd_A 333 Transcriptional regulators; structural genomics, P 83.96
3gx8_A121 Monothiol glutaredoxin-5, mitochondrial; TRX fold, 83.89
1tq8_A163 Hypothetical protein RV1636; MTCY01B2.28, structur 83.84
1oj7_A 408 Hypothetical oxidoreductase YQHD; structural genom 83.64
3lft_A 295 Uncharacterized protein; ABC, ATPase, cassette, L- 83.36
3hl0_A 353 Maleylacetate reductase; structur genomics, PSI-2, 83.0
3qmx_A99 Glutaredoxin A, glutaredoxin 3; electron transport 82.97
2o20_A 332 Catabolite control protein A; CCPA, transcriptiona 82.92
2wem_A118 Glutaredoxin-related protein 5; chromosome 14 open 82.73
2gru_A 368 2-deoxy-scyllo-inosose synthase; aminoglycoside, 2 82.49
3qbe_A 368 3-dehydroquinate synthase; shikimate pathway, myco 82.38
3jy6_A 276 Transcriptional regulator, LACI family; NYSGXRC, P 81.61
1wik_A109 Thioredoxin-like protein 2; picot homology 2 domai 81.59
1nvm_A 345 HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered 81.41
2yan_A105 Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {H 81.35
3ctp_A 330 Periplasmic binding protein/LACI transcriptional; 81.19
3lkv_A 302 Uncharacterized conserved domain protein; ATPase b 80.95
3idf_A138 USP-like protein; universal, stress, PSI, MCSG, st 80.64
2qh8_A 302 Uncharacterized protein; conserved domain protein, 80.61
3loq_A294 Universal stress protein; structural genomics, PSI 80.5
3jzd_A 358 Iron-containing alcohol dehydrogenase; YP_298327.1 80.2
>4b4k_A N5-carboxyaminoimidazole ribonucleotide mutase; isomerase; 2.50A {Bacillus anthracis} Back     alignment and structure
Probab=100.00  E-value=2.7e-33  Score=223.48  Aligned_cols=90  Identities=33%  Similarity=0.510  Sum_probs=82.5

Q ss_pred             CCCCeEEEEecCCCCHHHHHHHHHHHHHhCCCeEEEEEcCCCChHHHHHHHHHHhhCCceEEEEecCCCCchhhhhhccc
Q 032094           56 TDAPIVGIIMESDLDLPVMNDAARTLSDFGVPYEIKILPPHQNCKEALSYALSAKERGIKIIIVGDGVEAHLSGTCSCCK  135 (147)
Q Consensus        56 ~~~~~V~IimGS~SDl~~~~~a~~~L~~fGI~~ev~V~SAHRtp~~l~~~~~~~~~~g~~ViIAvAG~aAhLpGvvAg~T  135 (147)
                      ..+|+|+|||||+||+|+|++|.++|++|||+||++|+||||+|+++.+|+++++.+|++||||+||++||||||+||+|
T Consensus        20 ~mkp~V~IimGS~SD~~v~~~a~~~L~~~gI~~e~~V~SAHRtp~~l~~~~~~a~~~g~~ViIa~AG~aahLpGvvAa~T   99 (181)
T 4b4k_A           20 HMKSLVGVIMGSTSDWETMKYACDILDELNIPYEKKVVSAHRTPDYMFEYAETARERGLKVIIAGAGGAAHLPGMVAAKT   99 (181)
T ss_dssp             --CCSEEEEESSGGGHHHHHHHHHHHHHTTCCEEEEECCTTTSHHHHHHHHHHTTTTTCCEEEEEECSSCCHHHHHHTTC
T ss_pred             CCCccEEEEECCHhHHHHHHHHHHHHHHcCCCeeEEEEccccChHHHHHHHHHHHhcCceEEEEeccccccchhhHHhcC
Confidence            34578999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCc--ce--eeccc
Q 032094          136 FSN--TC--YSCSF  145 (147)
Q Consensus       136 ~~~--~~--~~~~~  145 (147)
                      ..|  -|  |+.++
T Consensus       100 ~~PVIGVPv~s~~l  113 (181)
T 4b4k_A          100 NLPVIGVPVQSKAL  113 (181)
T ss_dssp             CSCEEEEECCCTTT
T ss_pred             CCCEEEEecCCCCc
Confidence            877  23  66554
>2h31_A Multifunctional protein ADE2; alpha-beta-alpha, ligase, lyase; 2.80A {Homo sapiens} Back     alignment and structure
>4grd_A N5-CAIR mutase, phosphoribosylaminoimidazole carboxylase catalyti; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures; 1.85A {Burkholderia cenocepacia} Back     alignment and structure
>3ors_A N5-carboxyaminoimidazole ribonucleotide mutase; isomerase, isomerase,biosynthetic protein; 1.45A {Staphylococcus aureus subsp} Back     alignment and structure
>3trh_A Phosphoribosylaminoimidazole carboxylase carboxyltransferase subunit; purines, pyrimidines, nucleosides, nucleotides, lyase; 2.20A {Coxiella burnetii} Back     alignment and structure
