Citrus Sinensis ID: 032278
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 144 | ||||||
| 449444486 | 125 | PREDICTED: uncharacterized protein LOC10 | 0.812 | 0.936 | 0.905 | 1e-55 | |
| 194239472 | 125 | downward leaf curling protein [Cucumis m | 0.812 | 0.936 | 0.897 | 3e-55 | |
| 225447590 | 125 | PREDICTED: uncharacterized protein LOC10 | 0.812 | 0.936 | 0.897 | 9e-55 | |
| 224131826 | 125 | predicted protein [Populus trichocarpa] | 0.812 | 0.936 | 0.871 | 6e-54 | |
| 351724953 | 125 | uncharacterized protein LOC100499990 [Gl | 0.812 | 0.936 | 0.871 | 1e-53 | |
| 218186951 | 162 | hypothetical protein OsI_38513 [Oryza sa | 0.812 | 0.722 | 0.854 | 3e-53 | |
| 115488792 | 125 | Os12g0514600 [Oryza sativa Japonica Grou | 0.812 | 0.936 | 0.854 | 3e-53 | |
| 351725355 | 125 | uncharacterized protein LOC100527863 [Gl | 0.812 | 0.936 | 0.863 | 4e-53 | |
| 217075492 | 125 | unknown [Medicago truncatula] | 0.812 | 0.936 | 0.863 | 8e-53 | |
| 226510052 | 137 | uncharacterized protein LOC100276203 [Ze | 0.812 | 0.854 | 0.829 | 2e-52 |
| >gi|449444486|ref|XP_004140005.1| PREDICTED: uncharacterized protein LOC101220276 isoform 2 [Cucumis sativus] gi|449444488|ref|XP_004140006.1| PREDICTED: uncharacterized protein LOC101220276 isoform 3 [Cucumis sativus] gi|449475624|ref|XP_004154504.1| PREDICTED: uncharacterized protein LOC101230995 isoform 2 [Cucumis sativus] gi|449475628|ref|XP_004154505.1| PREDICTED: uncharacterized protein LOC101230995 isoform 3 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Score = 221 bits (562), Expect = 1e-55, Method: Compositional matrix adjust.
Identities = 106/117 (90%), Positives = 111/117 (94%)
Query: 28 PHALTLLSFQDVGLWLEEINLGGYRQIFKENGVNGEYLEGMSMFTTEQILRFIRRCHMKW 87
P + + +DVGLWLEEINLGGYRQIFKENGVNGEYLEGMSMFTTEQILRFIRRCHMKW
Sbjct: 9 PLDFFIWTVEDVGLWLEEINLGGYRQIFKENGVNGEYLEGMSMFTTEQILRFIRRCHMKW 68
Query: 88 GDFITLCKELRRIKVACLKGEQKVRRPWWAPSCLSVVFVKVAKRNRQSRVVSLKLEP 144
GDFITLCKELRRIKVACLKGEQKVRRPWWAPSCLS+VF+KVAKRNRQSRVVSLKLEP
Sbjct: 69 GDFITLCKELRRIKVACLKGEQKVRRPWWAPSCLSMVFLKVAKRNRQSRVVSLKLEP 125
|
Source: Cucumis sativus Species: Cucumis sativus Genus: Cucumis Family: Cucurbitaceae Order: Cucurbitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|194239472|dbj|BAG55245.1| downward leaf curling protein [Cucumis melo] | Back alignment and taxonomy information |
|---|
| >gi|225447590|ref|XP_002272109.1| PREDICTED: uncharacterized protein LOC100244267 isoform 1 [Vitis vinifera] gi|296085001|emb|CBI28416.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224131826|ref|XP_002321188.1| predicted protein [Populus trichocarpa] gi|222861961|gb|EEE99503.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|351724953|ref|NP_001235284.1| uncharacterized protein LOC100499990 [Glycine max] gi|357495313|ref|XP_003617945.1| Downward leaf curling protein [Medicago truncatula] gi|255628361|gb|ACU14525.1| unknown [Glycine max] gi|355519280|gb|AET00904.1| Downward leaf curling protein [Medicago truncatula] gi|388507138|gb|AFK41635.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|218186951|gb|EEC69378.1| hypothetical protein OsI_38513 [Oryza sativa Indica Group] | Back alignment and taxonomy information |
|---|
| >gi|115488792|ref|NP_001066883.1| Os12g0514600 [Oryza sativa Japonica Group] gi|108862741|gb|ABG22031.1| expressed protein [Oryza sativa Japonica Group] gi|113649390|dbj|BAF29902.1| Os12g0514600 [Oryza sativa Japonica Group] gi|215707153|dbj|BAG93613.1| unnamed protein product [Oryza sativa Japonica Group] | Back alignment and taxonomy information |
|---|
| >gi|351725355|ref|NP_001238625.1| uncharacterized protein LOC100527863 [Glycine max] gi|255633398|gb|ACU17056.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|217075492|gb|ACJ86106.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|226510052|ref|NP_001143520.1| uncharacterized protein LOC100276203 [Zea mays] gi|195621834|gb|ACG32747.1| hypothetical protein [Zea mays] gi|414878235|tpg|DAA55366.1| TPA: hypothetical protein ZEAMMB73_523630 [Zea mays] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 144 | ||||||
| TAIR|locus:2077347 | 125 | AT3G07760 "AT3G07760" [Arabido | 0.743 | 0.856 | 0.925 | 1.1e-50 |
| TAIR|locus:2077347 AT3G07760 "AT3G07760" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 527 (190.6 bits), Expect = 1.1e-50, P = 1.1e-50
Identities = 99/107 (92%), Positives = 102/107 (95%)
Query: 37 QDVGLWLEEINLGGYRQIFKENGVNGEYLEGMSMFTTEQILRFIRRCHMKWGDFITLCKE 96
+DVG WLEEINLGGYRQIFKENGVNGEYLE MS+FTTEQIL FIRR HMKWGDFITLCKE
Sbjct: 18 EDVGSWLEEINLGGYRQIFKENGVNGEYLESMSVFTTEQILHFIRRHHMKWGDFITLCKE 77
Query: 97 LRRIKVACLKGEQKVRRPWWAPSCLSVVFVKVAKRNRQSRVVSLKLE 143
LRRIKVACLKGEQ+VRRPWWAPSCLSVVFVK AKRNRQSRVVSLKLE
Sbjct: 78 LRRIKVACLKGEQRVRRPWWAPSCLSVVFVKAAKRNRQSRVVSLKLE 124
Parameters:
V=100
filter=SEG
E=0.001
ctxfactor=1.00
Query ----- As Used ----- ----- Computed ----
Frame MatID Matrix name Lambda K H Lambda K H
+0 0 BLOSUM62 0.327 0.140 0.451 same same same
Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a
Query
Frame MatID Length Eff.Length E S W T X E2 S2
+0 0 144 144 0.00091 102 3 11 22 0.37 31
30 0.48 33
Statistics:
Database: /share/blast/go-seqdb.fasta
Title: go_20130330-seqdb.fasta
Posted: 5:47:42 AM PDT Apr 1, 2013
Created: 5:47:42 AM PDT Apr 1, 2013
Format: XDF-1
# of letters in database: 169,044,731
# of sequences in database: 368,745
# of database sequences satisfying E: 1
No. of states in DFA: 593 (63 KB)
Total size of DFA: 150 KB (2090 KB)
Time to generate neighborhood: 0.00u 0.00s 0.00t Elapsed: 00:00:00
No. of threads or processors used: 24
Search cpu time: 12.61u 0.10s 12.71t Elapsed: 00:00:01
Total cpu time: 12.61u 0.10s 12.71t Elapsed: 00:00:01
Start: Sat May 11 00:01:15 2013 End: Sat May 11 00:01:16 2013
|
|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 144 | |||
| cd09506 | 66 | cd09506, SAM_Shank1,2,3, SAM domain of Shank1,2,3 | 4e-05 | |
| cd09534 | 62 | cd09534, SAM_Ste11_fungal, SAM domain of Ste11_fun | 4e-04 | |
| cd09546 | 66 | cd09546, SAM_EPH-A5, SAM domain of EPH-A5 subfamil | 7e-04 | |
| smart00454 | 68 | smart00454, SAM, Sterile alpha motif | 0.002 | |
| cd09487 | 56 | cd09487, SAM_superfamily, SAM (Sterile alpha motif | 0.003 | |
| cd09505 | 72 | cd09505, SAM_WDSUB1, SAM domain of WDSUB1 proteins | 0.003 | |
| pfam07647 | 66 | pfam07647, SAM_2, SAM domain (Sterile alpha motif) | 0.004 | |
| cd09507 | 65 | cd09507, SAM_DGK-delta-eta, SAM domain of diacylgl | 0.004 |
| >gnl|CDD|188905 cd09506, SAM_Shank1,2,3, SAM domain of Shank1,2,3 family proteins | Back alignment and domain information |
|---|
Score = 38.8 bits (91), Expect = 4e-05
Identities = 14/31 (45%), Positives = 22/31 (70%)
Query: 35 SFQDVGLWLEEINLGGYRQIFKENGVNGEYL 65
+ DVG WLE +NLG +R+ F +N ++G +L
Sbjct: 6 TVDDVGDWLESLNLGEHRERFMDNEIDGSHL 36
|
SAM (sterile alpha motif) domain of Shank1,2,3 family proteins is a protein-protein interaction domain. Shank1,2,3 proteins are scaffold proteins that are known to interact with a variety of cytoplasmic and membrane proteins. SAM domains of the Shank1,2,3 family are prone to homooligomerization. They are highly enriched in the postsynaptic density, acting as scaffolds to organize assembly of postsynaptic proteins. SAM domains of Shank3 proteins can form large sheets of helical fibers. Shank genes show distinct patterns of expression, in rat Shank1 mRNA is found almost exclusively in brain, Shank2 in brain, kidney and liver, and Shank3 in heart, brain and spleen. Length = 66 |
| >gnl|CDD|188933 cd09534, SAM_Ste11_fungal, SAM domain of Ste11_fungal subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|188945 cd09546, SAM_EPH-A5, SAM domain of EPH-A5 subfamily of tyrosine kinase receptors | Back alignment and domain information |