>1xmp_A PURE, phosphoribosylaminoimidazole carboxylase; purine biosynthesis, spine, lyase; 1.80A {Bacillus anthracis} SCOP: c.23.8.1 Back     alignment and structure
>3lp6_A Phosphoribosylaminoimidazole carboxylase catalyti; alpha and beta protein, structural genomics, PSI-2, protein initiative; 1.70A {Mycobacterium tuberculosis} SCOP: c.23.8.0 Back     alignment and structure
>3kuu_A Phosphoribosylaminoimidazole carboxylase catalyti PURE; 3-layer (ABA) sandwich, rossmann fold, csgid, lyase, structu genomics; 1.41A {Yersinia pestis} SCOP: c.23.8.1 PDB: 1d7a_A* 1qcz_A 2ate_A* 2nsl_A* 2nsh_A* 2nsj_A* Back     alignment and structure
>3rg8_A Phosphoribosylaminoimidazole carboxylase, PURE PR; purine biosynthesis, lyase; 1.74A {Treponema denticola} SCOP: c.23.8.0 PDB: 3rgg_A* Back     alignment and structure
>1u11_A PURE (N5-carboxyaminoimidazole ribonucleotide MUT; acidophIle, protein stability, lyase; HET: CIT; 1.55A {Acetobacter aceti} SCOP: c.23.8.1 PDB: 2fwj_A* 2fw1_A* 2fwb_A 2fwa_A 2fw9_A 2fw7_A 2fw6_A 2fwp_A* 2fwi_A* 2fw8_A Back     alignment and structure
>3oow_A Phosphoribosylaminoimidazole carboxylase,catalyic; structural genomics, center for structural genomics of infec diseases, csgid; HET: MSE; 1.75A {Francisella tularensis subsp} SCOP: c.23.8.1 PDB: 3opq_A* Back     alignment and structure
>1o4v_A Phosphoribosylaminoimidazole mutase PURE; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; 1.77A {Thermotoga maritima} SCOP: c.23.8.1 Back     alignment and structure
>2ywx_A Phosphoribosylaminoimidazole carboxylase catalyti; rossmann fold, structural genomics, NPPSFA; 2.31A {Methanocaldococcus jannaschii} Back     alignment and structure
>3uhj_A Probable glycerol dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.34A {Sinorhizobium meliloti} Back     alignment and structure
>1jq5_A Glycerol dehydrogenase; oxidoreductase, NAD, glycerol metabolism; HET: NAD; 1.70A {Geobacillus stearothermophilus} SCOP: e.22.1.2 PDB: 1jpu_A* 1jqa_A* Back     alignment and structure
>3bfj_A 1,3-propanediol oxidoreductase; opportunistic pathogens, decamer, structural genomics,struct proteomics in europe, spine; 2.70A {Klebsiella pneumoniae} Back     alignment and structure
>1o2d_A Alcohol dehydrogenase, iron-containing; TM0920, structural genomics, JCSG, PSI, protein structure initiative; HET: MSE NAP TRS; 1.30A {Thermotoga maritima} SCOP: e.22.1.2 PDB: 1vhd_A* Back     alignment and structure
>3okf_A 3-dehydroquinate synthase; structural genomics, center for structural genomics of infec diseases, csgid, NAD, lyase; HET: NAD; 2.50A {Vibrio cholerae o1 biovar eltor} Back     alignment and structure
>3ce9_A Glycerol dehydrogenase; NP_348253.1, 3-dehydroquinate syntha structural genomics, joint center for structural genomics; HET: MSE; 2.37A {Clostridium acetobutylicum atcc 824} Back     alignment and structure
>3ox4_A Alcohol dehydrogenase 2; iron, NAD, oxidoreductase; HET: NAD; 2.00A {Zymomonas mobilis} PDB: 3owo_A* Back     alignment and structure
>3zyw_A Glutaredoxin-3; metal binding protein; 1.84A {Homo sapiens} Back     alignment and structure
>1sg6_A Pentafunctional AROM polypeptide; shikimate pathway, aromatic amino acid biosynthesis, DHQS, O form J, domain movement, cyclase, lyase; HET: NAD; 1.70A {Emericella nidulans} SCOP: e.22.1.1 PDB: 1nr5_A* 1nrx_A* 1nua_A 1nva_A* 1nvb_A* 1nvd_A* 1nve_A* 1nvf_A* 1dqs_A* Back     alignment and structure
>1vlj_A NADH-dependent butanol dehydrogenase; TM0820, structural G JCSG, protein structure initiative, PSI, joint center for S genomics; HET: NAP; 1.78A {Thermotoga maritima} SCOP: e.22.1.2 Back     alignment and structure
>1rrm_A Lactaldehyde reductase; structural genomics, dehydrogenase, PSI, protein structure initiative; HET: APR; 1.60A {Escherichia coli} SCOP: e.22.1.2 PDB: 2bi4_A* 2bl4_A* Back     alignment and structure
>1ta9_A Glycerol dehydrogenase; oxidoredu; 1.90A {Schizosaccharomyces pombe} Back     alignment and structure
>3ipz_A Monothiol glutaredoxin-S14, chloroplastic; electron transport, PL redox-active center, transit peptide, transport, oxidoreduc; 2.40A {Arabidopsis thaliana} PDB: 2lku_A Back     alignment and structure
>3h5o_A Transcriptional regulator GNTR; transcription regulator, GNTR,chromobacterium violaceum, PSI, SGX, DNA-binding; 2.30A {Chromobacterium violaceum} Back     alignment and structure
>3msz_A Glutaredoxin 1; alpha-beta sandwich, center for structural genomics of infec diseases, csgid, oxidoreductase; HET: GSH; 2.05A {Francisella tularensis subsp} PDB: 3lgc_A* Back     alignment and structure
>3dbi_A Sugar-binding transcriptional regulator, LACI FAM; structural genomics, sugar-binding transcriptional regulator structure initiative, PSI-2; HET: MSE; 2.45A {Escherichia coli K12} Back     alignment and structure
>3l49_A ABC sugar (ribose) transporter, periplasmic substrate-binding subunit; sugar binding/transporter, structural genomics, PSI; HET: UNL; 2.30A {Rhodobacter sphaeroides} Back     alignment and structure
>3egc_A Putative ribose operon repressor; structural genomics, unknown function, DNA-binding, transcri transcription regulation, PSI-2; 2.35A {Burkholderia thailandensis} Back     alignment and structure
>1aba_A Glutaredoxin; electron transport; HET: MES; 1.45A {Enterobacteria phage T4} SCOP: c.47.1.1 PDB: 1aaz_A 1de1_A 1de2_A Back     alignment and structure
>1jx6_A LUXP protein; protein-ligand complex, signaling protein; HET: AI2; 1.50A {Vibrio harveyi} SCOP: c.93.1.1 PDB: 1zhh_A* 2hj9_A* Back     alignment and structure
>3m9w_A D-xylose-binding periplasmic protein; xylose binding protein, conformational changes, SUGA protein; 2.15A {Escherichia coli} PDB: 3m9x_A* 3ma0_A* Back     alignment and structure
>3o1i_D Periplasmic protein TORT; ligand free, two component sensor, periplasmic binding prote signaling protein; HET: PE4; 2.80A {Vibrio parahaemolyticus} PDB: 3o1h_B* 3o1j_C Back     alignment and structure
>3kjx_A Transcriptional regulator, LACI family; LACL family, protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.33A {Silicibacter pomeroyi} Back     alignment and structure
>3dlo_A Universal stress protein; unknown function, structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics; HET: MSE; 1.97A {Archaeoglobus fulgidus} PDB: 3qtb_A* Back     alignment and structure
>1tjy_A Sugar transport protein; protein-ligand complex, signaling protein; HET: PAV; 1.30A {Salmonella typhimurium} SCOP: c.93.1.1 PDB: 1tm2_A 3t95_A* 3ejw_A* Back     alignment and structure
>3l6u_A ABC-type sugar transport system periplasmic compo; structural genomics, nysgrc, target 11006S, PSI-2, protein S initiative; 1.90A {Exiguobacterium sibiricum} Back     alignment and structure
>3e3m_A Transcriptional regulator, LACI family; structural genomics, DNA-binding, plasmid, transcription regulation, PSI-2; 1.60A {Silicibacter pomeroyi} Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
>3s99_A Basic membrane lipoprotein; ssgcid, structural genomics, SEA structural genomics center for infectious disease, adenine; HET: ADE; 2.05A {Brucella melitensis biovar abortus} Back     alignment and structure
>3eth_A Phosphoribosylaminoimidazole carboxylase ATPase subunit; ATP-grAsp, purine biosynthesis, antimicrobial, ATP-binding, decarboxylase, lyase; HET: ATP; 1.60A {Escherichia coli} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 PDB: 1b6r_A* 3etj_A* 1b6s_A* Back     alignment and structure