|---|
| >gnl|CDD|197735 smart00454, SAM, Sterile alpha motif | Back alignment and domain information |
|---|
| >gnl|CDD|188886 cd09487, SAM_superfamily, SAM (Sterile alpha motif ) | Back alignment and domain information |
|---|
| >gnl|CDD|188904 cd09505, SAM_WDSUB1, SAM domain of WDSUB1 proteins | Back alignment and domain information |
|---|
| >gnl|CDD|203706 pfam07647, SAM_2, SAM domain (Sterile alpha motif) | Back alignment and domain information |
|---|
| >gnl|CDD|188906 cd09507, SAM_DGK-delta-eta, SAM domain of diacylglycerol kinase delta and eta subunits | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 144 | |||
| PF00536 | 64 | SAM_1: SAM domain (Sterile alpha motif); InterPro: | 99.58 | |
| PF07647 | 66 | SAM_2: SAM domain (Sterile alpha motif); InterPro: | 99.53 | |
| smart00454 | 68 | SAM Sterile alpha motif. Widespread domain in sign | 99.49 | |
| cd00166 | 63 | SAM Sterile alpha motif.; Widespread domain in sig | 99.48 | |
| KOG4375 | 272 | consensus Scaffold protein Shank and related SAM d | 98.39 | |
| KOG3678 | 832 | consensus SARM protein (with sterile alpha and arm | 98.33 | |
| KOG1170 | 1099 | consensus Diacylglycerol kinase [Lipid transport a | 97.97 | |
| PF02198 | 84 | SAM_PNT: Sterile alpha motif (SAM)/Pointed domain; | 97.42 | |
| KOG1899 | 861 | consensus LAR transmembrane tyrosine phosphatase-i | 97.04 | |
| KOG1899 | 861 | consensus LAR transmembrane tyrosine phosphatase-i | 97.02 | |
| KOG4403 | 575 | consensus Cell surface glycoprotein STIM, contains | 96.88 | |
| cd08757 | 68 | SAM_PNT_ESE Sterile alpha motif (SAM)/Pointed doma | 96.85 | |
| smart00251 | 82 | SAM_PNT SAM / Pointed domain. A subfamily of the S | 96.6 | |
| cd08532 | 76 | SAM_PNT-PDEF-like Sterile alpha motif (SAM)/Pointe | 96.54 | |
| PF09235 | 75 | Ste50p-SAM: Ste50p, sterile alpha motif; InterPro: | 96.36 | |
| cd08203 | 66 | SAM_PNT Sterile alpha motif (SAM)/Pointed domain. | 96.01 | |
| PF00400 | 39 | WD40: WD domain, G-beta repeat; InterPro: IPR01978 | 95.88 | |
| cd08534 | 89 | SAM_PNT-GABP-alpha Sterile alpha motif (SAM)/Point | 95.06 | |
| KOG4384 | 361 | consensus Uncharacterized SAM domain protein [Gene | 94.92 | |
| cd08540 | 75 | SAM_PNT-ERG Sterile alpha motif (SAM)/Pointed doma | 94.87 | |
| cd08538 | 78 | SAM_PNT-ESE-2-like Sterile alpha motif (SAM)/Point | 94.33 | |
| KOG0196 | 996 | consensus Tyrosine kinase, EPH (ephrin) receptor f | 94.28 | |
| cd08533 | 71 | SAM_PNT-ETS-1,2 Sterile alpha motif (SAM)/Pointed | 94.18 | |
| cd08542 | 88 | SAM_PNT-ETS-1 Sterile alpha motif (SAM)/Pointed do | 93.93 | |
| KOG0285 | 460 | consensus Pleiotropic regulator 1 [RNA processing | 93.7 | |
| cd08536 | 66 | SAM_PNT-Mae Sterile alpha motif (SAM)/Pointed doma | 93.59 | |
| cd08541 | 91 | SAM_PNT-FLI-1 Sterile alpha motif (SAM)/Pointed do | 93.23 | |
| KOG0319 | 775 | consensus WD40-repeat-containing subunit of the 18 | 93.16 | |
| cd08543 | 89 | SAM_PNT-ETS-2 Sterile alpha motif (SAM)/Pointed do | 93.13 | |
| cd08535 | 68 | SAM_PNT-Tel_Yan Sterile alpha motif (SAM)/Pointed | 92.72 | |
| KOG1738 | 638 | consensus Membrane-associated guanylate kinase-int | 92.53 | |
| smart00320 | 40 | WD40 WD40 repeats. Note that these repeats are per | 92.19 | |
| KOG4374 | 216 | consensus RNA-binding protein Bicaudal-C [RNA proc | 91.76 | |
| cd08531 | 75 | SAM_PNT-ERG_FLI-1 Sterile alpha motif (SAM)/Pointe | 91.67 | |
| KOG0288 | 459 | consensus WD40 repeat protein TipD [General functi | 90.99 | |
| KOG0264 | 422 | consensus Nucleosome remodeling factor, subunit CA | 90.33 | |
| PF10281 | 38 | Ish1: Putative stress-responsive nuclear envelope | 89.15 | |
| KOG0293 | 519 | consensus WD40 repeat-containing protein [Function | 89.09 | |
| KOG0249 | 916 | consensus LAR-interacting protein and related prot | 88.16 | |
| KOG0319 | 775 | consensus WD40-repeat-containing subunit of the 18 | 87.3 | |
| KOG0269 | 839 | consensus WD40 repeat-containing protein [Function | 87.02 | |
| KOG0650 | 733 | consensus WD40 repeat nucleolar protein Bop1, invo | 86.29 | |
| KOG0271 | 480 | consensus Notchless-like WD40 repeat-containing pr | 84.5 | |
| KOG0283 | 712 | consensus WD40 repeat-containing protein [Function | 84.45 | |
| KOG1332 | 299 | consensus Vesicle coat complex COPII, subunit SEC1 | 84.41 | |
| PF12979 | 351 | DUF3863: Domain of Unknown Function with PDB struc | 83.88 | |
| KOG0315 | 311 | consensus G-protein beta subunit-like protein (con | 83.81 | |
| KOG0263 | 707 | consensus Transcription initiation factor TFIID, s | 83.62 | |
| KOG0272 | 459 | consensus U4/U6 small nuclear ribonucleoprotein Pr | 81.56 | |
| KOG1063 | 764 | consensus RNA polymerase II elongator complex, sub | 80.52 |
| >PF00536 SAM_1: SAM domain (Sterile alpha motif); InterPro: IPR021129 The sterile alpha motif (SAM) domain is a putative protein interaction module present in a wide variety of proteins [] involved in many biological processes | Back alignment and domain information |
|---|
Probab=99.58 E-value=4.5e-15 Score=95.38 Aligned_cols=64 Identities=27% Similarity=0.463 Sum_probs=56.1
Q ss_pred cCCChhHHHHHHHhcCcchHHHHhhHcCcChhhhccCcccchHHHHHHHhHhhhccchHHHHHHHHHHHH
Q 032278 32 TLLSFQDVGLWLEEINLGGYRQIFKENGVNGEYLEGMSMFTTEQILRFIRRCHMKWGDFITLCKELRRIK 101 (144)
Q Consensus 32 ~~WS~EDVa~WLeeiGL~qYre~Fk~NnIdG~eLi~Ltk~T~e~il~~i~r~~~k~gd~itl~~el~~~k 101 (144)
++|++++|++||+++||++|.+.|++|.|+|+.|.+|| ++-|.-++. .+.||+.++...|+++|
T Consensus 1 s~W~~~~V~~WL~~~~l~~y~~~F~~~~i~g~~L~~lt----~~dL~~lgi--~~~ghr~ki~~~i~~Lk 64 (64)
T PF00536_consen 1 SEWSVEDVSEWLKSLGLEQYAENFEKNYIDGEDLLSLT----EEDLEELGI--TKLGHRKKILRAIQKLK 64 (64)
T ss_dssp GGTSHHHHHHHHHHTTGGGGHHHHHHTTSSHHHHTTSC----HHHHHHTT---SSHHHHHHHHHHHHHHH
T ss_pred CCCCHHHHHHHHHHCCCHHHHHHHHcCCchHHHHHhcC----HHHHHHcCC--CCHHHHHHHHHHHHHhC
Confidence 47999999999999999999999999999999999994 343544665 77899999999999987
|
The SAM domain that spreads over around 70 residues is found in diverse eukaryotic organisms []. SAM domains have been shown to homo- and hetero-oligomerise, forming multiple self-association architectures and also binding to various non-SAM domain-containing proteins [], nevertheless with a low affinity constant []. SAM domains also appear to possess the ability to bind RNA []. Smaug, a protein that helps to establish a morphogen gradient in Drosophila embryos by repressing the translation of nanos (nos) mRNA, binds to the 3' untranslated region (UTR) of nos mRNA via two similar hairpin structures. The 3D crystal structure of the Smaug RNA-binding region shows a cluster of positively charged residues on the Smaug-SAM domain, which could be the RNA-binding surface. This electropositive potential is unique among all previously determined SAM-domain structures and is conserved among Smaug-SAM homologs. These results suggest that the SAM domain might have a primary role in RNA binding. Structural analyses show that the SAM domain is arranged in a small five-helix bundle with two large interfaces []. In the case of the SAM domain of EphB2, each of these interfaces is able to form dimers. The presence of these two distinct intermonomers binding surface suggest that SAM could form extended polymeric structures []. This entry represents type 1 SAM domains. ; PDB: 2KIV_A 3HIL_B 3KKA_A 3K1R_B 3SEN_B 3SEI_B 1V85_A 2KE7_A 2EAM_A 1WWV_A .... |
| >PF07647 SAM_2: SAM domain (Sterile alpha motif); InterPro: IPR011510 The sterile alpha motif (SAM) domain is a putative protein interaction module present in a wide variety of proteins [] involved in many biological processes | Back alignment and domain information |
|---|
| >smart00454 SAM Sterile alpha motif | Back alignment and domain information |
|---|
| >cd00166 SAM Sterile alpha motif | Back alignment and domain information |