>3jvd_A Transcriptional regulators; structural genomics, PSI-2, sugar binding protein, transcrip regulation, protein structure initiative; 2.30A {Corynebacterium glutamicum} Back     alignment and structure
>3gx8_A Monothiol glutaredoxin-5, mitochondrial; TRX fold, electron transport, mitochondrion, redox-active center, transit peptide, transport; 1.67A {Saccharomyces cerevisiae} Back     alignment and structure
>1tq8_A Hypothetical protein RV1636; MTCY01B2.28, structural target, NYSGXRC, PSI, protein structure initiative; 2.40A {Mycobacterium tuberculosis} SCOP: c.26.2.4 Back     alignment and structure
>1oj7_A Hypothetical oxidoreductase YQHD; structural genomics; HET: NZQ; 2.0A {Escherichia coli} SCOP: e.22.1.2 Back     alignment and structure
>3lft_A Uncharacterized protein; ABC, ATPase, cassette, L-Trp, PSI, MCSG, structural genomics center for structural genomics; HET: MSE TRP; 1.35A {Streptococcus pneumoniae} Back     alignment and structure
>3hl0_A Maleylacetate reductase; structur genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; HET: MSE NAD EPE; 1.60A {Agrobacterium tumefaciens str} Back     alignment and structure
>3qmx_A Glutaredoxin A, glutaredoxin 3; electron transport; 1.82A {Synechocystis SP} SCOP: c.47.1.0 Back     alignment and structure
>2o20_A Catabolite control protein A; CCPA, transcriptional regulator, helix-turn-helix, transcrip; 1.90A {Lactococcus lactis} Back     alignment and structure
>2gru_A 2-deoxy-scyllo-inosose synthase; aminoglycoside, 2-deoxystreptamine, dehydroquinate synthase, lyase; HET: NAD EXO CAK; 2.15A {Bacillus circulans} PDB: 2d2x_A* Back     alignment and structure
>3qbe_A 3-dehydroquinate synthase; shikimate pathway, mycobacte tuberculosis, nicotinamide adenine dinucleotide (NAD)-depen enzyme; 2.07A {Mycobacterium tuberculosis} PDB: 3qbd_A Back     alignment and structure
>3jy6_A Transcriptional regulator, LACI family; NYSGXRC, PSI-II, protein S initiative, structural genomics; 1.97A {Lactobacillus brevis} Back     alignment and structure
>1wik_A Thioredoxin-like protein 2; picot homology 2 domain, picot protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 Back     alignment and structure
>1nvm_A HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: a.5.7.1 c.1.10.5 Back     alignment and structure
>2yan_A Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {Homo sapiens} Back     alignment and structure
>3ctp_A Periplasmic binding protein/LACI transcriptional; structural genomics, protein structure initiative; HET: XLF; 1.41A {Alkaliphilus metalliredigens} Back     alignment and structure
>3lkv_A Uncharacterized conserved domain protein; ATPase binding cassette, PSI, MCSG, structural genomics, Pro structure initiative; HET: PHE; 2.20A {Vibrio cholerae} Back     alignment and structure
>3idf_A USP-like protein; universal, stress, PSI, MCSG, structural genomics, midwest center for structural genomics structure initiative; 2.00A {Wolinella succinogenes} Back     alignment and structure
>3loq_A Universal stress protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: AMP; 2.32A {Archaeoglobus fulgidus} Back     alignment and structure
>3jzd_A Iron-containing alcohol dehydrogenase; YP_298327.1, putative alcohol dehedrogenase, structural GENO joint center for structural genomics; HET: MSE NAD PG4 P6G PGE; 2.10A {Ralstonia eutropha} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 147
d1qcza_163 c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoi 2e-20
d1o4va_169 c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoi 7e-19
d1xmpa_155 c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoi 1e-18