|---|
| >KOG4375 consensus Scaffold protein Shank and related SAM domain proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3678 consensus SARM protein (with sterile alpha and armadillo motifs) [Extracellular structures] | Back alignment and domain information |
|---|
| >KOG1170 consensus Diacylglycerol kinase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PF02198 SAM_PNT: Sterile alpha motif (SAM)/Pointed domain; InterPro: IPR003118 Transcription factors are protein molecules that bind to specific DNA sequences in the genome, resulting in the induction or inhibition of gene transcription [] | Back alignment and domain information |
|---|
| >KOG1899 consensus LAR transmembrane tyrosine phosphatase-interacting protein liprin [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1899 consensus LAR transmembrane tyrosine phosphatase-interacting protein liprin [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4403 consensus Cell surface glycoprotein STIM, contains SAM domain [General function prediction only] | Back alignment and domain information |
|---|
| >cd08757 SAM_PNT_ESE Sterile alpha motif (SAM)/Pointed domain of ESE-like ETS transcriptional regulators | Back alignment and domain information |
|---|
| >smart00251 SAM_PNT SAM / Pointed domain | Back alignment and domain information |
|---|
| >cd08532 SAM_PNT-PDEF-like Sterile alpha motif (SAM)/Pointed domain of prostate-derived ETS factor | Back alignment and domain information |
|---|
| >PF09235 Ste50p-SAM: Ste50p, sterile alpha motif; InterPro: IPR015316 The fungal Ste50p SAM domain consists of five helices, which form a compact, globular fold | Back alignment and domain information |
|---|
| >cd08203 SAM_PNT Sterile alpha motif (SAM)/Pointed domain | Back alignment and domain information |
|---|
| >PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide | Back alignment and domain information |
|---|
| >cd08534 SAM_PNT-GABP-alpha Sterile alpha motif (SAM)/Pointed domain of GA-binding protein alpha chain | Back alignment and domain information |
|---|
| >KOG4384 consensus Uncharacterized SAM domain protein [General function prediction only] | Back alignment and domain information |
|---|
| >cd08540 SAM_PNT-ERG Sterile alpha motif (SAM)/Pointed domain of ERG transcription factor | Back alignment and domain information |
|---|
| >cd08538 SAM_PNT-ESE-2-like Sterile alpha motif (SAM)/Pointed domain of ESE-2 like ETS transcriptional regulators | Back alignment and domain information |
|---|
| >KOG0196 consensus Tyrosine kinase, EPH (ephrin) receptor family [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd08533 SAM_PNT-ETS-1,2 Sterile alpha motif (SAM)/Pointed domain of ETS-1,2 family | Back alignment and domain information |
|---|
| >cd08542 SAM_PNT-ETS-1 Sterile alpha motif (SAM)/Pointed domain of ETS-1 | Back alignment and domain information |
|---|
| >KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] | Back alignment and domain information |
|---|
| >cd08536 SAM_PNT-Mae Sterile alpha motif (SAM)/Pointed domain of Mae protein homolog | Back alignment and domain information |
|---|
| >cd08541 SAM_PNT-FLI-1 Sterile alpha motif (SAM)/Pointed domain of friend leukemia integration 1 transcription activator | Back alignment and domain information |
|---|
| >KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] | Back alignment and domain information |
|---|
| >cd08543 SAM_PNT-ETS-2 Sterile alpha motif (SAM)/Pointed domain of ETS-2 | Back alignment and domain information |
|---|
| >cd08535 SAM_PNT-Tel_Yan Sterile alpha motif (SAM)/Pointed domain of Tel/Yan protein | Back alignment and domain information |
|---|
| >KOG1738 consensus Membrane-associated guanylate kinase-interacting protein/connector enhancer of KSR-like [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >smart00320 WD40 WD40 repeats | Back alignment and domain information |
|---|
| >KOG4374 consensus RNA-binding protein Bicaudal-C [RNA processing and modification] | Back alignment and domain information |
|---|
| >cd08531 SAM_PNT-ERG_FLI-1 Sterile alpha motif (SAM)/Pointed domain of ERG (Ets related gene) and FLI-1 (Friend leukemia integration 1) transcription factors | Back alignment and domain information |
|---|
| >KOG0288 consensus WD40 repeat protein TipD [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PF10281 Ish1: Putative stress-responsive nuclear envelope protein; InterPro: IPR018803 This group of proteins, found primarily in fungi, consists of putative stress-responsive nuclear envelope protein Ish1 and homologues [] | Back alignment and domain information |
|---|
| >KOG0293 consensus WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0249 consensus LAR-interacting protein and related proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0269 consensus WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0283 consensus WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF12979 DUF3863: Domain of Unknown Function with PDB structure (DUF3863); InterPro: IPR024334 This entry represents a functionally uncharacterised domain found in bacterial sequences | Back alignment and domain information |
|---|
| >KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] | Back alignment and domain information |
|---|
| >KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 144 | |||
| 3sei_A | 149 | Caskin-1; SAM domain, protein-protein interaction, | 4e-06 | |
| 2gle_A | 74 | Neurabin-1; SAM domain, scaffold, protein protein | 5e-06 | |
| 2f3n_A | 76 | SH3 and multiple ankyrin repeat domains 3; postsyn | 7e-06 | |
| 3tad_C | 265 | Liprin-beta-1; protein binding; 2.90A {Mus musculu | 7e-06 | |
| 3bq7_A | 81 | Diacylglycerol kinase delta; SAM domain, polymeriz | 9e-06 | |
| 2eao_A | 99 | Ephrin type-B receptor 1; cell-free protein synthe | 1e-05 | |
| 2qkq_A | 83 | Ephrin type-B receptor 4; ATP-binding, glycoprotei | 1e-05 | |
| 2e8n_A | 88 | Ephrin type-A receptor 2; cell-free protein synthe | 2e-05 | |
| 1ucv_A | 81 | Ephrin type-A receptor 8; receptor oligomerization | 3e-05 | |
| 2kso_A | 82 | Ephrin type-A receptor 2; SAM domain, heterodimer, | 3e-05 | |
| 3hil_A | 82 | Ephrin type-A receptor 1; ATP-binding, kinase, nuc | 3e-05 | |
| 1b0x_A | 94 | Protein (EPHA4 receptor tyrosine kinase); protein | 4e-05 | |
| 1b4f_A | 82 | EPHB2; SAM domain, EPH receptor, signal transducti | 5e-05 | |
| 2kg5_A | 100 | ARF-GAP, RHO-GAP domain, ANK repeat and PH domain- | 5e-05 | |
| 3h8m_A | 90 | Ephrin type-A receptor 7; SAM domain, kinase,struc | 6e-05 | |
| 2eam_A | 80 | Putative 47 kDa protein; cell-free protein synthes | 7e-05 | |
| 3kka_C | 86 | Ephrin type-A receptor 2; ATP-binding, kinase, nuc | 8e-05 | |
| 2ke7_A | 103 | Ankyrin repeat and sterIle alpha motif domain- con | 3e-04 | |
| 2ean_A | 83 | Connector enhancer of kinase suppressor of RAS 2; | 3e-04 | |
| 2dl0_A | 97 | SAM and SH3 domain-containing protein 1; cell-free | 3e-04 | |
| 1wwv_A | 91 | Connector enhancer of kinase suppressor of RAS 1; | 4e-04 | |
| 2k4p_A | 86 | Phosphatidylinositol-3,4,5-trisphosphate 5- phosph | 6e-04 | |
| 2kiv_A | 148 | Ankyrin repeat and sterIle alpha motif domain- con | 6e-04 |
| >3sei_A Caskin-1; SAM domain, protein-protein interaction, signaling protein; 2.40A {Homo sapiens} PDB: 3sen_A Length = 149 | Back alignment and structure |
|---|
Score = 42.7 bits (100), Expect = 4e-06
Identities = 10/42 (23%), Positives = 14/42 (33%)
Query: 35 SFQDVGLWLEEINLGGYRQIFKENGVNGEYLEGMSMFTTEQI 76
S + V WL L Y F G + + M+ I
Sbjct: 9 SSEAVSQWLTAFQLQLYAPNFISAGYDLPTISRMTPEDLTAI 50
|
| >2gle_A Neurabin-1; SAM domain, scaffold, protein protein interaction, protein binding; NMR {Rattus norvegicus} Length = 74 | Back alignment and structure |
|---|
| >2f3n_A SH3 and multiple ankyrin repeat domains 3; postsynaptic density, SAM domain, shank, scaffolding protein, structural protein; 2.10A {Rattus norvegicus} SCOP: a.60.1.2 PDB: 2f44_A Length = 76 | Back alignment and structure |
|---|
| >3tad_C Liprin-beta-1; protein binding; 2.90A {Mus musculus} Length = 265 | Back alignment and structure |
|---|
| >3bq7_A Diacylglycerol kinase delta; SAM domain, polymerization domain, alternative splicing, cytoplasm, membrane, metal-binding, phorbol-ester binding; 2.90A {Homo sapiens} Length = 81 | Back alignment and structure |
|---|
| >2eao_A Ephrin type-B receptor 1; cell-free protein synthesis, protein regulation, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >2qkq_A Ephrin type-B receptor 4; ATP-binding, glycoprotein, kinase, membrane, nucleotide- binding, phosphorylation, repeat, signal, transferase; 2.10A {Homo sapiens} Length = 83 | Back alignment and structure |
|---|
| >2e8n_A Ephrin type-A receptor 2; cell-free protein synthesis, protein regulation, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >1ucv_A Ephrin type-A receptor 8; receptor oligomerization, developmental regulation, tyrosine kinase, riken structural genomics/proteomics initiative; NMR {Homo sapiens} SCOP: a.60.1.2 Length = 81 | Back alignment and structure |
|---|
| >2kso_A Ephrin type-A receptor 2; SAM domain, heterodimer, cell signaling, angiogenesis, apopt ATP-binding, cataract; NMR {Homo sapiens} Length = 82 | Back alignment and structure |
|---|
| >3hil_A Ephrin type-A receptor 1; ATP-binding, kinase, nucleotide-binding, transferase, tyrosine-protein kinase, signal, sterIle alpha motif; 2.00A {Homo sapiens} PDB: 3kka_A Length = 82 | Back alignment and structure |
|---|
| >1b0x_A Protein (EPHA4 receptor tyrosine kinase); protein interaction module, dimerization domain, transferase; 2.00A {Mus musculus} SCOP: a.60.1.2 Length = 94 | Back alignment and structure |
|---|
| >1b4f_A EPHB2; SAM domain, EPH receptor, signal transduction, oligomer; 1.95A {Homo sapiens} SCOP: a.60.1.2 PDB: 1f0m_A 1sgg_A Length = 82 | Back alignment and structure |
|---|
| >2kg5_A ARF-GAP, RHO-GAP domain, ANK repeat and PH domain-containing protein 3; SAM domain, helix bundle, cell membrane, cell projection, cytoplasm; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >3h8m_A Ephrin type-A receptor 7; SAM domain, kinase,structural genomics, structural genomics consortium, SGC, alternative splicing, ATP-binding; 2.10A {Homo sapiens} Length = 90 | Back alignment and structure |
|---|
| >2eam_A Putative 47 kDa protein; cell-free protein synthesis, protein regulation, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 | Back alignment and structure |
|---|
| >3kka_C Ephrin type-A receptor 2; ATP-binding, kinase, nucleotide-binding, transferase, tyrosine-protein kinase, signal, sterIle alpha motif; 2.40A {Homo sapiens} Length = 86 | Back alignment and structure |
|---|
| >2ke7_A Ankyrin repeat and sterIle alpha motif domain- containing protein 1B; SAM domain, alternative splicing, ANK repeat, cell junction, cell membrane; NMR {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >2ean_A Connector enhancer of kinase suppressor of RAS 2; cell-free protein synthesis, protein regulation, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 83 | Back alignment and structure |
|---|
| >2dl0_A SAM and SH3 domain-containing protein 1; cell-free protein synthesis, protein regulation, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 97 | Back alignment and structure |
|---|
| >1wwv_A Connector enhancer of kinase suppressor of RAS 1; structural genomics, protein regulation, transcription; NMR {Homo sapiens} SCOP: a.60.1.2 Length = 91 | Back alignment and structure |
|---|
| >2k4p_A Phosphatidylinositol-3,4,5-trisphosphate 5- phosphatase 2; helix bundle, signaling protein, actin-binding, alternative splicing, cell adhesion; NMR {Homo sapiens} PDB: 2kso_B Length = 86 | Back alignment and structure |
|---|
| >2kiv_A Ankyrin repeat and sterIle alpha motif domain- containing protein 1B; SAM domain, tandem, signaling protein, alternative splicing, ANK repeat; NMR {Homo sapiens} Length = 148 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 144 | |||
| 3bs7_A | 78 | Protein aveugle; sterIle alpha motif (SAM) domain, | 99.67 | |
| 2gle_A | 74 | Neurabin-1; SAM domain, scaffold, protein protein | 99.66 | |
| 3bq7_A | 81 | Diacylglycerol kinase delta; SAM domain, polymeriz | 99.63 | |
| 2f3n_A | 76 | SH3 and multiple ankyrin repeat domains 3; postsyn | 99.62 | |
| 3bs5_A | 106 | Protein aveugle; sterIle alpha motif, SAM domain, | 99.62 | |
| 1v85_A | 91 | Similar to ring finger protein 36; apoptosis, neur | 99.6 | |
| 2e8o_A | 103 | SAM domain and HD domain-containing protein 1; cel | 99.6 | |
| 3bs5_B | 80 | Connector enhancer of kinase suppressor of RAS 2; | 99.59 | |
| 2ean_A | 83 | Connector enhancer of kinase suppressor of RAS 2; | 99.58 | |
| 1pk1_B | 89 | Sex COMB on midleg CG9495-PA; hetero SAM domain, p | 99.56 | |
| 2d8c_A | 97 | Phosphatidylcholine:ceramide cholinephosphotransfe | 99.56 | |
| 1kw4_A | 89 | Polyhomeotic; SAM domain, polycomb group, polymer, | 99.55 | |
| 1wwv_A | 91 | Connector enhancer of kinase suppressor of RAS 1; | 99.36 | |
| 2ke7_A | 103 | Ankyrin repeat and sterIle alpha motif domain- con | 99.34 | |
| 2e8n_A | 88 | Ephrin type-A receptor 2; cell-free protein synthe | 99.29 | |
| 1ow5_A | 85 | Serine/threonine-protein kinase STE11; MAP kinase, | 99.22 | |
| 2l5y_A | 150 | Stromal interaction molecule 2; EF-hand, SAM domai | 99.2 | |
| 2kso_A | 82 | Ephrin type-A receptor 2; SAM domain, heterodimer, | 99.19 | |
| 3tad_C | 265 | Liprin-beta-1; protein binding; 2.90A {Mus musculu | 99.14 | |
| 2eam_A | 80 | Putative 47 kDa protein; cell-free protein synthes | 99.13 | |
| 2kg5_A | 100 | ARF-GAP, RHO-GAP domain, ANK repeat and PH domain- | 99.12 | |
| 2qkq_A | 83 | Ephrin type-B receptor 4; ATP-binding, glycoprotei | 99.1 | |
| 1ucv_A | 81 | Ephrin type-A receptor 8; receptor oligomerization | 99.09 | |
| 2k4p_A | 86 | Phosphatidylinositol-3,4,5-trisphosphate 5- phosph | 99.08 | |
| 1b4f_A | 82 | EPHB2; SAM domain, EPH receptor, signal transducti | 99.08 | |
| 2dl0_A | 97 | SAM and SH3 domain-containing protein 1; cell-free | 99.07 | |
| 2eao_A | 99 | Ephrin type-B receptor 1; cell-free protein synthe | 99.07 | |
| 3h8m_A | 90 | Ephrin type-A receptor 7; SAM domain, kinase,struc | 99.03 | |
| 1b0x_A | 94 | Protein (EPHA4 receptor tyrosine kinase); protein | 99.03 | |
| 2k60_A | 150 | Protein (stromal interaction molecule 1); EF-hand, | 99.01 | |
| 2kiv_A | 148 | Ankyrin repeat and sterIle alpha motif domain- con | 98.95 | |
| 3kka_C | 86 | Ephrin type-A receptor 2; ATP-binding, kinase, nuc | 98.95 | |
| 3hil_A | 82 | Ephrin type-A receptor 1; ATP-binding, kinase, nuc | 98.93 | |
| 1x40_A | 91 | ARAP2; ASAP-related protein2, GTPase activity, sig | 98.9 | |
| 2lmr_A | 101 | ODIN, ankyrin repeat and SAM domain-containing pro | 98.86 | |
| 2dkz_A | 84 | Hypothetical protein LOC64762; cell-free protein s | 98.86 | |
| 3sei_A | 149 | Caskin-1; SAM domain, protein-protein interaction, | 98.83 | |
| 3k1r_B | 74 | Usher syndrome type-1G protein; protein-protein co | 98.81 | |
| 3sei_A | 149 | Caskin-1; SAM domain, protein-protein interaction, | 98.77 | |
| 1v38_A | 78 | SAM-domain protein samsn-1; structural genomics, h | 98.75 | |
| 3tad_C | 265 | Liprin-beta-1; protein binding; 2.90A {Mus musculu | 98.68 | |
| 3tac_B | 334 | Liprin-alpha-2; transferase-protein binding comple | 98.62 | |
| 1uqv_A | 85 | STE50 protein; SAM, sterIle alpha motif, helical, | 98.5 | |
| 2kiv_A | 148 | Ankyrin repeat and sterIle alpha motif domain- con | 98.46 | |