d1u11a_159 c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoi 2e-18
>d1qcza_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Escherichia coli [TaxId: 562]} Length = 163 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Flavodoxin-like
superfamily: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE)
family: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE)
domain: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE)
species: Escherichia coli [TaxId: 562]

 Score = 80.0 bits (197), Expect = 2e-20
 Identities = 26/85 (30%), Positives = 38/85 (44%), Gaps = 1/85 (1%)

Query: 59  PIVGIIMESDLDLPVMNDAARTLSDFGVPYEIKILPPHQNCKEALSYALSAKERGIKIII 118
             V I+M S  D   M  AA       VP+ ++++  H+   +  S+A SA+E G ++II
Sbjct: 2   ARVAIVMGSKSDWATMQFAAEIFEILNVPHHVEVVSAHRTPDKLFSFAESAEENGYQVII 61

Query: 119 VGDGVEAHLSGTCSCCKFSNTCYSC 143
            G G  AHL G     K        
Sbjct: 62  AGAGGAAHLPGMI-AAKTLVPVLGV 85
>d1o4va_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Thermotoga maritima [TaxId: 2336]} Length = 169 Back     information, alignment and structure
>d1xmpa_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Bacillus anthracis [TaxId: 1392]} Length = 155 Back     information, alignment and structure
>d1u11a_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Acetobacter aceti [TaxId: 435]} Length = 159 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query147
d1qcza_163 N5-CAIR mutase (phosphoribosylaminoimidazole carbo 99.97
d1u11a_159 N5-CAIR mutase (phosphoribosylaminoimidazole carbo 99.97
d1xmpa_155 N5-CAIR mutase (phosphoribosylaminoimidazole carbo 99.97
d1o4va_169 N5-CAIR mutase (phosphoribosylaminoimidazole carbo 99.96
d3etja179 N5-carboxyaminoimidazole ribonucleotide synthetase 95.58
d1jq5a_ 366 Glycerol dehydrogenase {Bacillus stearothermophilu 93.81
d2dria_ 271 D-ribose-binding protein {Escherichia coli, strain 93.26
d1o2da_ 359 Alcohol dehydrogenase TM0920 {Thermotoga maritima 93.19
d1zl0a2167 LD-carboxypeptidase A, N-terminal domain {Pseudomo 91.64
d2bona1 295 Lipid kinase YegS {Escherichia coli [TaxId: 562]} 91.32
d1vlja_ 398 NADH-dependent butanol dehydrogenase A (TM0820) {T 90.76
d1guda_ 288 D-allose-binding protein {Escherichia coli [TaxId: 90.21
d1tjya_ 316 AI-2 receptor LsrB {Salmonella typhi [TaxId: 90370 89.69
d1byka_ 255 Trehalose repressor, C-terminal domain {Escherichi 88.8
d1rrma_ 385 Lactaldehyde reductase FucO {Escherichia coli [Tax 88.71
d2rhca1 257 beta-keto acyl carrier protein reductase {Streptom 86.0
d2bd0a1 240 Bacterial sepiapterin reductase {Chlorobium tepidu 85.65
d1kjqa174 Glycinamide ribonucleotide transformylase PurT, C- 84.71
d1utaa_77 Cell division protein FtsN {Escherichia coli [TaxI 84.45
d1yb1a_ 244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 84.37
d1a4ia2125 Tetrahydrofolate dehydrogenase/cyclohydrolase {Hum 84.19
d2ae2a_ 259 Tropinone reductase {Jimsonweed (Datura stramonium 84.13
d2nzug1 275 Glucose-resistance amylase regulator CcpA, C-termi 83.74
d1fmca_ 255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 83.63
d1zema1 260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 82.59
d1wika_109 Thioredoxin-like protein 2 {Mouse (Mus musculus) [ 82.36
d2r8oa3136 Transketolase (TK), C-domain {Escherichia coli [Ta 81.54
d1g94a2 354 Bacterial alpha-amylase {Pseudoalteromonas halopla 81.17
d1xq1a_ 259 Tropinone reductase {Thale cress (Arabidopsis thal 81.15
d2fvya1 305 Galactose/glucose-binding protein {Escherichia col 81.14
d1oaaa_ 259 Sepiapterin reductase {Mouse (Mus musculus) [TaxId 80.79
>d1qcza_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Flavodoxin-like
superfamily: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE)