| 2eap_A | 90 | Lymphocyte cytosolic protein 2; cell-free protein | 98.3 | |
| 3tac_B | 334 | Liprin-alpha-2; transferase-protein binding comple | 97.91 | |
| 2qar_B | 93 | Telsam domain; polymer, crystallization modules, s | 97.91 | |
| 1sv0_C | 82 | Modulator of the activity of ETS CG15085-PA; alpha | 97.7 | |
| 2d3d_A | 88 | VTS1 protein; RNA binding, SAM domain, SRE hairpin | 97.54 | |
| 1ji7_A | 89 | ETS-related protein TEL1; helical polymer, transcr | 97.54 | |
| 2y9t_A | 82 | Tumor protein 63; apoptosis, sterIle alpha motif, | 97.42 | |
| 2b6g_A | 119 | VTS1P; alpha-helix, pentaloop, hairpin, RNA bindin | 97.41 | |
| 2y9u_A | 69 | Tumor protein 63; apoptosis, sterIle alpha motif, | 97.41 | |
| 2es6_A | 101 | VTS1P; SAM domain, protein structure, gene regulat | 97.41 | |
| 1oxj_A | 173 | RNA-binding protein smaug; SAM domain, PHAT domain | 96.79 | |
| 1wwu_A | 99 | Hypothetical protein FLJ21935; structural genomics | 96.77 | |
| 2e8m_A | 99 | Epidermal growth factor receptor kinase substrate | 96.76 | |
| 1x66_A | 98 | Friend leukemia integration 1 transcription factor | 96.2 | |
| 1sxd_A | 91 | GA repeat binding protein, alpha; alpha helical, t | 96.13 | |
| 1sv0_A | 85 | ETS DNA-binding protein pokkuri; alpha-helix, 3(10 | 96.0 | |
| 4h5i_A | 365 | Guanine nucleotide-exchange factor SEC12; copii ve | 95.36 | |
| 4aow_A | 340 | Guanine nucleotide-binding protein subunit beta-2; | 95.0 | |
| 2dkx_A | 96 | SAM pointed domain-containing ETS transcription fa | 94.72 | |
| 2jv3_A | 110 | ETS1 proto-oncogene; ETS-1 pointed (PNT) domain, M | 94.55 | |
| 2h80_A | 81 | STAR-related lipid transfer protein 13; helical bu | 94.15 | |
| 2dky_A | 91 | RHO-GTPase-activating protein 7; cell-free protein | 94.08 | |
| 2ytu_A | 128 | Friend leukemia integration 1 transcription factor | 93.49 | |
| 1sxe_A | 97 | Transcriptional regulator ERG; alpha helical, sign | 93.12 | |
| 4gga_A | 420 | P55CDC, cell division cycle protein 20 homolog; ce | 93.03 | |
| 4gq1_A | 393 | NUP37; propeller, transport protein; 2.40A {Schizo | 92.92 | |
| 3ow8_A | 321 | WD repeat-containing protein 61; structural genomi | 91.87 | |
| 3bg1_A | 316 | Protein SEC13 homolog; NPC, transport, WD repeat, | 91.13 | |
| 2e8p_A | 92 | ELF3 protein; cell-free protein synthesis, protein | 90.98 | |
| 4ggc_A | 318 | P55CDC, cell division cycle protein 20 homolog; ce | 90.69 | |
| 2pm7_B | 297 | Protein transport protein SEC13, protein transport | 90.66 | |
| 2xzm_R | 343 | RACK1; ribosome, translation; 3.93A {Tetrahymena t | 90.55 | |
| 3zwl_B | 369 | Eukaryotic translation initiation factor 3 subuni; | 90.54 | |
| 2qb0_B | 241 | Telsam domain - lysozyme chimera; helical polymer, | 90.53 | |
| 2pm7_B | 297 | Protein transport protein SEC13, protein transport | 90.46 | |
| 3fm0_A | 345 | Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r | 89.31 | |
| 4e54_B | 435 | DNA damage-binding protein 2; beta barrel, double | 89.1 | |
| 3frx_A | 319 | Guanine nucleotide-binding protein subunit beta- l | 88.94 | |
| 3frx_A | 319 | Guanine nucleotide-binding protein subunit beta- l | 88.5 | |
| 4h5i_A | 365 | Guanine nucleotide-exchange factor SEC12; copii ve | 88.22 | |
| 2ynn_A | 304 | Coatomer subunit beta'; protein transport, peptide | 88.22 | |
| 3iz6_a | 380 | 40S ribosomal protein RACK1 (RACK1); eukaryotic ri | 88.0 | |
| 3bg1_A | 316 | Protein SEC13 homolog; NPC, transport, WD repeat, | 87.87 | |
| 2hes_X | 330 | YDR267CP; beta-propeller, WD40 repeat, biosyntheti | 87.81 | |
| 3f3f_A | 351 | Nucleoporin SEH1; structural protein, protein comp | 87.54 | |
| 4e54_B | 435 | DNA damage-binding protein 2; beta barrel, double | 87.46 | |
| 2xzm_R | 343 | RACK1; ribosome, translation; 3.93A {Tetrahymena t | 87.46 | |
| 2j04_B | 524 | YDR362CP, TAU91; beta propeller, type 2 promoters, | 87.34 | |
| 4g56_B | 357 | MGC81050 protein; protein arginine methyltransfera | 87.19 | |
| 2ynn_A | 304 | Coatomer subunit beta'; protein transport, peptide | 87.14 | |
| 2w18_A | 356 | PALB2, fancn, partner and localizer of BRCA2; fanc | 87.14 | |
| 3gre_A | 437 | Serine/threonine-protein kinase VPS15; seven-blade | 86.98 | |
| 4gqb_B | 344 | Methylosome protein 50; TIM barrel, beta-propeller | 86.86 | |
| 3f3f_A | 351 | Nucleoporin SEH1; structural protein, protein comp | 86.78 | |
| 2pbi_B | 354 | Guanine nucleotide-binding protein subunit beta 5; | 85.66 | |
| 2hes_X | 330 | YDR267CP; beta-propeller, WD40 repeat, biosyntheti | 85.53 | |
| 3iz6_a | 380 | 40S ribosomal protein RACK1 (RACK1); eukaryotic ri | 85.52 | |
| 3vu4_A | 355 | KMHSV2; beta-propeller fold, protein transport; 2. | 85.48 | |
| 3fm0_A | 345 | Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r | 85.23 | |
| 1got_B | 340 | GT-beta; complex (GTP-binding/transducer), G prote | 85.0 | |
| 3vu4_A | 355 | KMHSV2; beta-propeller fold, protein transport; 2. | 84.87 | |
| 4a11_B | 408 | DNA excision repair protein ERCC-8; DNA binding pr | 84.65 | |
| 4aow_A | 340 | Guanine nucleotide-binding protein subunit beta-2; | 84.45 | |
| 3lrv_A | 343 | PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu | 84.4 | |
| 4gqb_B | 344 | Methylosome protein 50; TIM barrel, beta-propeller | 84.36 | |
| 1nr0_A | 611 | Actin interacting protein 1; beta propeller, WD40 | 83.95 | |
| 3dm0_A | 694 | Maltose-binding periplasmic protein fused with RAC | 83.71 | |
| 4gq1_A | 393 | NUP37; propeller, transport protein; 2.40A {Schizo | 83.62 | |
| 3ow8_A | 321 | WD repeat-containing protein 61; structural genomi | 83.31 | |
| 4gga_A | 420 | P55CDC, cell division cycle protein 20 homolog; ce | 83.06 | |
| 3mmy_A | 368 | MRNA export factor; mRNA export, nuclear protein; | 82.68 | |
| 3odt_A | 313 | Protein DOA1; ubiquitin, nuclear protein; HET: MSE | 82.32 | |
| 3idw_A | 72 | Actin cytoskeleton-regulatory complex protein SLA; | 82.1 | |
| 2aq5_A | 402 | Coronin-1A; WD40 repeat, 7-bladed beta-propeller, | 81.85 | |
| 2pbi_B | 354 | Guanine nucleotide-binding protein subunit beta 5; | 81.7 | |
| 1got_B | 340 | GT-beta; complex (GTP-binding/transducer), G prote | 81.61 | |
| 1nr0_A | 611 | Actin interacting protein 1; beta propeller, WD40 | 81.54 | |
| 1vyh_C | 410 | Platelet-activating factor acetylhydrolase IB alph | 81.5 | |
| 3lrv_A | 343 | PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu | 81.39 | |
| 1vyh_C | 410 | Platelet-activating factor acetylhydrolase IB alph | 81.3 | |
| 3dw8_B | 447 | Serine/threonine-protein phosphatase 2A 55 kDa RE | 81.3 | |
| 4ery_A | 312 | WD repeat-containing protein 5; WD40, WIN motif, b | 81.23 | |
| 3mmy_A | 368 | MRNA export factor; mRNA export, nuclear protein; | 81.11 | |
| 3dwl_C | 377 | Actin-related protein 2/3 complex subunit 1; prope | 80.72 | |
| 3jrp_A | 379 | Fusion protein of protein transport protein SEC13 | 80.57 | |
| 1erj_A | 393 | Transcriptional repressor TUP1; beta-propeller, tr | 80.52 | |
| 2oaj_A | 902 | Protein SNI1; WD40 repeat, beta propeller, endocyt | 80.43 | |
| 2w18_A | 356 | PALB2, fancn, partner and localizer of BRCA2; fanc | 80.16 |
| >3bs7_A Protein aveugle; sterIle alpha motif (SAM) domain, cytoplasm, membrane, sensory transduction, vision, signaling protein; 1.90A {Drosophila melanogaster} | Back alignment and structure |
|---|
Probab=99.67 E-value=7.4e-17 Score=107.53 Aligned_cols=69 Identities=19% Similarity=0.327 Sum_probs=61.1
Q ss_pred cccCCChhHHHHHHHhc--CcchHHHHhhHcCcChhhhccCcccchHHHHHHHhHhhhccchHHHHHHHHHHHHHHH
Q 032278 30 ALTLLSFQDVGLWLEEI--NLGGYRQIFKENGVNGEYLEGMSMFTTEQILRFIRRCHMKWGDFITLCKELRRIKVAC 104 (144)
Q Consensus 30 ~~~~WS~EDVa~WLeei--GL~qYre~Fk~NnIdG~eLi~Ltk~T~e~il~~i~r~~~k~gd~itl~~el~~~kv~~ 104 (144)
++..||+|||+.||+.+ ||++|.+.|++|+|||+.|+.|| ++-|+.++. .+.||+.++..+++.+|...
T Consensus 2 ~v~~Wt~~~V~~WL~~~~~gl~~y~~~F~~~~I~G~~Ll~L~----~~dL~~lGI--~~~g~r~~il~~I~~Lr~~~ 72 (78)
T 3bs7_A 2 AVYLWTVSDVLKWYRRHCGEYTQYEQLFAQHDITGRALLRIT----DSSLQRMGV--TDNRDREAIWREIVKQRLKT 72 (78)
T ss_dssp CGGGCCHHHHHHHHHHHSGGGGGGHHHHHHTTCCHHHHTTCC----HHHHHHHTC--CCHHHHHHHHHHHHHHHHHH
T ss_pred ChhhCCHHHHHHHHHHHhcCHHHHHHHHHHCCCCHHHHhhCC----HHHHhHcCC--CCHHHHHHHHHHHHHHHhHH
Confidence 57899999999999996 99999999999999999999994 445666666 78999999999999998654
|
| >2gle_A Neurabin-1; SAM domain, scaffold, protein protein interaction, protein binding; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >3bq7_A Diacylglycerol kinase delta; SAM domain, polymerization domain, alternative splicing, cytoplasm, membrane, metal-binding, phorbol-ester binding; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2f3n_A SH3 and multiple ankyrin repeat domains 3; postsynaptic density, SAM domain, shank, scaffolding protein, structural protein; 2.10A {Rattus norvegicus} SCOP: a.60.1.2 PDB: 2f44_A | Back alignment and structure |
|---|
| >3bs5_A Protein aveugle; sterIle alpha motif, SAM domain, SAM domain dimer, SAM domain complex, cytoplasm, membrane; 2.00A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1v85_A Similar to ring finger protein 36; apoptosis, neuron, cell death, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2e8o_A SAM domain and HD domain-containing protein 1; cell-free protein synthesis, protein regulation, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3bs5_B Connector enhancer of kinase suppressor of RAS 2; sterIle alpha motif, SAM domain, SAM domain dimer, SAM domain complex, cytoplasm, membrane; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2ean_A Connector enhancer of kinase suppressor of RAS 2; cell-free protein synthesis, protein regulation, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1pk1_B Sex COMB on midleg CG9495-PA; hetero SAM domain, polymers, transcriptional repression, transcription repression; 1.80A {Drosophila melanogaster} SCOP: a.60.1.2 PDB: 1pk3_A | Back alignment and structure |
|---|
| >2d8c_A Phosphatidylcholine:ceramide cholinephosphotransferase 1; cell-free protein synthesis, protein regulation, lipid metabolism, structural genomics; NMR {Mus musculus} SCOP: a.60.1.2 | Back alignment and structure |
|---|
| >1kw4_A Polyhomeotic; SAM domain, polycomb group, polymer, DNA binding protein; 1.75A {Drosophila melanogaster} SCOP: a.60.1.2 PDB: 1pk1_A | Back alignment and structure |
|---|
| >1wwv_A Connector enhancer of kinase suppressor of RAS 1; structural genomics, protein regulation, transcription; NMR {Homo sapiens} SCOP: a.60.1.2 | Back alignment and structure |
|---|
| >2ke7_A Ankyrin repeat and sterIle alpha motif domain- containing protein 1B; SAM domain, alternative splicing, ANK repeat, cell junction, cell membrane; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2e8n_A Ephrin type-A receptor 2; cell-free protein synthesis, protein regulation, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ow5_A Serine/threonine-protein kinase STE11; MAP kinase, MAPKKK, SAM domain, pointed domain, SCM domain, STE50 regulator, transferase; NMR {Saccharomyces cerevisiae} SCOP: a.60.1.2 PDB: 1x9x_A | Back alignment and structure |
|---|
| >2l5y_A Stromal interaction molecule 2; EF-hand, SAM domain, store OPE calcium entry, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kso_A Ephrin type-A receptor 2; SAM domain, heterodimer, cell signaling, angiogenesis, apopt ATP-binding, cataract; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3tad_C Liprin-beta-1; protein binding; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >2eam_A Putative 47 kDa protein; cell-free protein synthesis, protein regulation, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kg5_A ARF-GAP, RHO-GAP domain, ANK repeat and PH domain-containing protein 3; SAM domain, helix bundle, cell membrane, cell projection, cytoplasm; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2qkq_A Ephrin type-B receptor 4; ATP-binding, glycoprotein, kinase, membrane, nucleotide- binding, phosphorylation, repeat, signal, transferase; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1ucv_A Ephrin type-A receptor 8; receptor oligomerization, developmental regulation, tyrosine kinase, riken structural genomics/proteomics initiative; NMR {Homo sapiens} SCOP: a.60.1.2 | Back alignment and structure |
|---|
| >2k4p_A Phosphatidylinositol-3,4,5-trisphosphate 5- phosphatase 2; helix bundle, signaling protein, actin-binding, alternative splicing, cell adhesion; NMR {Homo sapiens} PDB: 2kso_B | Back alignment and structure |
|---|
| >1b4f_A EPHB2; SAM domain, EPH receptor, signal transduction, oligomer; 1.95A {Homo sapiens} SCOP: a.60.1.2 PDB: 1f0m_A 1sgg_A | Back alignment and structure |
|---|
| >2dl0_A SAM and SH3 domain-containing protein 1; cell-free protein synthesis, protein regulation, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eao_A Ephrin type-B receptor 1; cell-free protein synthesis, protein regulation, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3h8m_A Ephrin type-A receptor 7; SAM domain, kinase,structural genomics, structural genomics consortium, SGC, alternative splicing, ATP-binding; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1b0x_A Protein (EPHA4 receptor tyrosine kinase); protein interaction module, dimerization domain, transferase; 2.00A {Mus musculus} SCOP: a.60.1.2 | Back alignment and structure |
|---|
| >2k60_A Protein (stromal interaction molecule 1); EF-hand, SAM domain, EF-SAM, STIM1, store operated calcium entry regulator, SOCE; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kiv_A Ankyrin repeat and sterIle alpha motif domain- containing protein 1B; SAM domain, tandem, signaling protein, alternative splicing, ANK repeat; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3kka_C Ephrin type-A receptor 2; ATP-binding, kinase, nucleotide-binding, transferase, tyrosine-protein kinase, signal, sterIle alpha motif; 2.40A {Homo sapiens} SCOP: a.60.1.0 | Back alignment and structure |
|---|
| >3hil_A Ephrin type-A receptor 1; ATP-binding, kinase, nucleotide-binding, transferase, tyrosine-protein kinase, signal, sterIle alpha motif; 2.00A {Homo sapiens} PDB: 3kka_A | Back alignment and structure |
|---|
| >1x40_A ARAP2; ASAP-related protein2, GTPase activity, signal transduction, SAM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.60.1.2 | Back alignment and structure |
|---|
| >2lmr_A ODIN, ankyrin repeat and SAM domain-containing protein; signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dkz_A Hypothetical protein LOC64762; cell-free protein synthesis, protein regulation, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3sei_A Caskin-1; SAM domain, protein-protein interaction, signaling protein; 2.40A {Homo sapiens} PDB: 3sen_A | Back alignment and structure |
|---|
| >3k1r_B Usher syndrome type-1G protein; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3sei_A Caskin-1; SAM domain, protein-protein interaction, signaling protein; 2.40A {Homo sapiens} PDB: 3sen_A | Back alignment and structure |
|---|
| >1v38_A SAM-domain protein samsn-1; structural genomics, hypothetical protein, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: a.60.1.2 | Back alignment and structure |
|---|
| >3tad_C Liprin-beta-1; protein binding; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >3tac_B Liprin-alpha-2; transferase-protein binding complex; 2.20A {Homo sapiens} PDB: 3tad_A | Back alignment and structure |
|---|
| >1uqv_A STE50 protein; SAM, sterIle alpha motif, helical, protein-protein interaction domain, growth arrest, signaling protein; NMR {Saccharomyces cerevisiae} SCOP: a.60.1.2 PDB: 1z1v_A | Back alignment and structure |
|---|
| >2kiv_A Ankyrin repeat and sterIle alpha motif domain- containing protein 1B; SAM domain, tandem, signaling protein, alternative splicing, ANK repeat; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eap_A Lymphocyte cytosolic protein 2; cell-free protein synthesis, protein regulation, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3tac_B Liprin-alpha-2; transferase-protein binding complex; 2.20A {Homo sapiens} PDB: 3tad_A | Back alignment and structure |
|---|
| >2qar_B Telsam domain; polymer, crystallization modules, sterIle alpha motif, hydro regulator; 2.40A {Escherichia coli} | Back alignment and structure |
|---|
| >1sv0_C Modulator of the activity of ETS CG15085-PA; alpha-helix, 3(10) helix, transcription; 2.07A {Drosophila melanogaster} SCOP: a.60.1.1 | Back alignment and structure |
|---|
| >2d3d_A VTS1 protein; RNA binding, SAM domain, SRE hairpin binding, RNA binding protein; 1.60A {Saccharomyces cerevisiae} PDB: 2f8k_A 2fe9_A | Back alignment and structure |
|---|
| >1ji7_A ETS-related protein TEL1; helical polymer, transcription; 1.45A {Homo sapiens} SCOP: a.60.1.1 PDB: 2qar_A 2qb0_A 1lky_A 1lky_B 2qb1_A | Back alignment and structure |
|---|
| >2y9t_A Tumor protein 63; apoptosis, sterIle alpha motif, 5-helix bundle; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2b6g_A VTS1P; alpha-helix, pentaloop, hairpin, RNA binding protein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2y9u_A Tumor protein 63; apoptosis, sterIle alpha motif, 5-helix bundle, mutations, A syndrome; 1.60A {Homo sapiens} PDB: 1rg6_A | Back alignment and structure |
|---|
| >2es6_A VTS1P; SAM domain, protein structure, gene regulation; NMR {Saccharomyces cerevisiae} PDB: 2ese_A | Back alignment and structure |
|---|
| >1oxj_A RNA-binding protein smaug; SAM domain, PHAT domain; 1.80A {Drosophila melanogaster} SCOP: a.60.1.2 a.118.1.13 | Back alignment and structure |
|---|
| >1wwu_A Hypothetical protein FLJ21935; structural genomics, protein regulation, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2e8m_A Epidermal growth factor receptor kinase substrate 8; cell-free protein synthesis, protein regulation, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x66_A Friend leukemia integration 1 transcription factor; cell-free protein synthesis, protein regulation, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1sxd_A GA repeat binding protein, alpha; alpha helical, transcription, signaling protein; NMR {Mus musculus} SCOP: a.60.1.1 | Back alignment and structure |
|---|
| >1sv0_A ETS DNA-binding protein pokkuri; alpha-helix, 3(10) helix, transcription; 2.07A {Drosophila melanogaster} SCOP: a.60.1.1 PDB: 1sv4_A | Back alignment and structure |
|---|
| >4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A | Back alignment and structure |
|---|
| >4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a | Back alignment and structure |
|---|
| >2dkx_A SAM pointed domain-containing ETS transcription factor; cell-free protein synthesis, protein regulation, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jv3_A ETS1 proto-oncogene; ETS-1 pointed (PNT) domain, MAP kinase phosphorylation site, alpha-helical bundle, transcription factor, DNA-binding, nucleus; NMR {Mus musculus} PDB: 2kmd_A* | Back alignment and structure |
|---|
| >2h80_A STAR-related lipid transfer protein 13; helical bundle, lipid binding protein; NMR {Homo sapiens} SCOP: a.60.1.3 PDB: 2jw2_A | Back alignment and structure |
|---|
| >2dky_A RHO-GTPase-activating protein 7; cell-free protein synthesis, protein regulation, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.60.1.3 PDB: 2gyt_A 2kap_A | Back alignment and structure |
|---|
| >2ytu_A Friend leukemia integration 1 transcription factor; cell-free protein synthesis, protein regulation, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1sxe_A Transcriptional regulator ERG; alpha helical, signaling protein; NMR {Homo sapiens} SCOP: a.60.1.1 | Back alignment and structure |
|---|
| >4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A | Back alignment and structure |
|---|
| >4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A | Back alignment and structure |
|---|
| >3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A | Back alignment and structure |
|---|
| >2e8p_A ELF3 protein; cell-free protein synthesis, protein regulation, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} | Back alignment and structure |
|---|
| >2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A | Back alignment and structure |
|---|
| >2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R | Back alignment and structure |
|---|
| >3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2qb0_B Telsam domain - lysozyme chimera; helical polymer, hydrolase regulator; 2.56A {Escherichia coli} | Back alignment and structure |
|---|
| >2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A | Back alignment and structure |
|---|
| >3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* | Back alignment and structure |
|---|
| >3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* | Back alignment and structure |
|---|
| >3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* | Back alignment and structure |
|---|
| >4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A | Back alignment and structure |
|---|
| >2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A | Back alignment and structure |
|---|
| >3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} | Back alignment and structure |
|---|
| >3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A | Back alignment and structure |
|---|
| >2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A | Back alignment and structure |
|---|
| >4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* | Back alignment and structure |
|---|
| >2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R | Back alignment and structure |
|---|
| >2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} | Back alignment and structure |
|---|
| >2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A | Back alignment and structure |
|---|
| >2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A | Back alignment and structure |
|---|
| >3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} | Back alignment and structure |
|---|
| >3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A | Back alignment and structure |
|---|
| >2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} | Back alignment and structure |
|---|
| >2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} | Back alignment and structure |
|---|
| >3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A | Back alignment and structure |
|---|
| >3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* | Back alignment and structure |
|---|
| >3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A | Back alignment and structure |
|---|
| >4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} | Back alignment and structure |
|---|
| >4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a | Back alignment and structure |
|---|
| >3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} | Back alignment and structure |
|---|
| >1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A | Back alignment and structure |
|---|
| >3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} | Back alignment and structure |
|---|
| >4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A | Back alignment and structure |
|---|
| >3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A | Back alignment and structure |
|---|
| >3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3idw_A Actin cytoskeleton-regulatory complex protein SLA; clathrin adaptor, endocytosis, SAM domain, yeast, actin-BIND membrane, endosome; 1.85A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A | Back alignment and structure |
|---|
| >2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} | Back alignment and structure |
|---|
| >1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* | Back alignment and structure |
|---|
| >1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A | Back alignment and structure |
|---|
| >1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 | Back alignment and structure |
|---|
| >3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 | Back alignment and structure |
|---|
| >3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} | Back alignment and structure |
|---|
| >4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... | Back alignment and structure |
|---|
| >3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 | Back alignment and structure |
|---|
| >2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 144 | ||||
| d2f3na1 | 64 | a.60.1.2 (A:2-65) Sh3 and multiple ankyrin repeat | 2e-04 | |
| d1v38a_ | 78 | a.60.1.2 (A:) Sam-domain protein samsn-1 {Mouse (M | 3e-04 | |
| d1kw4a_ | 70 | a.60.1.2 (A:) Polyhomeotic {Drosophila melanogaste | 3e-04 | |
| d1b0xa_ | 72 | a.60.1.2 (A:) EphA4 receptor tyrosine kinases {Mou | 4e-04 | |
| d1b4fa_ | 74 | a.60.1.2 (A:) EphB2 receptor {Human (Homo sapiens) | 0.001 | |
| d1ucva_ | 81 | a.60.1.2 (A:) Ephrin type-A receptor 8, C-terminal | 0.002 | |
| d1x40a1 | 78 | a.60.1.2 (A:8-85) Centaurin-delta 1 (Arap2) {Human | 0.004 |
| >d2f3na1 a.60.1.2 (A:2-65) Sh3 and multiple ankyrin repeat domains 3 (Shank3) {Rat(Rattus norvegicus) [TaxId: 10116]} Length = 64 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: SAM domain-like superfamily: SAM/Pointed domain family: SAM (sterile alpha motif) domain domain: Sh3 and multiple ankyrin repeat domains 3 (Shank3) species: Rat(Rattus norvegicus) [TaxId: 10116]
Score = 35.6 bits (82), Expect = 2e-04
Identities = 17/64 (26%), Positives = 32/64 (50%), Gaps = 6/64 (9%)
Query: 37 QDVGLWLEEINLGGYRQIFKENGVNGEYLEGMSMFTTEQILRFIRRCHMKWGDFITLCKE 96
DVG WLE I+LG +R F+++ + G +L T++ + + G + +
Sbjct: 7 FDVGDWLESIHLGEHRDRFEDHEIEGAHL----PALTKEDFVEL--GVTRVGHRENIERA 60
Query: 97 LRRI 100
LR++
Sbjct: 61 LRQL 64
|
| >d1v38a_ a.60.1.2 (A:) Sam-domain protein samsn-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 | Back information, alignment and structure |
|---|
| >d1kw4a_ a.60.1.2 (A:) Polyhomeotic {Drosophila melanogaster [TaxId: 7227]} Length = 70 | Back information, alignment and structure |
|---|
| >d1b0xa_ a.60.1.2 (A:) EphA4 receptor tyrosine kinases {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 | Back information, alignment and structure |
|---|
| >d1b4fa_ a.60.1.2 (A:) EphB2 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 74 | Back information, alignment and structure |
|---|
| >d1ucva_ a.60.1.2 (A:) Ephrin type-A receptor 8, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 81 | Back information, alignment and structure |
|---|
| >d1x40a1 a.60.1.2 (A:8-85) Centaurin-delta 1 (Arap2) {Human(Homo sapiens) [TaxId: 9606]} Length = 78 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 144 | |||
| d1kw4a_ | 70 | Polyhomeotic {Drosophila melanogaster [TaxId: 7227 | 99.7 | |
| d1pk3a1 | 63 | Polycomb protein Scm {Fruit fly (Drosophila melano | 99.66 | |
| d2f3na1 | 64 | Sh3 and multiple ankyrin repeat domains 3 (Shank3) | 99.66 | |
| d1wwva1 | 78 | Connector enhancer of kinase suppressor of Ras 1, | 99.59 | |
| d2d8ca1 | 85 | Sphingomyelin synthase 1, SMS1 {Mouse (Mus musculu | 99.47 | |
| d1b4fa_ | 74 | EphB2 receptor {Human (Homo sapiens) [TaxId: 9606] | 99.4 | |
| d1ow5a_ | 60 | Serine/threonine-protein kinase ste11 {Baker's yea | 99.38 | |
| d1v38a_ | 78 | Sam-domain protein samsn-1 {Mouse (Mus musculus) [ | 99.35 | |
| d1b0xa_ | 72 | EphA4 receptor tyrosine kinases {Mouse (Mus muscul | 99.24 | |
| d1x40a1 | 78 | Centaurin-delta 1 (Arap2) {Human(Homo sapiens) [Ta | 99.2 | |
| d1ucva_ | 81 | Ephrin type-A receptor 8, C-terminal domain {Human | 99.19 | |
| d1oxja1 | 62 | RNA-binding protein Smaug {Drosophila melanogaster | 99.07 | |
| d1dxsa_ | 57 | C-terminal domain of p73 {Human (Homo sapiens) [Ta | 98.45 | |
| d1z1va1 | 70 | Ste50p, N-terminal domain {Baker's yeast (Saccharo | 96.8 | |
| d1sxda_ | 91 | GABP-alpha subunit {Mouse (Mus musculus) [TaxId: 1 | 96.46 | |
| d1sv0c_ | 82 | Modulator of the activity of Ets (MAE, CG15085-PA) | 95.75 | |
| d1sv0a_ | 77 | Ets DNA-binding protein pokkuri (Yan) {Fruit fly ( | 95.23 | |
| d1yfqa_ | 342 | Cell cycle arrest protein BUB3 {Baker's yeast (Sac | 95.21 | |
| d1p22a2 | 293 | F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom | 95.16 | |
| d2ovrb2 | 342 | F-box/WD repeat-containing protein 7, FBXW7 {Human | 94.93 | |
| d1vyhc1 | 317 | Platelet-activating factor acetylhydrolase IB subu | 94.81 | |
| d1nexb2 | 355 | Cdc4 propeller domain {Baker's yeast (Saccharomyce | 94.69 | |
| d1sxea_ | 97 | Transcriptional regulator ERG {Human (Homo sapiens | 94.68 | |
| d1yfqa_ | 342 | Cell cycle arrest protein BUB3 {Baker's yeast (Sac | 94.58 | |
| d1rg6a_ | 67 | C-terminal domain of p63 {Human (Homo sapiens) [Ta | 94.3 | |
| d2jv3a_ | 110 | Ets-1 transcription factor pointed domain {Mouse ( | 94.13 | |
| d1ji7a_ | 77 | Etv6 transcription factor pointed domain (Tel SAM) | 94.12 | |
| d1tbga_ | 340 | beta1-subunit of the signal-transducing G protein | 93.82 | |
| d1nr0a2 | 299 | Actin interacting protein 1 {Nematode (Caenorhabdi | 93.04 | |
| d1pgua2 | 287 | Actin interacting protein 1 {Baker's yeast (Saccha | 91.74 | |
| d1sq9a_ | 393 | Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac | 91.51 | |
| d1pgua2 | 287 | Actin interacting protein 1 {Baker's yeast (Saccha | 90.72 | |
| d1sq9a_ | 393 | Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac | 89.97 | |
| d1nr0a1 | 311 | Actin interacting protein 1 {Nematode (Caenorhabdi | 89.56 | |
| d2ovrb2 | 342 | F-box/WD repeat-containing protein 7, FBXW7 {Human | 89.51 | |
| d1erja_ | 388 | Tup1, C-terminal domain {Baker's yeast (Saccharomy | 89.24 | |
| d2h80a1 | 71 | Deleted in Liver Cancer 2, DLC2 {Human (Homo sapie | 89.12 | |
| d1nr0a2 | 299 | Actin interacting protein 1 {Nematode (Caenorhabdi | 89.02 | |
| d2dkya1 | 78 | Deleted in liver cancer 1 protein, DLC-1 {Human (H | 88.8 | |
| d1gxra_ | 337 | Groucho/tle1, C-terminal domain {Human (Homo sapie | 88.77 | |
| d1vyhc1 | 317 | Platelet-activating factor acetylhydrolase IB subu | 88.39 | |
| d1pgua1 | 325 | Actin interacting protein 1 {Baker's yeast (Saccha | 88.25 | |
| d1pgua1 | 325 | Actin interacting protein 1 {Baker's yeast (Saccha | 87.22 | |
| d1nr0a1 | 311 | Actin interacting protein 1 {Nematode (Caenorhabdi | 87.2 | |
| d1nexb2 | 355 | Cdc4 propeller domain {Baker's yeast (Saccharomyce | 86.46 | |
| d1p22a2 | 293 | F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom | 85.6 | |
| d1erja_ | 388 | Tup1, C-terminal domain {Baker's yeast (Saccharomy | 85.32 | |
| d1k8kc_ | 371 | Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur | 84.04 | |
| d1tbga_ | 340 | beta1-subunit of the signal-transducing G protein | 82.61 | |
| d1gxra_ | 337 | Groucho/tle1, C-terminal domain {Human (Homo sapie | 80.47 |
| >d1kw4a_ a.60.1.2 (A:) Polyhomeotic {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: SAM domain-like superfamily: SAM/Pointed domain family: SAM (sterile alpha motif) domain domain: Polyhomeotic species: Drosophila melanogaster [TaxId: 7227]
Probab=99.70 E-value=5.2e-18 Score=109.91 Aligned_cols=67 Identities=22% Similarity=0.342 Sum_probs=58.3
Q ss_pred ccccCCChhHHHHHHHhc-CcchHHHHhhHcCcChhhhccCcccchHHHHHHHhHhhhccchHHHHHHHHHHHH
Q 032278 29 HALTLLSFQDVGLWLEEI-NLGGYRQIFKENGVNGEYLEGMSMFTTEQILRFIRRCHMKWGDFITLCKELRRIK 101 (144)
Q Consensus 29 l~~~~WS~EDVa~WLeei-GL~qYre~Fk~NnIdG~eLi~Ltk~T~e~il~~i~r~~~k~gd~itl~~el~~~k 101 (144)
.++..||+|||+.||+++ |+++|.+.|++|+|||..|+.|| ++-|+-+. .++.||+++++++++.+|
T Consensus 3 ~pv~~Ws~~dV~~wL~~~~~~~~y~~~F~~~~IdG~~Ll~Lt----~~~L~~~~--~~~~g~r~~i~~~I~~Lk 70 (70)
T d1kw4a_ 3 PPISSWSVDDVSNFIRELPGCQDYVDDFIQQEIDGQALLRLK----EKHLVNAM--GMKLGPALKIVAKVESIK 70 (70)
T ss_dssp CCGGGCCHHHHHHHHHTSTTCGGGHHHHHHTTCCHHHHHHCC----HHHHHTTT--CCCHHHHHHHHHHHHHHC
T ss_pred CchhcCCHHHHHHHHHhCCCcHHHHHHHHHcCccHHHHHHcc----HHHHHHHc--CCchHHHHHHHHHHHHhC
Confidence 457899999999999999 79999999999999999999994 44444333 489999999999999886
|
| >d1pk3a1 a.60.1.2 (A:17-79) Polycomb protein Scm {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2f3na1 a.60.1.2 (A:2-65) Sh3 and multiple ankyrin repeat domains 3 (Shank3) {Rat(Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1wwva1 a.60.1.2 (A:8-85) Connector enhancer of kinase suppressor of Ras 1, CNK1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d8ca1 a.60.1.2 (A:7-91) Sphingomyelin synthase 1, SMS1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1b4fa_ a.60.1.2 (A:) EphB2 receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ow5a_ a.60.1.2 (A:) Serine/threonine-protein kinase ste11 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1v38a_ a.60.1.2 (A:) Sam-domain protein samsn-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1b0xa_ a.60.1.2 (A:) EphA4 receptor tyrosine kinases {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x40a1 a.60.1.2 (A:8-85) Centaurin-delta 1 (Arap2) {Human(Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ucva_ a.60.1.2 (A:) Ephrin type-A receptor 8, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oxja1 a.60.1.2 (A:594-655) RNA-binding protein Smaug {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1dxsa_ a.60.1.2 (A:) C-terminal domain of p73 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z1va1 a.60.1.2 (A:33-102) Ste50p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sxda_ a.60.1.1 (A:) GABP-alpha subunit {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1sv0c_ a.60.1.1 (C:) Modulator of the activity of Ets (MAE, CG15085-PA) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1sv0a_ a.60.1.1 (A:) Ets DNA-binding protein pokkuri (Yan) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sxea_ a.60.1.1 (A:) Transcriptional regulator ERG {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1rg6a_ a.60.1.2 (A:) C-terminal domain of p63 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ji7a_ a.60.1.1 (A:) Etv6 transcription factor pointed domain (Tel SAM) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2h80a1 a.60.1.3 (A:11-81) Deleted in Liver Cancer 2, DLC2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d2dkya1 a.60.1.3 (A:8-85) Deleted in liver cancer 1 protein, DLC-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|