family: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE)
domain: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE)
species: Escherichia coli [TaxId: 562]

Probab=99.97  E-value=6e-32  Score=210.74  Aligned_cols=80  Identities=31%  Similarity=0.464  Sum_probs=78.4

Q ss_pred             CeEEEEecCCCCHHHHHHHHHHHHHhCCCeEEEEEcCCCChHHHHHHHHHHhhCCceEEEEecCCCCchhhhhhccccCc
Q 032094           59 PIVGIIMESDLDLPVMNDAARTLSDFGVPYEIKILPPHQNCKEALSYALSAKERGIKIIIVGDGVEAHLSGTCSCCKFSN  138 (147)
Q Consensus        59 ~~V~IimGS~SDl~~~~~a~~~L~~fGI~~ev~V~SAHRtp~~l~~~~~~~~~~g~~ViIAvAG~aAhLpGvvAg~T~~~  138 (147)
                      ++|+|||||+||+++|+++.++|++|||+||++|+||||+|+++.+|+++++++|++||||+||++||||||+||+|+.+
T Consensus         2 aKV~IImGS~SD~~~~~~a~~~L~~~gI~~e~~v~SAHRtp~~l~~~~~~~~~~~~~ViIa~AG~aa~LpgvvA~~t~~P   81 (163)
T d1qcza_           2 ARVAIVMGSKSDWATMQFAAEIFEILNVPHHVEVVSAHRTPDKLFSFAESAEENGYQVIIAGAGGAAHLPGMIAAKTLVP   81 (163)
T ss_dssp             CCEEEEESSGGGHHHHHHHHHHHHHHTCCEEEEECCTTTCHHHHHHHHHHTTTTTCSEEEEEECSSCCHHHHHHHSCSSC
T ss_pred             CeEEEEECcHhhHHHHHHHHHHHHHcCCCeEEEEeccccCHHHHHHHHHHHHHcCCeEEEEeccCCCcccchhhHhccce
Confidence            68999999999999999999999999999999999999999999999999999999999999999999999999999887
>d1u11a_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Acetobacter aceti [TaxId: 435]} Back     information, alignment and structure
>d1xmpa_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Bacillus anthracis [TaxId: 1392]} Back     information, alignment and structure
>d1o4va_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d3etja1 b.84.2.1 (A:277-355) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), C-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jq5a_ e.22.1.2 (A:) Glycerol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2dria_ c.93.1.1 (A:) D-ribose-binding protein {Escherichia coli, strain k-12 [TaxId: 562]} Back     information, alignment and structure
>d1o2da_ e.22.1.2 (A:) Alcohol dehydrogenase TM0920 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1zl0a2 c.23.16.7 (A:3-169) LD-carboxypeptidase A, N-terminal domain {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2bona1 e.52.1.2 (A:5-299) Lipid kinase YegS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vlja_ e.22.1.2 (A:) NADH-dependent butanol dehydrogenase A (TM0820) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1guda_ c.93.1.1 (A:) D-allose-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tjya_ c.93.1.1 (A:) AI-2 receptor LsrB {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d1byka_ c.93.1.1 (A:) Trehalose repressor, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rrma_ e.22.1.2 (A:) Lactaldehyde reductase FucO {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1kjqa1 b.84.2.1 (A:319-392) Glycinamide ribonucleotide transformylase PurT, C-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1utaa_ d.58.52.1 (A:) Cell division protein FtsN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a4ia2 c.58.1.2 (A:2-126) Tetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d2nzug1 c.93.1.1 (G:58-332) Glucose-resistance amylase regulator CcpA, C-terminal domain {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1wika_ c.47.1.1 (A:) Thioredoxin-like protein 2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2r8oa3 c.48.1.1 (A:528-663) Transketolase (TK), C-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g94a2 c.1.8.1 (A:1-354) Bacterial alpha-amylase {Pseudoalteromonas haloplanktis (Alteromonas haloplanktis) [TaxId: 228]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2fvya1 c.93.1.1 (A:2-306) Galactose/glucose-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure