Citrus Sinensis ID: 032303

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140---
MAGVISSPTLGFFSVKKTSRDSRKLNNRNLPCHGIRAMRVEKPLEELYNVRVERQVSPERLKELDVSRWSMWKTGKCKLPWDWQVDQLVYIEEGEVRVVPEGSQRYMRFLAGDLIRYPKWFEADLFFNGPYQERYSFRAYGDD
ccccccccccccccccccccccccccccccccccccEEEEccccccEEcEEEEEcccHHHHHcccccccccccccccEEcEEEcccEEEEEEEEEEEEEEcccEEEEEEccccEEEEccccEEEEEEcccEEEEEEEEEcccc
cccHccccccccccccccccccccccccccHHHEEEEEEccccHHHHcccEEEccccHHHHHHcccccccccccccccccccEcccEEEEEEEcEEEEEccccccEEEEEcccEEEcccccEEEEEEcccccEEEEEEEEccc
magvissptlgffsvkktsrdsrklnnrnlpchgiramrvekpLEELYNVrverqvsperlkeLDVSrwsmwktgkcklpwdwqvdqlvyieegevrvvpegsQRYMRFLAGDlirypkwfeadlffngpyqerysfraygdd
magvissptlgffsvkktsrdsrklnnrnlpchgiramrvekpleelynvrverqvsperlkeldvsrwsmwktgkcklpwdWQVDQLVYIEEgevrvvpegsqRYMRFLAGDLIRYPKWFEADLffngpyqerysfraygdd
MAGVISSPTLGFFSVKKTSRDSRKLNNRNLPCHGIRAMRVEKPLEELYNVRVERQVSPERLKELDVSRWSMWKTGKCKLPWDWQVDQLVYIEEGEVRVVPEGSQRYMRFLAGDLIRYPKWFEADLFFNGPYQERYSFRAYGDD
*****************************LPCHGIRAMRVEKPLEELYNVRVERQVSPERLKELDVSRWSMWKTGKCKLPWDWQVDQLVYIEEGEVRVVPEGSQRYMRFLAGDLIRYPKWFEADLFFNGPYQERYSFRA****
********TLGFFSV*********************************************L**LDVSRWSMWKTGKCKLPWDWQVDQLVYIEEGEVRVVPEGSQRYMRFLAGDLIRYPKWFEADLFFNGPYQERYSFRAYG**
MAGVISSPTLGFFSVKKTSRDSRKLNNRNLPCHGIRAMRVEKPLEELYNVRVERQVSPERLKELDVSRWSMWKTGKCKLPWDWQVDQLVYIEEGEVRVVPEGSQRYMRFLAGDLIRYPKWFEADLFFNGPYQERYSFRAYGDD
****************KTSRDSRKLNNRNLPCHGIRAMRVEKPLEELYNVRVERQVSPERLKELDVSRWSMWKTGKCKLPWDWQVDQLVYIEEGEVRVVPEGSQRYMRFLAGDLIRYPKWFEADLFFNGPYQERYSFRAYGD*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAGVISSPTLGFFSVKKTSRDSRKLNNRNLPCHGIRAMRVEKPLEELYNVRVERQVSPERLKELDVSRWSMWKTGKCKLPWDWQVDQLVYIEEGEVRVVPEGSQRYMRFLAGDLIRYPKWFEADLFFNGPYQERYSFRAYGDD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query143
255568685146 conserved hypothetical protein [Ricinus 0.993 0.972 0.746 3e-58
224129010141 predicted protein [Populus trichocarpa] 0.979 0.992 0.755 8e-58
449453533139 PREDICTED: uncharacterized protein LOC10 0.965 0.992 0.727 1e-56
225447105142 PREDICTED: uncharacterized protein LOC10 0.993 1.0 0.713 2e-53
357442051143 hypothetical protein MTR_1g086000 [Medic 0.993 0.993 0.692 1e-52
359807399144 uncharacterized protein LOC100776314 [Gl 1.0 0.993 0.685 3e-52
351722659144 uncharacterized protein LOC100526901 [Gl 1.0 0.993 0.685 4e-51
164564752144 CM0545.540.nc [Lotus japonicus] gi|38851 0.986 0.979 0.689 1e-50
21592432139 unknown [Arabidopsis thaliana] 0.853 0.877 0.739 3e-48
297823045139 PTAC18 [Arabidopsis lyrata subsp. lyrata 0.762 0.784 0.816 4e-48
>gi|255568685|ref|XP_002525314.1| conserved hypothetical protein [Ricinus communis] gi|223535373|gb|EEF37047.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
 Score =  229 bits (584), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 106/142 (74%), Positives = 121/142 (85%)

Query: 2   AGVISSPTLGFFSVKKTSRDSRKLNNRNLPCHGIRAMRVEKPLEELYNVRVERQVSPERL 61
            G+I++   G   + +++R   K  + N   HGI+AMRVEK LEELYNVRVER+V+PERL
Sbjct: 4   TGMITAQGYGLLPINRSNRTCCKFRSTNRQSHGIKAMRVEKSLEELYNVRVERKVTPERL 63

Query: 62  KELDVSRWSMWKTGKCKLPWDWQVDQLVYIEEGEVRVVPEGSQRYMRFLAGDLIRYPKWF 121
            +L VSRWSMWKTGKCKLPWDWQVDQLVYIEEGEVRVVPEGS+RYMRF+AGDL+RYPKWF
Sbjct: 64  ADLGVSRWSMWKTGKCKLPWDWQVDQLVYIEEGEVRVVPEGSERYMRFVAGDLVRYPKWF 123

Query: 122 EADLFFNGPYQERYSFRAYGDD 143
           EADLFFNGPYQERY FRAYGDD
Sbjct: 124 EADLFFNGPYQERYRFRAYGDD 145

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224129010|ref|XP_002320478.1| predicted protein [Populus trichocarpa] gi|222861251|gb|EEE98793.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449453533|ref|XP_004144511.1| PREDICTED: uncharacterized protein LOC101204548 [Cucumis sativus] gi|449493164|ref|XP_004159210.1| PREDICTED: uncharacterized LOC101204548 [Cucumis sativus] Back     alignment and taxonomy information
>gi|225447105|ref|XP_002271026.1| PREDICTED: uncharacterized protein LOC100249947 [Vitis vinifera] gi|297739196|emb|CBI28847.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|357442051|ref|XP_003591303.1| hypothetical protein MTR_1g086000 [Medicago truncatula] gi|355480351|gb|AES61554.1| hypothetical protein MTR_1g086000 [Medicago truncatula] gi|388521457|gb|AFK48790.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|359807399|ref|NP_001240874.1| uncharacterized protein LOC100776314 [Glycine max] gi|255645498|gb|ACU23244.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|351722659|ref|NP_001235716.1| uncharacterized protein LOC100526901 [Glycine max] gi|255631113|gb|ACU15922.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|164564752|dbj|BAF98232.1| CM0545.540.nc [Lotus japonicus] gi|388515381|gb|AFK45752.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|21592432|gb|AAM64383.1| unknown [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297823045|ref|XP_002879405.1| PTAC18 [Arabidopsis lyrata subsp. lyrata] gi|297325244|gb|EFH55664.1| PTAC18 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query143
TAIR|locus:2045532139 PTAC18 "AT2G32180" [Arabidopsi 0.846 0.870 0.745 1.8e-48
TAIR|locus:2046412139 AT2G32650 "AT2G32650" [Arabido 0.846 0.870 0.745 1.8e-48
UNIPROTKB|Q60B2591 MCA0659 "Putative uncharacteri 0.615 0.967 0.325 2e-10
TAIR|locus:2122734134 AT4G10300 "AT4G10300" [Arabido 0.818 0.873 0.275 5.2e-10
TAIR|locus:2122819120 AT4G10290 "AT4G10290" [Arabido 0.517 0.616 0.337 1.8e-09
TAIR|locus:2122809140 AT4G10280 "AT4G10280" [Arabido 0.517 0.528 0.298 3.3e-08
TAIR|locus:210309596 AT3G04300 "AT3G04300" [Arabido 0.580 0.864 0.314 5.3e-08
TAIR|locus:100623000252 AT2G27402 "AT2G27402" [Arabido 0.272 0.75 0.525 2.4e-05
TAIR|locus:505006531107 AT4G28703 "AT4G28703" [Arabido 0.475 0.635 0.285 0.00093
TAIR|locus:2045532 PTAC18 "AT2G32180" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 506 (183.2 bits), Expect = 1.8e-48, P = 1.8e-48
 Identities = 91/122 (74%), Positives = 106/122 (86%)

Query:    23 RKLNNRNLP-CHGIRAMRVEKPLEELYNVRVERQVSPERLKELDVSRWSMWKTGKCKLPW 81
             +K NN ++     +  M+ EKPLEELYNV+VER+VS +RL+EL VSRWS+WKTGKCKLPW
Sbjct:    18 KKTNNLSVQRAFRVTCMQTEKPLEELYNVKVERKVSQKRLEELGVSRWSVWKTGKCKLPW 77

Query:    82 DWQVDQLVYIEEGEVRVVPEGSQRYMRFLAGDLIRYPKWFEADLFFNGPYQERYSFRAYG 141
             DWQVDQLVYIE+GEVRVVPEGS+RYM+FLAGDL+RYPKW EADLFFN PY ERY F+AYG
Sbjct:    78 DWQVDQLVYIEQGEVRVVPEGSKRYMQFLAGDLVRYPKWLEADLFFNAPYIERYCFKAYG 137

Query:   142 DD 143
             DD
Sbjct:   138 DD 139
GO:0003674 "molecular_function" evidence=ND
GO:0008150 "biological_process" evidence=ND
GO:0009507 "chloroplast" evidence=ISM
GO:0009295 "nucleoid" evidence=IDA
GO:0009508 "plastid chromosome" evidence=IDA
TAIR|locus:2046412 AT2G32650 "AT2G32650" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q60B25 MCA0659 "Putative uncharacterized protein" [Methylococcus capsulatus str. Bath (taxid:243233)] Back     alignment and assigned GO terms
TAIR|locus:2122734 AT4G10300 "AT4G10300" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2122819 AT4G10290 "AT4G10290" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2122809 AT4G10280 "AT4G10280" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2103095 AT3G04300 "AT3G04300" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:1006230002 AT2G27402 "AT2G27402" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:505006531 AT4G28703 "AT4G28703" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
grail3.0012023001
hypothetical protein (142 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query143
pfam0589974 pfam05899, Cupin_3, Protein of unknown function (D 7e-17
>gnl|CDD|147835 pfam05899, Cupin_3, Protein of unknown function (DUF861) Back     alignment and domain information 
 Score = 69.6 bits (171), Expect = 7e-17
 Identities = 23/75 (30%), Positives = 34/75 (45%), Gaps = 1/75 (1%)

Query: 61  LKELDVSRWSMWKTGKCKLPWDWQVDQLVYIEEGEVRVVPEGSQRYMRFLAGDLIRYPKW 120
           L    V  W +W+    K  W ++ D+  YI  GEV V PEG +  +   AGDL+ +P  
Sbjct: 1   LGPDGVFSWGIWECTPGKFRWTYEEDEFCYILSGEVTVTPEGGET-VELRAGDLVVFPAG 59

Query: 121 FEADLFFNGPYQERY 135
           F          ++ Y
Sbjct: 60  FTGTWEVLETVRKHY 74

This family consists of several proteins which seem to be specific to plants and bacteria. The function of this family is unknown. Length = 74

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 143
COG3450116 Predicted enzyme of the cupin superfamily [General 99.97
PF0589974 Cupin_3: Protein of unknown function (DUF861); Int 99.95
PF06249152 EutQ: Ethanolamine utilisation protein EutQ; Inter 99.07
PRK15457233 ethanolamine utilization protein EutQ; Provisional 98.88
COG4766176 EutQ Ethanolamine utilization protein [Amino acid 98.7
COG3837161 Uncharacterized conserved protein, contains double 98.37
PF0788371 Cupin_2: Cupin domain; InterPro: IPR013096 This fa 98.34
COG0662127 {ManC} Mannose-6-phosphate isomerase [Carbohydrate 98.22
PRK13290125 ectC L-ectoine synthase; Reviewed 98.08
PF00190144 Cupin_1: Cupin; InterPro: IPR006045 This family re 97.99
PRK13264177 3-hydroxyanthranilate 3,4-dioxygenase; Provisional 97.92
COG1917131 Uncharacterized conserved protein, contains double 97.84
TIGR03037159 anthran_nbaC 3-hydroxyanthranilate 3,4-dioxygenase 97.82
PF02311136 AraC_binding: AraC-like ligand binding domain; Int 97.62
TIGR03404367 bicupin_oxalic bicupin, oxalate decarboxylase fami 97.52
PRK09943185 DNA-binding transcriptional repressor PuuR; Provis 97.52
smart00835146 Cupin_1 Cupin. This family represents the conserve 97.49
PF0686594 DUF1255: Protein of unknown function (DUF1255); In 97.41
PRK1057994 hypothetical protein; Provisional 97.4
TIGR03214 260 ura-cupin putative allantoin catabolism protein. T 97.3
TIGR03404 367 bicupin_oxalic bicupin, oxalate decarboxylase fami 97.16
PRK04190191 glucose-6-phosphate isomerase; Provisional 97.13
PRK11171 266 hypothetical protein; Provisional 97.1
TIGR01479468 GMP_PMI mannose-1-phosphate guanylyltransferase/ma 96.99
PRK15460478 cpsB mannose-1-phosphate guanyltransferase; Provis 96.9
COG4297163 Uncharacterized protein containing double-stranded 96.83
PF01050151 MannoseP_isomer: Mannose-6-phosphate isomerase; In 96.69
PF12852186 Cupin_6: Cupin 96.61
PF04209 424 HgmA: homogentisate 1,2-dioxygenase; InterPro: IPR 96.47
PF03079157 ARD: ARD/ARD' family; InterPro: IPR004313 The two 96.31
COG2140209 Thermophilic glucose-6-phosphate isomerase and rel 96.28
PRK10296 278 DNA-binding transcriptional regulator ChbR; Provis 96.26
PRK05341 438 homogentisate 1,2-dioxygenase; Provisional 96.2
PRK11171266 hypothetical protein; Provisional 96.16
TIGR03214260 ura-cupin putative allantoin catabolism protein. T 96.07
TIGR01015 429 hmgA homogentisate 1,2-dioxygenase. Missing in hum 96.0
PF1169985 CENP-C_C: Mif2/CENP-C like; PDB: 2VPV_B. 95.89
PRK13500 312 transcriptional activator RhaR; Provisional 95.86
PRK13502 282 transcriptional activator RhaR; Provisional 95.81
PRK13501 290 transcriptional activator RhaR; Provisional 95.76
PLN00212493 glutelin; Provisional 95.69
PF1297391 Cupin_7: ChrR Cupin-like domain; PDB: 3O14_B 2Z2S_ 95.52
PLN02658 435 homogentisate 1,2-dioxygenase 95.52
PRK10371 302 DNA-binding transcriptional regulator MelR; Provis 95.51
PRK13503 278 transcriptional activator RhaS; Provisional 95.39
TIGR02272335 gentisate_1_2 gentisate 1,2-dioxygenase. This fami 95.31
COG312394 Uncharacterized protein conserved in bacteria [Fun 95.25
TIGR02297 287 HpaA 4-hydroxyphenylacetate catabolism regulatory 95.12
COG3508 427 HmgA Homogentisate 1,2-dioxygenase [Secondary meta 95.01
PF06052151 3-HAO: 3-hydroxyanthranilic acid dioxygenase; Inte 94.32
PF06560182 GPI: Glucose-6-phosphate isomerase (GPI); InterPro 94.03
COG4101142 Predicted mannose-6-phosphate isomerase [Carbohydr 93.58
TIGR00218302 manA mannose-6-phosphate isomerase, class I. The n 93.13
PRK10572 290 DNA-binding transcriptional regulator AraC; Provis 93.07
KOG2107179 consensus Uncharacterized conserved protein, conta 92.82
PLN00212 493 glutelin; Provisional 92.49
TIGR02272 335 gentisate_1_2 gentisate 1,2-dioxygenase. This fami 92.16
COG3257 264 GlxB Uncharacterized protein, possibly involved in 91.95
PLN02288394 mannose-6-phosphate isomerase 91.81
PRK15131389 mannose-6-phosphate isomerase; Provisional 91.75
COG1791181 Uncharacterized conserved protein, contains double 91.11
PRK09685 302 DNA-binding transcriptional activator FeaR; Provis 91.01
PF14499 251 DUF4437: Domain of unknown function (DUF4437); PDB 90.44
PF06339126 Ectoine_synth: Ectoine synthase; InterPro: IPR0104 90.43
PF02678107 Pirin: Pirin; InterPro: IPR003829 This entry repre 90.38
PF14525172 AraC_binding_2: AraC-binding-like domain 89.85
KOG2757411 consensus Mannose-6-phosphate isomerase [Carbohydr 88.32
TIGR02451215 anti_sig_ChrR anti-sigma factor, putative, ChrR fa 85.74
PF13621251 Cupin_8: Cupin-like domain; PDB: 3AL6_C 3AL5_C 2XU 85.71
PRK15186 291 AraC family transcriptional regulator; Provisional 85.65
PF02041167 Auxin_BP: Auxin binding protein; InterPro: IPR0005 85.07
PF04622216 ERG2_Sigma1R: ERG2 and Sigma1 receptor like protei 85.03
PF05523131 FdtA: WxcM-like, C-terminal ; InterPro: IPR008894 84.64
PF1114263 DUF2917: Protein of unknown function (DUF2917); In 84.47
PF05726104 Pirin_C: Pirin C-terminal cupin domain; InterPro: 81.87
PF04962 261 KduI: KduI/IolB family; InterPro: IPR021120 The Kd 81.0
KOG0501 971 consensus K+-channel KCNQ [Inorganic ion transport 80.96
COG3435 351 Gentisate 1,2-dioxygenase [Secondary metabolites b 80.07
COG1482312 ManA Phosphomannose isomerase [Carbohydrate transp 80.03
>COG3450 Predicted enzyme of the cupin superfamily [General function prediction only] Back     alignment and domain information 
Probab=99.97  E-value=2.8e-30  Score=193.12  Aligned_cols=86  Identities=21%  Similarity=0.345  Sum_probs=79.5

Q ss_pred             EecCCCHHHHhhc----CCCceeeeeecCceeeeeeccceEEEEEEeEEEEEeCCCeeeEEEcCCcEEEEcCCCEEEEEE
Q 032303           52 VERQVSPERLKEL----DVSRWSMWKTGKCKLPWDWQVDQLVYIEEGEVRVVPEGSQRYMRFLAGDLIRYPKWFEADLFF  127 (143)
Q Consensus        52 ve~~ps~~rl~~l----Gv~~wgiWec~pg~f~~~y~~dE~~yILEG~V~vt~d~G~~~~e~~AGDlv~fPkG~~gtW~V  127 (143)
                      |+++|+......+    |....|+|+|+||+|++.|+.+|+||||+|+++||+|+|++ ++++|||+|+||+||+|+|+|
T Consensus        26 i~G~p~~~t~~~~~~~dg~~~~GiWe~TpG~~r~~y~~~E~chil~G~v~~T~d~Ge~-v~~~aGD~~~~~~G~~g~W~V  104 (116)
T COG3450          26 ILGDPSAATWNLYGAPDGQVETGIWECTPGKFRVTYDEDEFCHILEGRVEVTPDGGEP-VEVRAGDSFVFPAGFKGTWEV  104 (116)
T ss_pred             ccCCccceehheeeCCCCCeeEeEEEecCccceEEcccceEEEEEeeEEEEECCCCeE-EEEcCCCEEEECCCCeEEEEE
Confidence            7788877777655    34578999999999999999999999999999999999999 899999999999999999999


Q ss_pred             ecceEEEEEEE
Q 032303          128 NGPYQERYSFR  138 (143)
Q Consensus       128 ~e~vrK~Y~~~  138 (143)
                      ++++||+|+++
T Consensus       105 ~EtvrK~Yv~~  115 (116)
T COG3450         105 LETVRKHYVIR  115 (116)
T ss_pred             eeeeEEEEEEe
Confidence            99999999986

>PF05899 Cupin_3: Protein of unknown function (DUF861); InterPro: IPR008579 The function of the proteins in this entry are unknown Back     alignment and domain information
>PF06249 EutQ: Ethanolamine utilisation protein EutQ; InterPro: IPR010424 The eut operon of Salmonella typhimurium encodes proteins involved in the cobalamin-dependent degradation of ethanolamine Back     alignment and domain information
>PRK15457 ethanolamine utilization protein EutQ; Provisional Back     alignment and domain information
>COG4766 EutQ Ethanolamine utilization protein [Amino acid transport and metabolism] Back     alignment and domain information
>COG3837 Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] Back     alignment and domain information
>PF07883 Cupin_2: Cupin domain; InterPro: IPR013096 This family represents the conserved barrel domain of the cupin superfamily [] (cupa is the Latin term for a small barrel) Back     alignment and domain information
>COG0662 {ManC} Mannose-6-phosphate isomerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK13290 ectC L-ectoine synthase; Reviewed Back     alignment and domain information
>PF00190 Cupin_1: Cupin; InterPro: IPR006045 This family represents the conserved barrel domain of the 'cupin' superfamily ('cupa' is the Latin term for a small barrel) Back     alignment and domain information
>PRK13264 3-hydroxyanthranilate 3,4-dioxygenase; Provisional Back     alignment and domain information
>COG1917 Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] Back     alignment and domain information
>TIGR03037 anthran_nbaC 3-hydroxyanthranilate 3,4-dioxygenase Back     alignment and domain information
>PF02311 AraC_binding: AraC-like ligand binding domain; InterPro: IPR003313 This entry defines the arabinose-binding and dimerisation domain of the bacterial gene regulatory protein AraC Back     alignment and domain information
>TIGR03404 bicupin_oxalic bicupin, oxalate decarboxylase family Back     alignment and domain information
>PRK09943 DNA-binding transcriptional repressor PuuR; Provisional Back     alignment and domain information
>smart00835 Cupin_1 Cupin Back     alignment and domain information
>PF06865 DUF1255: Protein of unknown function (DUF1255); InterPro: IPR009664 This family consists of several conserved hypothetical bacterial proteins of around 95 residues in length Back     alignment and domain information
>PRK10579 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03214 ura-cupin putative allantoin catabolism protein Back     alignment and domain information
>TIGR03404 bicupin_oxalic bicupin, oxalate decarboxylase family Back     alignment and domain information
>PRK04190 glucose-6-phosphate isomerase; Provisional Back     alignment and domain information
>PRK11171 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01479 GMP_PMI mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase Back     alignment and domain information
>PRK15460 cpsB mannose-1-phosphate guanyltransferase; Provisional Back     alignment and domain information
>COG4297 Uncharacterized protein containing double-stranded beta helix domain [Function unknown] Back     alignment and domain information
>PF01050 MannoseP_isomer: Mannose-6-phosphate isomerase; InterPro: IPR001538 Mannose-6-phosphate isomerase or phosphomannose isomerase (5 Back     alignment and domain information
>PF12852 Cupin_6: Cupin Back     alignment and domain information
>PF04209 HgmA: homogentisate 1,2-dioxygenase; InterPro: IPR005708 Alkaptonuria (AKU), a rare hereditary disorder, was the first disease to be interpreted as an inborn error of metabolism Back     alignment and domain information
>PF03079 ARD: ARD/ARD' family; InterPro: IPR004313 The two acireductone dioxygenase enzymes (ARD and ARD', previously known as E-2 and E-2') from Klebsiella pneumoniae share the same amino acid sequence Q9ZFE7 from SWISSPROT, but bind different metal ions: ARD binds Ni2+, ARD' binds Fe2+ [] Back     alignment and domain information
>COG2140 Thermophilic glucose-6-phosphate isomerase and related metalloenzymes [Carbohydrate transport and metabolism / General function prediction only] Back     alignment and domain information
>PRK10296 DNA-binding transcriptional regulator ChbR; Provisional Back     alignment and domain information
>PRK05341 homogentisate 1,2-dioxygenase; Provisional Back     alignment and domain information
>PRK11171 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03214 ura-cupin putative allantoin catabolism protein Back     alignment and domain information
>TIGR01015 hmgA homogentisate 1,2-dioxygenase Back     alignment and domain information
>PF11699 CENP-C_C: Mif2/CENP-C like; PDB: 2VPV_B Back     alignment and domain information
>PRK13500 transcriptional activator RhaR; Provisional Back     alignment and domain information
>PRK13502 transcriptional activator RhaR; Provisional Back     alignment and domain information
>PRK13501 transcriptional activator RhaR; Provisional Back     alignment and domain information
>PLN00212 glutelin; Provisional Back     alignment and domain information
>PF12973 Cupin_7: ChrR Cupin-like domain; PDB: 3O14_B 2Z2S_F 2Q1Z_B 3EBR_A Back     alignment and domain information
>PLN02658 homogentisate 1,2-dioxygenase Back     alignment and domain information
>PRK10371 DNA-binding transcriptional regulator MelR; Provisional Back     alignment and domain information
>PRK13503 transcriptional activator RhaS; Provisional Back     alignment and domain information
>TIGR02272 gentisate_1_2 gentisate 1,2-dioxygenase Back     alignment and domain information
>COG3123 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>TIGR02297 HpaA 4-hydroxyphenylacetate catabolism regulatory protein HpaA Back     alignment and domain information
>COG3508 HmgA Homogentisate 1,2-dioxygenase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF06052 3-HAO: 3-hydroxyanthranilic acid dioxygenase; InterPro: IPR010329 Members of this protein family, from both bacteria and eukaryotes, are the enzyme 3-hydroxyanthranilate 3,4-dioxygenase (1 Back     alignment and domain information
>PF06560 GPI: Glucose-6-phosphate isomerase (GPI); InterPro: IPR010551 This entry consists of several bacterial and archaeal glucose-6-phosphate isomerase (GPI) proteins (5 Back     alignment and domain information
>COG4101 Predicted mannose-6-phosphate isomerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00218 manA mannose-6-phosphate isomerase, class I Back     alignment and domain information
>PRK10572 DNA-binding transcriptional regulator AraC; Provisional Back     alignment and domain information
>KOG2107 consensus Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] Back     alignment and domain information
>PLN00212 glutelin; Provisional Back     alignment and domain information
>TIGR02272 gentisate_1_2 gentisate 1,2-dioxygenase Back     alignment and domain information
>COG3257 GlxB Uncharacterized protein, possibly involved in glyoxylate utilization [General function prediction only] Back     alignment and domain information
>PLN02288 mannose-6-phosphate isomerase Back     alignment and domain information
>PRK15131 mannose-6-phosphate isomerase; Provisional Back     alignment and domain information
>COG1791 Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] Back     alignment and domain information
>PRK09685 DNA-binding transcriptional activator FeaR; Provisional Back     alignment and domain information
>PF14499 DUF4437: Domain of unknown function (DUF4437); PDB: 2QDR_A Back     alignment and domain information
>PF06339 Ectoine_synth: Ectoine synthase; InterPro: IPR010462 This family consists of several bacterial ectoine synthase proteins Back     alignment and domain information
>PF02678 Pirin: Pirin; InterPro: IPR003829 This entry represents N-terminal domain of Pirin proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>PF14525 AraC_binding_2: AraC-binding-like domain Back     alignment and domain information
>KOG2757 consensus Mannose-6-phosphate isomerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02451 anti_sig_ChrR anti-sigma factor, putative, ChrR family Back     alignment and domain information
>PF13621 Cupin_8: Cupin-like domain; PDB: 3AL6_C 3AL5_C 2XUM_A 2Y0I_A 1MZE_A 3KCY_A 1MZF_A 1YCI_A 2ILM_A 1H2L_A Back     alignment and domain information
>PRK15186 AraC family transcriptional regulator; Provisional Back     alignment and domain information
>PF02041 Auxin_BP: Auxin binding protein; InterPro: IPR000526 Auxin binding protein is located in the lumen of the endoplasmic reticulum (ER) Back     alignment and domain information
>PF04622 ERG2_Sigma1R: ERG2 and Sigma1 receptor like protein; InterPro: IPR006716 This family consists of the fungal C-8 sterol isomerase and mammalian sigma1 receptor Back     alignment and domain information
>PF05523 FdtA: WxcM-like, C-terminal ; InterPro: IPR008894 This entry includes FdtA (Q6T1W8 from SWISSPROT) from Aneurinibacillus thermoaerophilus, which has been characterised as a dTDP-6-deoxy-3,4-keto-hexulose isomerase [] Back     alignment and domain information
>PF11142 DUF2917: Protein of unknown function (DUF2917); InterPro: IPR021317 This bacterial family of proteins appears to be restricted to Proteobacteria Back     alignment and domain information
>PF05726 Pirin_C: Pirin C-terminal cupin domain; InterPro: IPR008778 This entry represents C-terminal domain of Pirin proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>PF04962 KduI: KduI/IolB family; InterPro: IPR021120 The KduI/IolB family of enzymes includes 5-keto 4-deoxyuronate isomerase (KduI) and 5-deoxy-glucuronate isomerase (IolB) Back     alignment and domain information
>KOG0501 consensus K+-channel KCNQ [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG3435 Gentisate 1,2-dioxygenase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG1482 ManA Phosphomannose isomerase [Carbohydrate transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query143
1o5u_A101 Crystal Structure Of A Duf861 Family Protein (Tm111 3e-07
1lkn_A89 Solution Nmr Structure Of Protein Tm_1112 From Ther 3e-07
>pdb|1O5U|A Chain A, Crystal Structure Of A Duf861 Family Protein (Tm1112) From Thermotoga Maritima At 1.83 A Resolution Length = 101 Back     alignment and structure 
Iteration: 1

 Score = 50.8 bits (120), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 43/70 (61%), Gaps = 2/70 (2%)
Query: 50  VRVERQVSPERLKELDVSRWSMWKTGKCKLPWDWQVDQLVYIEEGEVRVVPEGSQRYMRF 109
           V++E+  +PE+LKEL V +W +W+    +  W +  ++  YI EG+V V  E  ++Y+  
Sbjct: 15  VKIEKP-TPEKLKELSVEKWPIWEKEVSEFDWYYDTNETCYILEGKVEVTTEDGKKYV-I 72
Query: 110 LAGDLIRYPK 119
             GDL+ +PK
Sbjct: 73  EKGDLVTFPK 82
>pdb|1LKN|A Chain A, Solution Nmr Structure Of Protein Tm_1112 From Thermotoga Maritima. Ontario Centre For Structural Proteomics Target Tm1112_1_89; Northeast Structural Genomics Consortium Target Vt74. Length = 89 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query143
1o5u_A101 Novel thermotoga maritima enzyme TM1112; cupin, st 2e-13
3myx_A238 Uncharacterized protein pspto_0244; protein of unk 2e-04
2pyt_A133 Ethanolamine utilization protein EUTQ; structural 5e-04
4axo_A151 EUTQ, ethanolamine utilization protein; structural 6e-04
>1o5u_A Novel thermotoga maritima enzyme TM1112; cupin, structural genomics center for structural genomics, JCSG, protein structure INI PSI; 1.83A {Thermotoga maritima} SCOP: b.82.1.8 PDB: 1lkn_A 2k9z_A Length = 101 Back     alignment and structure
 Score = 61.4 bits (149), Expect = 2e-13
 Identities = 27/88 (30%), Positives = 47/88 (53%), Gaps = 2/88 (2%)

Query: 50  VRVERQVSPERLKELDVSRWSMWKTGKCKLPWDWQVDQLVYIEEGEVRVVPEGSQRYMRF 109
           V++E+  +PE+LKEL V +W +W+    +  W +  ++  YI EG+V V  E  ++Y   
Sbjct: 15  VKIEK-PTPEKLKELSVEKWPIWEKEVSEFDWYYDTNETCYILEGKVEVTTEDGKKY-VI 72

Query: 110 LAGDLIRYPKWFEADLFFNGPYQERYSF 137
             GDL+ +PK          P ++ Y+ 
Sbjct: 73  EKGDLVTFPKGLRCRWKVLEPVRKHYNL 100
>3myx_A Uncharacterized protein pspto_0244; protein of unknown function (DUF861), cupin_3 (PF05899), STR genomics; HET: MSE; 1.30A {Pseudomonas syringae PV} Length = 238 Back     alignment and structure
>2pyt_A Ethanolamine utilization protein EUTQ; structural genomics, joint center for structural genomics, J protein structure initiative; 1.90A {Salmonella typhimurium LT2} SCOP: b.82.1.24 Length = 133 Back     alignment and structure
>4axo_A EUTQ, ethanolamine utilization protein; structural protein, bacterial microcompartment, BMC; 1.00A {Clostridium difficile} Length = 151 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query143
3es4_A116 Uncharacterized protein DUF861 with A RMLC-like C; 99.94
3myx_A238 Uncharacterized protein pspto_0244; protein of unk 99.9
3bcw_A123 Uncharacterized protein; structural genomics, join 99.85
1o5u_A101 Novel thermotoga maritima enzyme TM1112; cupin, st 99.76
2pyt_A133 Ethanolamine utilization protein EUTQ; structural 99.58
3myx_A 238 Uncharacterized protein pspto_0244; protein of unk 99.57
4axo_A151 EUTQ, ethanolamine utilization protein; structural 99.47
3lwc_A119 Uncharacterized protein; structural genomics, unkn 99.26
2i45_A107 Hypothetical protein; neisseria meningitidis cupin 98.53
2oyz_A94 UPF0345 protein VPA0057; unknown function, structu 98.44
2pfw_A116 Cupin 2, conserved barrel domain protein; cupin do 98.22
3h8u_A125 Uncharacterized conserved protein with double-STR 98.2
1yhf_A115 Hypothetical protein SPY1581; structural genomics, 98.2
2o8q_A134 Hypothetical protein; cpuin-like fold, structural 98.17
3d82_A102 Cupin 2, conserved barrel domain protein; structur 98.11
1vj2_A126 Novel manganese-containing cupin TM1459; structura 98.1
2q30_A110 Uncharacterized protein; double-stranded beta-heli 98.09
3fjs_A114 Uncharacterized protein with RMLC-like cupin fold; 98.08
2ozj_A114 Cupin 2, conserved barrel; cupin superfamily prote 98.07
2opk_A112 Hypothetical protein; putative mannose-6-phosphate 98.06
3l2h_A162 Putative sugar phosphate isomerase; AFE_0303, stru 98.06
4e2g_A126 Cupin 2 conserved barrel domain protein; MCSG, PSI 98.04
1juh_A350 Quercetin 2,3-dioxygenase; cupin, glycoprotein, be 98.04
1v70_A105 Probable antibiotics synthesis protein; structural 98.03
2fqp_A97 Hypothetical protein BP2299; double-stranded beta- 98.0
3ht1_A145 REMF protein; cupin fold, Zn-binding, antibiotic b 97.96
3ibm_A167 Cupin 2, conserved barrel domain protein; cupin 2 97.95
1y9q_A192 Transcriptional regulator, HTH_3 family; transcrip 97.94
1fi2_A201 Oxalate oxidase, germin; beta-jellyroll, oxidoredu 97.94
2gu9_A113 Tetracenomycin polyketide synthesis protein; X-RAY 97.92
2arc_A164 ARAC, arabinose operon regulatory protein; transcr 97.92
1zvf_A176 3-hydroxyanthranilate 3,4-dioxygenase; jellyroll b 97.91
1yfu_A174 3-hydroxyanthranilate-3,4-dioxygenase; cupin, oxid 97.88
3kgz_A156 Cupin 2 conserved barrel domain protein; metallopr 97.87
3i7d_A163 Sugar phosphate isomerase; YP_168127.1, structural 97.87
2bnm_A198 Epoxidase; oxidoreductase, cupin, HTH, cation-depe 97.86
2b8m_A117 Hypothetical protein MJ0764; structural genomics, 97.86
1o4t_A133 Putative oxalate decarboxylase; double-stranded be 97.84
1dgw_A178 Canavalin; duplicated swiss-roll beta barrels, loo 97.8
3jzv_A166 Uncharacterized protein RRU_A2000; structural geno 97.78
2vpv_A166 Protein MIF2, MIF2P; nucleus, mitosis, centromere, 97.75
4e2q_A 266 Ureidoglycine aminohydrolase; BI-cupin, manganese 97.75
3rns_A 227 Cupin 2 conserved barrel domain protein; structura 97.73
1sfn_A 246 Conserved hypothetical protein; structural genomic 97.7
1lr5_A163 Auxin binding protein 1; beta jellyroll, double st 97.69
4i4a_A128 Similar to unknown protein; structural genomics, P 97.68
3rns_A227 Cupin 2 conserved barrel domain protein; structura 97.68
4b29_A217 Dimethylsulfoniopropionate lyase; hydrolase, dimet 97.66
3eo6_A106 Protein of unknown function (DUF1255); AFE_2634, s 97.64
1rc6_A 261 Hypothetical protein YLBA; structural genomics, NY 97.62
2f4p_A147 Hypothetical protein TM1010; double-stranded beta- 97.62
1vr3_A191 Acireductone dioxygenase; 13543033, structural gen 97.61
3fz3_A531 Prunin; TREE NUT allergen, allergy, amandin, almon 97.59
1uij_A 416 Beta subunit of beta conglycinin; double-stranded 97.58
1y3t_A 337 Hypothetical protein YXAG; BI cupin, dioxygenase, 97.58
3cew_A125 Uncharacterized cupin protein; all beta-protein, j 97.57
1sef_A 274 Conserved hypothetical protein; structural genomic 97.57
3es1_A172 Cupin 2, conserved barrel domain protein; YP_00116 97.56
2cav_A 445 Protein (canavalin); vicilin, 7S SEED protein, dom 97.56
2ea7_A 434 7S globulin-1; beta barrel, cupin superfamily, pla 97.55
1sq4_A 278 GLXB, glyoxylate-induced protein; structural genom 97.52
2oa2_A148 BH2720 protein; 10175341, structural genomics, joi 97.52
1x82_A190 Glucose-6-phosphate isomerase; cupin superfamily, 97.5
3h7j_A243 Bacilysin biosynthesis protein BACB; YWFC, bacilys 97.49
4h7l_A157 Uncharacterized protein; structural genomics, PSI- 97.48
2vqa_A 361 SLL1358 protein, MNCA; periplasmic binding protein 97.47
1rc6_A261 Hypothetical protein YLBA; structural genomics, NY 97.46
1y3t_A337 Hypothetical protein YXAG; BI cupin, dioxygenase, 97.44
1fxz_A476 Glycinin G1; proglycinin, legumin, SEED storage pr 97.41
1j58_A 385 YVRK protein; cupin, decarboxyklase, oxalate, mang 97.4
3c3v_A510 Arachin ARAH3 isoform; peanut allergen, allergy, g 97.4
2e9q_A459 11S globulin subunit beta; cucubitin, pumpkin SEED 97.38
2qnk_A 286 3-hydroxyanthranilate 3,4-dioxygenase; bicupin fol 97.37
3h7j_A 243 Bacilysin biosynthesis protein BACB; YWFC, bacilys 97.37
1zrr_A179 E-2/E-2' protein; nickel, cupin, beta helix, methi 97.37
2d5f_A493 Glycinin A3B4 subunit; soybean, globulin, 11S,SEED 97.35
1sef_A274 Conserved hypothetical protein; structural genomic 97.32
1juh_A 350 Quercetin 2,3-dioxygenase; cupin, glycoprotein, be 97.3
2vqa_A361 SLL1358 protein, MNCA; periplasmic binding protein 97.29
3d0j_A140 Uncharacterized protein CA_C3497; beta-barrel, str 97.28
3ksc_A496 LEGA class, prolegumin; PEA prolegumin, 11S SEED s 97.26
2xlg_A239 SLL1785 protein, CUCA; metal binding protein, cupi 97.23
3kgl_A466 Cruciferin; 11S SEED globulin, rapeseed, SEED stor 97.19
2ozi_A98 Hypothetical protein RPA4178; APC6210, putative pr 97.13
3s7i_A 418 Allergen ARA H 1, clone P41B; bicupin, vicilin, st 97.12
3qac_A465 11S globulin SEED storage protein; 11S SEED storag 97.12
3hqx_A111 UPF0345 protein aciad0356; DUF1255,PF06865,PSI2,MC 97.08
2d40_A 354 Z3393, putative gentisate 1,2-dioxygenase; gentisi 97.01
3lag_A98 Uncharacterized protein RPA4178; functionally unkn 96.97
2phl_A397 Phaseolin; plant SEED storage protein(vicilin); HE 96.96
1sfn_A246 Conserved hypothetical protein; structural genomic 96.94
1j58_A385 YVRK protein; cupin, decarboxyklase, oxalate, mang 96.92
1uij_A416 Beta subunit of beta conglycinin; double-stranded 96.92
2d40_A354 Z3393, putative gentisate 1,2-dioxygenase; gentisi 96.91
2phl_A 397 Phaseolin; plant SEED storage protein(vicilin); HE 96.87
2e9q_A 459 11S globulin subunit beta; cucubitin, pumpkin SEED 96.85
2ea7_A434 7S globulin-1; beta barrel, cupin superfamily, pla 96.81
3bu7_A 394 Gentisate 1,2-dioxygenase; cupin domain, oxidoredu 96.76
3nw4_A 368 Gentisate 1,2-dioxygenase; beta-barrel, oxidoreduc 96.73
1fxz_A 476 Glycinin G1; proglycinin, legumin, SEED storage pr 96.68
2cav_A445 Protein (canavalin); vicilin, 7S SEED protein, dom 96.68
2d5f_A 493 Glycinin A3B4 subunit; soybean, globulin, 11S,SEED 96.67
3qac_A 465 11S globulin SEED storage protein; 11S SEED storag 96.62
1eyb_A 471 Homogentisate 1,2-dioxygenase; jelly roll, beta sa 96.52
3bu7_A394 Gentisate 1,2-dioxygenase; cupin domain, oxidoredu 96.41
1sq4_A278 GLXB, glyoxylate-induced protein; structural genom 96.17
3ksc_A 496 LEGA class, prolegumin; PEA prolegumin, 11S SEED s 96.14
2o1q_A145 Putative acetyl/propionyl-COA carboxylase, alpha; 96.03
3gbg_A 276 TCP pilus virulence regulatory protein; cupin, hel 96.0
3nw4_A368 Gentisate 1,2-dioxygenase; beta-barrel, oxidoreduc 95.96
4e2q_A266 Ureidoglycine aminohydrolase; BI-cupin, manganese 95.89
3s7i_A418 Allergen ARA H 1, clone P41B; bicupin, vicilin, st 95.64
3kgl_A 466 Cruciferin; 11S SEED globulin, rapeseed, SEED stor 95.6
3c3v_A 510 Arachin ARAH3 isoform; peanut allergen, allergy, g 95.5
2y0o_A175 Probable D-lyxose ketol-isomerase; carbohydrate me 95.45
2qnk_A286 3-hydroxyanthranilate 3,4-dioxygenase; bicupin fol 95.22
3st7_A369 Capsular polysaccharide synthesis enzyme CAP5F; ro 94.66
3cjx_A165 Protein of unknown function with A cupin-like FOL; 94.35
1qwr_A319 Mannose-6-phosphate isomerase; structural genomics 93.81
2wfp_A394 Mannose-6-phosphate isomerase; APO-structure, meta 93.55
2q1z_B195 Anti-sigma factor CHRR, transcriptional activator; 93.43
1pmi_A440 PMI, phosphomannose isomerase; aldose-ketose isome 92.76
1zx5_A300 Mannosephosphate isomerase, putative; STRU genomic 92.31
3bpz_A202 Potassium/sodium hyperpolarization-activated cycli 91.64
3o14_A 223 Anti-ecfsigma factor, CHRR; cupin, structural geno 91.47
3ebr_A159 Uncharacterized RMLC-like cupin; structural genomi 91.46
2d93_A134 RAP guanine nucleotide exchange factor 6; CNMP_bin 91.11
2vec_A 256 YHAK, pirin-like protein YHAK; ROS, bicupin, sulfe 88.63
2vec_A256 YHAK, pirin-like protein YHAK; ROS, bicupin, sulfe 88.45
2ptm_A198 Hyperpolarization-activated (IH) channel; ION chan 88.28
3bal_A153 Acetylacetone-cleaving enzyme; jelly roll, tetrame 87.87
3fz3_A 531 Prunin; TREE NUT allergen, allergy, amandin, almon 87.38
3ocp_A139 PRKG1 protein; serine/threonine kinase, TF2I and I 87.01
4gjz_A235 Lysine-specific demethylase 8; JMJC, beta barrel, 85.04
4f8a_A160 Potassium voltage-gated channel subfamily H membe; 84.88
3pna_A154 CAMP-dependent protein kinase type I-alpha regula 84.72
3eqe_A171 Putative cystein deoxygenase; YUBC, SR112, NESG, s 83.95
1tq5_A 242 Protein YHHW; bicupin, pirin, montreal-kingston ba 83.59
2gm6_A208 Cysteine dioxygenase type I; structural genomics, 82.25
3of1_A 246 CAMP-dependent protein kinase regulatory subunit; 82.18
3ukn_A212 Novel protein similar to vertebrate potassium VOL 81.75
2xdv_A 442 MYC-induced nuclear antigen; ribosome biogenesis, 81.7
2qjv_A 270 Uncharacterized IOLB-like protein; structural geno 81.48
1yud_A170 Hypothetical protein SO0799; SOR12, Q8E1N8, PSI, p 81.26
>3es4_A Uncharacterized protein DUF861 with A RMLC-like C; 17741406, protein of unknown function (DUF861) with A RMLC-L fold; HET: MSE; 1.64A {Agrobacterium tumefaciens str} Back     alignment and structure
Probab=99.94  E-value=3.1e-27  Score=175.09  Aligned_cols=76  Identities=9%  Similarity=0.094  Sum_probs=71.5

Q ss_pred             hcCCCceeeeeecCceeeeeeccc-eEEEEEEeEEEEEeCCCeeeEEEcCCcEEEEcCCCEEEEEEecceEEEEEEEe
Q 032303           63 ELDVSRWSMWKTGKCKLPWDWQVD-QLVYIEEGEVRVVPEGSQRYMRFLAGDLIRYPKWFEADLFFNGPYQERYSFRA  139 (143)
Q Consensus        63 ~lGv~~wgiWec~pg~f~~~y~~d-E~~yILEG~V~vt~d~G~~~~e~~AGDlv~fPkG~~gtW~V~e~vrK~Y~~~a  139 (143)
                      ..|...+|+|+|+||+|+|+|+.+ |+||||||+++|+++||++ ++|+|||+|+||+|++|+|+|++++||+|++..
T Consensus        38 ~~g~~~~GvWe~tPG~~~~~~~~~~E~~~iLeG~~~lt~ddG~~-~~l~aGD~~~~P~G~~gtWev~e~vrK~~~~~~  114 (116)
T 3es4_A           38 VENGTIVAVWMAEPGIYNYAGRDLEETFVVVEGEALYSQADADP-VKIGPGSIVSIAKGVPSRLEILSSFRKLATVIP  114 (116)
T ss_dssp             SSSCCEEEEEEECSEEEEECCCSEEEEEEEEECCEEEEETTCCC-EEECTTEEEEECTTCCEEEEECSCEEEEEEEEE
T ss_pred             CCCCEEEEEEecCCceeECeeCCCcEEEEEEEeEEEEEeCCCeE-EEECCCCEEEECCCCeEEEEEeEEEeEEEEEec
Confidence            357789999999999999999976 9999999999999999998 899999999999999999999999999999864
>3myx_A Uncharacterized protein pspto_0244; protein of unknown function (DUF861), cupin_3 (PF05899), STR genomics; HET: MSE; 1.30A {Pseudomonas syringae PV} Back     alignment and structure
>3bcw_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.60A {Bordetella bronchiseptica RB50} Back     alignment and structure
>1o5u_A Novel thermotoga maritima enzyme TM1112; cupin, structural genomics center for structural genomics, JCSG, protein structure INI PSI; 1.83A {Thermotoga maritima} SCOP: b.82.1.8 PDB: 1lkn_A 2k9z_A Back     alignment and structure
>2pyt_A Ethanolamine utilization protein EUTQ; structural genomics, joint center for structural genomics, J protein structure initiative; 1.90A {Salmonella typhimurium LT2} SCOP: b.82.1.24 Back     alignment and structure
>3myx_A Uncharacterized protein pspto_0244; protein of unknown function (DUF861), cupin_3 (PF05899), STR genomics; HET: MSE; 1.30A {Pseudomonas syringae PV} Back     alignment and structure
>4axo_A EUTQ, ethanolamine utilization protein; structural protein, bacterial microcompartment, BMC; 1.00A {Clostridium difficile} Back     alignment and structure
>3lwc_A Uncharacterized protein; structural genomics, unknown function, joint center for STRU genomics, JCSG, protein structure initiative; HET: MSE; 1.40A {Rhizobium leguminosarum} Back     alignment and structure
>2i45_A Hypothetical protein; neisseria meningitidis cupin domain, structural genomics, PS protein structure initiative; 2.50A {Neisseria meningitidis} Back     alignment and structure
>2oyz_A UPF0345 protein VPA0057; unknown function, structural genomi 2, protein structure initiative, midwest center for structu genomics, MCSG; 1.71A {Vibrio parahaemolyticus} SCOP: b.82.1.22 Back     alignment and structure
>2pfw_A Cupin 2, conserved barrel domain protein; cupin domain, struc genomics, joint center for structural genomics, JCSG; 1.90A {Shewanella frigidimarina} Back     alignment and structure
>3h8u_A Uncharacterized conserved protein with double-STR beta-helix domain; YP_001338853.1; HET: 2PE; 1.80A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1yhf_A Hypothetical protein SPY1581; structural genomics, conserved hypothetical protein, PSI, PR structure initiative; 2.00A {Streptococcus pyogenes} SCOP: b.82.1.9 Back     alignment and structure
>2o8q_A Hypothetical protein; cpuin-like fold, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.55A {Burkholderia xenovorans} Back     alignment and structure
>3d82_A Cupin 2, conserved barrel domain protein; structural genomics, joint center for structural genomics; 2.05A {Shewanella frigidimarina ncimb 400} Back     alignment and structure
>1vj2_A Novel manganese-containing cupin TM1459; structural genomics, joint for structural genomics, JCSG; 1.65A {Thermotoga maritima} SCOP: b.82.1.10 Back     alignment and structure
>2q30_A Uncharacterized protein; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: MSE; 1.94A {Desulfovibrio desulfuricans subsp} Back     alignment and structure
>3fjs_A Uncharacterized protein with RMLC-like cupin fold; structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.90A {Ralstonia eutropha JMP134} Back     alignment and structure
>2ozj_A Cupin 2, conserved barrel; cupin superfamily protein, struct genomics, joint center for structural genomics, JCSG; HET: MSE; 1.60A {Desulfitobacterium hafniense} Back     alignment and structure
>2opk_A Hypothetical protein; putative mannose-6-phosphate isomerase, structural genomics, center for structural genomics, JCSG; 2.10A {Ralstonia eutropha} Back     alignment and structure
>3l2h_A Putative sugar phosphate isomerase; AFE_0303, structural GEN joint center for structural genomics, JCSG; HET: MSE CXS; 1.85A {Acidithiobacillus ferrooxidans} Back     alignment and structure
>4e2g_A Cupin 2 conserved barrel domain protein; MCSG, PSI-biology, structural genomics, GEBA, midwest center structural genomics; HET: MSE; 1.86A {Sphaerobacter thermophilus} Back     alignment and structure
>1juh_A Quercetin 2,3-dioxygenase; cupin, glycoprotein, beta sandwich, oxidoreduct; HET: NAG BMA MAN; 1.60A {Aspergillus japonicus} SCOP: b.82.1.5 PDB: 1gqh_A* 1h1i_A* 1h1m_A* 1gqg_A* Back     alignment and structure
>1v70_A Probable antibiotics synthesis protein; structural genomics, thermus thermophilus HB8, riken structu genomics/proteomics initiative, RSGI; 1.30A {Thermus thermophilus} SCOP: b.82.1.9 PDB: 2dct_A Back     alignment and structure
>2fqp_A Hypothetical protein BP2299; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: 1PE; 1.80A {Bordetella pertussis tohama I} Back     alignment and structure
>3ht1_A REMF protein; cupin fold, Zn-binding, antibiotic biosynthesis, resistomycin, metalloprotein, cyclase, lyase; 1.20A {Streptomyces resistomycificus} PDB: 3ht2_A Back     alignment and structure
>3ibm_A Cupin 2, conserved barrel domain protein; cupin 2 family, metal-binding site, beta barrel, PSI-2, NYSG structural genomics; 2.00A {Halorhodospira halophila SL1} Back     alignment and structure
>1y9q_A Transcriptional regulator, HTH_3 family; transcriptional regulaator, strucutral genomics, protein structure initiative, PSI; 1.90A {Vibrio cholerae} SCOP: a.35.1.8 b.82.1.15 Back     alignment and structure
>1fi2_A Oxalate oxidase, germin; beta-jellyroll, oxidoreductase; 1.60A {Hordeum vulgare} SCOP: b.82.1.2 PDB: 2et1_A 2ete_A* 2et7_A Back     alignment and structure
>2gu9_A Tetracenomycin polyketide synthesis protein; X-RAY diffraction, cupin, immune system; 1.40A {Xanthomonas campestris} PDB: 2ilb_A 3h50_A Back     alignment and structure
>2arc_A ARAC, arabinose operon regulatory protein; transcription factor, carbohydrate binding, coiled-coil, jelly roll; HET: ARA; 1.50A {Escherichia coli} SCOP: b.82.4.1 PDB: 2aac_A* 1xja_A 2ara_A Back     alignment and structure
>1zvf_A 3-hydroxyanthranilate 3,4-dioxygenase; jellyroll beta-barrel, oxidoreductase; 2.41A {Saccharomyces cerevisiae} SCOP: b.82.1.20 Back     alignment and structure
>1yfu_A 3-hydroxyanthranilate-3,4-dioxygenase; cupin, oxidoreductase; 1.90A {Cupriavidus metallidurans} SCOP: b.82.1.20 PDB: 1yfw_A* 1yfx_A* 1yfy_A* Back     alignment and structure
>3kgz_A Cupin 2 conserved barrel domain protein; metalloprotein, structural genomics, PSI-2, protein structur initiative; 1.85A {Rhodopseudomonas palustris} Back     alignment and structure
>3i7d_A Sugar phosphate isomerase; YP_168127.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; 2.30A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>2bnm_A Epoxidase; oxidoreductase, cupin, HTH, cation-dependant, zinc, fosfomycin; 1.7A {Streptomyces wedmorensis} SCOP: a.35.1.3 b.82.1.10 PDB: 1zz7_A 1zz8_A 1zz9_A 1zzb_A 1zz6_A 1zzc_A 2bnn_A 2bno_A 3scf_A 3scg_A 3sch_A Back     alignment and structure
>2b8m_A Hypothetical protein MJ0764; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.70A {Methanocaldococcus jannaschii} SCOP: b.82.1.18 Back     alignment and structure
>1o4t_A Putative oxalate decarboxylase; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; 1.95A {Thermotoga maritima} SCOP: b.82.1.9 Back     alignment and structure
>1dgw_A Canavalin; duplicated swiss-roll beta barrels, loops with alpha helices merohedral/ hemihedral twinning, plant protein; 1.70A {Canavalia ensiformis} SCOP: b.82.1.2 PDB: 1dgr_A 1cau_A 1cav_A 1caw_A 1cax_A Back     alignment and structure
>3jzv_A Uncharacterized protein RRU_A2000; structural genomics, cupin-2 fold, unknown function, PSI-2, structure initiative; HET: MSE; 2.30A {Rhodospirillum rubrum} Back     alignment and structure
>2vpv_A Protein MIF2, MIF2P; nucleus, mitosis, centromere, cell cycle, DNA-binding, kinetochore, cell division, phosphoprotein, jelly-roll fold; 2.7A {Saccharomyces cerevisiae} Back     alignment and structure
>4e2q_A Ureidoglycine aminohydrolase; BI-cupin, manganese binding, endoplasmic RET hydrolase; 2.50A {Arabidopsis thaliana} PDB: 4e2s_A Back     alignment and structure
>3rns_A Cupin 2 conserved barrel domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 2.07A {Leptotrichia buccalis} Back     alignment and structure
>1sfn_A Conserved hypothetical protein; structural genomics, nysgxrc target T1583, PSI, protein STRU initiative; 2.46A {Deinococcus radiodurans} SCOP: b.82.1.11 Back     alignment and structure
>1lr5_A Auxin binding protein 1; beta jellyroll, double stranded beta helix, germin-like PROT protein binding; HET: NAG BMA MAN; 1.90A {Zea mays} SCOP: b.82.1.2 PDB: 1lrh_A* Back     alignment and structure
>4i4a_A Similar to unknown protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 1.35A {Photorhabdus luminescens subsp} Back     alignment and structure
>3rns_A Cupin 2 conserved barrel domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 2.07A {Leptotrichia buccalis} Back     alignment and structure
>4b29_A Dimethylsulfoniopropionate lyase; hydrolase, dimethylsulfide, sulphur cycle; 1.72A {Roseovarius nubinhibens ism} Back     alignment and structure
>3eo6_A Protein of unknown function (DUF1255); AFE_2634, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 0.97A {Acidithiobacillus ferrooxidans ATCC23270} Back     alignment and structure
>1rc6_A Hypothetical protein YLBA; structural genomics, NYSGXRC, SGX clone NAME 3174C1TCT3B1, T T1521, PSI, protein initiative; 2.60A {Escherichia coli} SCOP: b.82.1.11 Back     alignment and structure
>2f4p_A Hypothetical protein TM1010; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: UNL; 1.90A {Thermotoga maritima} SCOP: b.82.1.9 Back     alignment and structure
>1vr3_A Acireductone dioxygenase; 13543033, structural genomics, JOI for structural genomics, JCSG, protein structure initiative oxidoreductase; 2.06A {Mus musculus} SCOP: b.82.1.6 Back     alignment and structure
>3fz3_A Prunin; TREE NUT allergen, allergy, amandin, almond, 11S SEED storage protein, allergen; 2.40A {Prunus dulcis} PDB: 3ehk_A Back     alignment and structure
>1uij_A Beta subunit of beta conglycinin; double-stranded beta helix, SEED storage protein, sugar binding protein; 2.50A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ipk_A 1ipj_A* Back     alignment and structure
>1y3t_A Hypothetical protein YXAG; BI cupin, dioxygenase, oxidoreductase; 2.40A {Bacillus subtilis} SCOP: b.82.1.5 PDB: 2h0v_A* Back     alignment and structure
>3cew_A Uncharacterized cupin protein; all beta-protein, jelly-roll (cupin-2), structural genomics, protein structure initiative; 2.31A {Bacteroides fragilis} Back     alignment and structure
>1sef_A Conserved hypothetical protein; structural genomics, nysgxrc target T1582, PSI, protein STRU initiative; 2.05A {Enterococcus faecalis} SCOP: b.82.1.11 Back     alignment and structure
>3es1_A Cupin 2, conserved barrel domain protein; YP_001165807.1; HET: MSE; 1.91A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID} Back     alignment and structure
>2cav_A Protein (canavalin); vicilin, 7S SEED protein, domain duplication, swiss roll, PL protein; 2.00A {Canavalia ensiformis} SCOP: b.82.1.2 b.82.1.2 PDB: 2cau_A 1cau_B 1cav_B 1caw_B 1cax_B Back     alignment and structure
>2ea7_A 7S globulin-1; beta barrel, cupin superfamily, plant protein; 1.80A {Vigna angularis} PDB: 2eaa_A* 2cv6_A 1uik_A Back     alignment and structure
>1sq4_A GLXB, glyoxylate-induced protein; structural genomics, double beta barrel protein, PSI, protei structure initiative; 2.70A {Pseudomonas aeruginosa} SCOP: b.82.1.11 Back     alignment and structure
>2oa2_A BH2720 protein; 10175341, structural genomics, joint center for STRU genomics, JCSG, protein structure initiative, PSI-2, unknow function; HET: MSE; 1.41A {Bacillus halodurans} Back     alignment and structure
>1x82_A Glucose-6-phosphate isomerase; cupin superfamily, hyperthermophIle, phosphoglucose isomerase, extremeophIle; HET: PA5; 1.50A {Pyrococcus furiosus} SCOP: b.82.1.7 PDB: 1x7n_A* 1x8e_A 1qxr_A* 1qxj_A* 1qy4_A* 2gc1_A* 2gc0_A* 2gc2_A* 2gc3_A* 3sxw_A 1j3q_A 1j3p_A 1j3r_A* Back     alignment and structure
>3h7j_A Bacilysin biosynthesis protein BACB; YWFC, bacilysin synthesis, anticapsin synthesis, BI-Cu double stranded beta helix, antibiotic biosynthesis; HET: PPY; 1.87A {Bacillus subtilis} PDB: 3h7y_A* 3h9a_A* Back     alignment and structure
>4h7l_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, cupin, unknown function; 2.45A {Planctomyces limnophilus} Back     alignment and structure
>2vqa_A SLL1358 protein, MNCA; periplasmic binding protein, metal-binding protein, cupin, BI-cupin, oxalate decarboxylase; 2.95A {Synechocystis SP} Back     alignment and structure
>1rc6_A Hypothetical protein YLBA; structural genomics, NYSGXRC, SGX clone NAME 3174C1TCT3B1, T T1521, PSI, protein initiative; 2.60A {Escherichia coli} SCOP: b.82.1.11 Back     alignment and structure
>1y3t_A Hypothetical protein YXAG; BI cupin, dioxygenase, oxidoreductase; 2.40A {Bacillus subtilis} SCOP: b.82.1.5 PDB: 2h0v_A* Back     alignment and structure
>1fxz_A Glycinin G1; proglycinin, legumin, SEED storage protein, plant protein; 2.80A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ud1_A 1ucx_A Back     alignment and structure
>1j58_A YVRK protein; cupin, decarboxyklase, oxalate, manganese, formate, metal BI protein; 1.75A {Bacillus subtilis} SCOP: b.82.1.2 PDB: 1l3j_A 1uw8_A 2uyb_A 2uy9_A 2uy8_A 2v09_A 2uya_A 3s0m_A Back     alignment and structure
>3c3v_A Arachin ARAH3 isoform; peanut allergen, allergy, glycinin; 1.73A {Arachis hypogaea} Back     alignment and structure
>2e9q_A 11S globulin subunit beta; cucubitin, pumpkin SEED storage globulin, plant protein; 2.20A {Cucurbita maxima} PDB: 2evx_A Back     alignment and structure
>2qnk_A 3-hydroxyanthranilate 3,4-dioxygenase; bicupin fold, cupin barrel, extradiol dioxygenase, metalloen trytophan catabolism, NAD+ synthesis; HET: MSE; 1.60A {Homo sapiens} PDB: 3fe5_A Back     alignment and structure
>3h7j_A Bacilysin biosynthesis protein BACB; YWFC, bacilysin synthesis, anticapsin synthesis, BI-Cu double stranded beta helix, antibiotic biosynthesis; HET: PPY; 1.87A {Bacillus subtilis} PDB: 3h7y_A* 3h9a_A* Back     alignment and structure
>1zrr_A E-2/E-2' protein; nickel, cupin, beta helix, methionine salvage, oxidoreductase; NMR {Klebsiella oxytoca} SCOP: b.82.1.6 PDB: 2hji_A Back     alignment and structure
>1sef_A Conserved hypothetical protein; structural genomics, nysgxrc target T1582, PSI, protein STRU initiative; 2.05A {Enterococcus faecalis} SCOP: b.82.1.11 Back     alignment and structure
>1juh_A Quercetin 2,3-dioxygenase; cupin, glycoprotein, beta sandwich, oxidoreduct; HET: NAG BMA MAN; 1.60A {Aspergillus japonicus} SCOP: b.82.1.5 PDB: 1gqh_A* 1h1i_A* 1h1m_A* 1gqg_A* Back     alignment and structure
>2vqa_A SLL1358 protein, MNCA; periplasmic binding protein, metal-binding protein, cupin, BI-cupin, oxalate decarboxylase; 2.95A {Synechocystis SP} Back     alignment and structure
>3d0j_A Uncharacterized protein CA_C3497; beta-barrel, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.53A {Clostridium acetobutylicum atcc 824} Back     alignment and structure
>3ksc_A LEGA class, prolegumin; PEA prolegumin, 11S SEED storage protein, pisum sativum L., SEED storage protein, storage protein, plant protein; 2.61A {Pisum sativum} Back     alignment and structure
>2xlg_A SLL1785 protein, CUCA; metal binding protein, cupin; 1.80A {Synechocystis SP} PDB: 2xl7_A 2xl9_A 2xlf_A* 2xla_A Back     alignment and structure
>3kgl_A Cruciferin; 11S SEED globulin, rapeseed, SEED storage protein, storage protein, plant protein; 2.98A {Brassica napus} Back     alignment and structure
>3s7i_A Allergen ARA H 1, clone P41B; bicupin, vicilin, storage SEED protein; 2.35A {Arachis hypogaea} PDB: 3s7e_A 3smh_A Back     alignment and structure
>3qac_A 11S globulin SEED storage protein; 11S SEED storage protein (globulins) family, SEED storage PR plant protein; 2.27A {Amaranthus hypochondriacus} Back     alignment and structure
>3hqx_A UPF0345 protein aciad0356; DUF1255,PF06865,PSI2,MCSG, structural genomics, protein STRU initiative, midwest center for structural genomics; 1.66A {Acinetobacter SP} SCOP: b.82.1.0 Back     alignment and structure
>2d40_A Z3393, putative gentisate 1,2-dioxygenase; gentisic acid, bicupin, tetramer, montreal- bacterial structural genomics initiative, BSGI; 2.41A {Escherichia coli} SCOP: b.82.1.23 Back     alignment and structure
>3lag_A Uncharacterized protein RPA4178; functionally unknown protein, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.15A {Rhodopseudomonas palustris} Back     alignment and structure
>2phl_A Phaseolin; plant SEED storage protein(vicilin); HET: NAG; 2.20A {Phaseolus vulgaris} SCOP: b.82.1.2 b.82.1.2 PDB: 1phs_A* Back     alignment and structure
>1sfn_A Conserved hypothetical protein; structural genomics, nysgxrc target T1583, PSI, protein STRU initiative; 2.46A {Deinococcus radiodurans} SCOP: b.82.1.11 Back     alignment and structure
>1j58_A YVRK protein; cupin, decarboxyklase, oxalate, manganese, formate, metal BI protein; 1.75A {Bacillus subtilis} SCOP: b.82.1.2 PDB: 1l3j_A 1uw8_A 2uyb_A 2uy9_A 2uy8_A 2v09_A 2uya_A 3s0m_A Back     alignment and structure
>1uij_A Beta subunit of beta conglycinin; double-stranded beta helix, SEED storage protein, sugar binding protein; 2.50A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ipk_A 1ipj_A* Back     alignment and structure
>2d40_A Z3393, putative gentisate 1,2-dioxygenase; gentisic acid, bicupin, tetramer, montreal- bacterial structural genomics initiative, BSGI; 2.41A {Escherichia coli} SCOP: b.82.1.23 Back     alignment and structure
>2phl_A Phaseolin; plant SEED storage protein(vicilin); HET: NAG; 2.20A {Phaseolus vulgaris} SCOP: b.82.1.2 b.82.1.2 PDB: 1phs_A* Back     alignment and structure
>2e9q_A 11S globulin subunit beta; cucubitin, pumpkin SEED storage globulin, plant protein; 2.20A {Cucurbita maxima} PDB: 2evx_A Back     alignment and structure
>2ea7_A 7S globulin-1; beta barrel, cupin superfamily, plant protein; 1.80A {Vigna angularis} PDB: 2eaa_A* 2cv6_A 1uik_A Back     alignment and structure
>3bu7_A Gentisate 1,2-dioxygenase; cupin domain, oxidoreductase, plasmid; 2.80A {Silicibacter pomeroyi} SCOP: b.82.1.23 Back     alignment and structure
>3nw4_A Gentisate 1,2-dioxygenase; beta-barrel, oxidoreductase; HET: GTQ; 2.00A {Pseudaminobacter salicylatoxidans} PDB: 3nvc_A* 3nst_A* 3njz_A* 2phd_A* 3nkt_A* 3nl1_A* 4fag_A* 4fbf_A 4fah_A Back     alignment and structure
>1fxz_A Glycinin G1; proglycinin, legumin, SEED storage protein, plant protein; 2.80A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ud1_A 1ucx_A Back     alignment and structure
>2cav_A Protein (canavalin); vicilin, 7S SEED protein, domain duplication, swiss roll, PL protein; 2.00A {Canavalia ensiformis} SCOP: b.82.1.2 b.82.1.2 PDB: 2cau_A 1cau_B 1cav_B 1caw_B 1cax_B Back     alignment and structure
>2d5f_A Glycinin A3B4 subunit; soybean, globulin, 11S,SEED storage protein, plant; 1.90A {Glycine max} PDB: 2d5h_A 1od5_A Back     alignment and structure
>3qac_A 11S globulin SEED storage protein; 11S SEED storage protein (globulins) family, SEED storage PR plant protein; 2.27A {Amaranthus hypochondriacus} Back     alignment and structure
>1eyb_A Homogentisate 1,2-dioxygenase; jelly roll, beta sandwich, oxidoreductase; 1.90A {Homo sapiens} SCOP: b.82.1.4 PDB: 1ey2_A Back     alignment and structure
>3bu7_A Gentisate 1,2-dioxygenase; cupin domain, oxidoreductase, plasmid; 2.80A {Silicibacter pomeroyi} SCOP: b.82.1.23 Back     alignment and structure
>1sq4_A GLXB, glyoxylate-induced protein; structural genomics, double beta barrel protein, PSI, protei structure initiative; 2.70A {Pseudomonas aeruginosa} SCOP: b.82.1.11 Back     alignment and structure
>3ksc_A LEGA class, prolegumin; PEA prolegumin, 11S SEED storage protein, pisum sativum L., SEED storage protein, storage protein, plant protein; 2.61A {Pisum sativum} Back     alignment and structure
>2o1q_A Putative acetyl/propionyl-COA carboxylase, alpha; putative acetylacetone dioxygenase, structural genomics; HET: MSE PG4; 1.50A {Methylibium petroleiphilum} SCOP: b.82.1.21 Back     alignment and structure
>3gbg_A TCP pilus virulence regulatory protein; cupin, helix-turn-helix, ARAC family, activator, DNA-binding transcription, transcription regulation; HET: PAM; 1.90A {Vibrio cholerae} Back     alignment and structure
>3nw4_A Gentisate 1,2-dioxygenase; beta-barrel, oxidoreductase; HET: GTQ; 2.00A {Pseudaminobacter salicylatoxidans} PDB: 3nvc_A* 3nst_A* 3njz_A* 2phd_A* 3nkt_A* 3nl1_A* 4fag_A* 4fbf_A 4fah_A Back     alignment and structure
>4e2q_A Ureidoglycine aminohydrolase; BI-cupin, manganese binding, endoplasmic RET hydrolase; 2.50A {Arabidopsis thaliana} PDB: 4e2s_A Back     alignment and structure
>3s7i_A Allergen ARA H 1, clone P41B; bicupin, vicilin, storage SEED protein; 2.35A {Arachis hypogaea} PDB: 3s7e_A 3smh_A Back     alignment and structure
>3kgl_A Cruciferin; 11S SEED globulin, rapeseed, SEED storage protein, storage protein, plant protein; 2.98A {Brassica napus} Back     alignment and structure
>3c3v_A Arachin ARAH3 isoform; peanut allergen, allergy, glycinin; 1.73A {Arachis hypogaea} Back     alignment and structure
>2y0o_A Probable D-lyxose ketol-isomerase; carbohydrate metabolism, metal-binding, sugar ISO stress response; HET: MSE; 1.23A {Bacillus subtilis subsp} Back     alignment and structure
>2qnk_A 3-hydroxyanthranilate 3,4-dioxygenase; bicupin fold, cupin barrel, extradiol dioxygenase, metalloen trytophan catabolism, NAD+ synthesis; HET: MSE; 1.60A {Homo sapiens} PDB: 3fe5_A Back     alignment and structure
>3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A Back     alignment and structure
>3cjx_A Protein of unknown function with A cupin-like FOL; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 2.60A {Ralstonia eutropha} Back     alignment and structure
>1qwr_A Mannose-6-phosphate isomerase; structural genomics, D-mannose 6-phosphate, PSI, protein structure initiative; 1.80A {Bacillus subtilis} SCOP: b.82.1.3 Back     alignment and structure
>2wfp_A Mannose-6-phosphate isomerase; APO-structure, metal-binding; 1.67A {Salmonella typhimurium} PDB: 3h1w_A 3h1m_A 3h1y_A* Back     alignment and structure
>1pmi_A PMI, phosphomannose isomerase; aldose-ketose isomerase; 1.70A {Candida albicans} SCOP: b.82.1.3 Back     alignment and structure
>1zx5_A Mannosephosphate isomerase, putative; STRU genomics, PSI, protein structure initiative, midwest center structural genomics, MCSG; HET: LFR; 2.30A {Archaeoglobus fulgidus} SCOP: b.82.1.3 Back     alignment and structure
>3bpz_A Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2; CNBD, C-linker, pacemaker, HCN, HCN2, CAP, PKA, CAMP, ION channel; HET: CMP; 1.65A {Mus musculus} PDB: 3ffq_A 1q3e_A* 1q43_A* 1q5o_A* 3u10_A* 2q0a_A* 3etq_A* 3u11_A* 3otf_A* 3u0z_A* Back     alignment and structure
>3o14_A Anti-ecfsigma factor, CHRR; cupin, structural genomics, joint center for structura genomics, JCSG, protein structure initiative; HET: MSE; 1.70A {Marinobacter aquaeolei} Back     alignment and structure
>3ebr_A Uncharacterized RMLC-like cupin; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.60A {Ralstonia eutropha JMP134} Back     alignment and structure
>2d93_A RAP guanine nucleotide exchange factor 6; CNMP_binding domain, PDZ domain containing guanine nucleotide exchange factor 2, PDZ-GEF2, RA-GEF-2; NMR {Homo sapiens} Back     alignment and structure
>2vec_A YHAK, pirin-like protein YHAK; ROS, bicupin, sulfenic acid, reactive cysteine, cytosolic protein; 1.85A {Escherichia coli} Back     alignment and structure
>2vec_A YHAK, pirin-like protein YHAK; ROS, bicupin, sulfenic acid, reactive cysteine, cytosolic protein; 1.85A {Escherichia coli} Back     alignment and structure
>2ptm_A Hyperpolarization-activated (IH) channel; ION channel, cyclic nucleotide binding domain, C-linker, CAM SPHCN1, HCN; HET: CMP; 1.93A {Strongylocentrotus purpuratus} Back     alignment and structure
>3bal_A Acetylacetone-cleaving enzyme; jelly roll, tetramer, dioxygenase, iron, metal-binding, oxidoreductase; 1.95A {Acinetobacter johnsonii} Back     alignment and structure
>3fz3_A Prunin; TREE NUT allergen, allergy, amandin, almond, 11S SEED storage protein, allergen; 2.40A {Prunus dulcis} PDB: 3ehk_A Back     alignment and structure
>3ocp_A PRKG1 protein; serine/threonine kinase, TF2I and IRAG, transferase; HET: CMP; 2.49A {Homo sapiens} PDB: 3od0_A* 3ogj_A* Back     alignment and structure
>4gjz_A Lysine-specific demethylase 8; JMJC, beta barrel, Fe(II) and 2-oxoglutarate binding, oxidor; HET: AKG BME; 1.05A {Homo sapiens} PDB: 4gjy_A* 4aap_A* 3uyj_A* Back     alignment and structure
>4f8a_A Potassium voltage-gated channel subfamily H membe; probable regulatory domain of potassium channel, membrane PR transport protein; 2.20A {Mus musculus} Back     alignment and structure
>3pna_A CAMP-dependent protein kinase type I-alpha regula subunit; beta-barrel, CAMP-binding, catalytic subunit, transferase; HET: CMP; 1.50A {Bos taurus} PDB: 3fhi_B* 3iia_A 3plq_A* 1u7e_B* 3pvb_B* Back     alignment and structure
>3eqe_A Putative cystein deoxygenase; YUBC, SR112, NESG, structural genomics, PSI-2, protein structure initiative; 2.82A {Bacillus subtilis} Back     alignment and structure
>1tq5_A Protein YHHW; bicupin, pirin, montreal-kingston bacterial structural genomics initiative, BSGI, structural genomics, unknown function; 1.76A {Escherichia coli} SCOP: b.82.1.12 Back     alignment and structure
>2gm6_A Cysteine dioxygenase type I; structural genomics, J center for structural genomics, JCSG, protein structure INI PSI-2, oxidoreductase; 1.84A {Ralstonia eutropha} SCOP: b.82.1.19 Back     alignment and structure
>3of1_A CAMP-dependent protein kinase regulatory subunit; cyclic nucleotide binding domain, evolution, PKA signaling, transfer; HET: CMP; 2.21A {Saccharomyces cerevisiae} Back     alignment and structure
>3ukn_A Novel protein similar to vertebrate potassium VOL channel, subfamily H (EAG-related)...; KCNH, ELK, ERG, CNBD, CNBHD, C-linker, ION channel; 2.20A {Danio rerio} PDB: 3ukt_B 3ukv_B Back     alignment and structure
>2xdv_A MYC-induced nuclear antigen; ribosome biogenesis, nuclear protein; HET: OGA; 2.57A {Homo sapiens} Back     alignment and structure
>2qjv_A Uncharacterized IOLB-like protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MLY MSE; 1.90A {Salmonella typhimurium LT2} Back     alignment and structure
>1yud_A Hypothetical protein SO0799; SOR12, Q8E1N8, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.70A {Shewanella oneidensis} SCOP: b.82.1.16 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 143
d1o5ua_88 b.82.1.8 (A:) Hypothetical protein TM1112 {Thermot 6e-17
>d1o5ua_ b.82.1.8 (A:) Hypothetical protein TM1112 {Thermotoga maritima [TaxId: 2336]} Length = 88 Back     information, alignment and structure

class: All beta proteins
fold: Double-stranded beta-helix
superfamily: RmlC-like cupins
family: Hypothetical protein TM1112
domain: Hypothetical protein TM1112
species: Thermotoga maritima [TaxId: 2336]

 Score = 68.6 bits (168), Expect = 6e-17
 Identities = 25/73 (34%), Positives = 42/73 (57%), Gaps = 2/73 (2%)

Query: 50  VRVERQVSPERLKELDVSRWSMWKTGKCKLPWDWQVDQLVYIEEGEVRVVPEGSQRYMRF 109
           V++E+  +PE+LKEL V +W +W+    +  W +  ++  YI EG+V V  E  ++Y   
Sbjct: 2   VKIEK-PTPEKLKELSVEKWPIWEKEVSEFDWYYDTNETCYILEGKVEVTTEDGKKY-VI 59

Query: 110 LAGDLIRYPKWFE 122
             GDL+ +PK   
Sbjct: 60  EKGDLVTFPKGLR 72

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query143
d1o5ua_88 Hypothetical protein TM1112 {Thermotoga maritima [ 100.0
d2pyta1128 Ethanolamine utilization protein EutQ {Salmonella 99.58
d2b8ma1108 Hypothetical protein MJ0764 {Archaeon Methanococcu 98.27
d1vj2a_114 Hypothetical protein TM1459 {Thermotoga maritima [ 98.07
d1v70a_105 Hypothetical protein TTHA0104 {Thermus thermophilu 98.06
d1dgwa_178 Seed storage 7S protein {Jack bean (Canavalia ensi 98.05
d1uika1203 Seed storage 7S protein {Soybean (Glycine max), be 98.03
d1od5a2173 Seed storage 7S protein {Soybean (Glycine max), gl 98.0
d1uija1170 Seed storage 7S protein {Soybean (Glycine max), be 97.99
d1y9qa299 Probable transcriptional regulator VC1968, C-termi 97.96
d1juha_348 Quercetin 2,3-dioxygenase {Aspergillus japonicus [ 97.96
d1o4ta_115 Hypothetical protein TM1287 {Thermotoga maritima [ 97.96
d1yhfa1112 Hypothetical protein SPy1581 {Streptococcus pyogen 97.95
d2f4pa1134 Hypothetical protein TM1010 {Thermotoga maritima [ 97.92
g1dgw.1168 Seed storage 7S protein {Jack bean (Canavalia ensi 97.88
d1fxza2174 Seed storage 7S protein {Soybean (Glycine max), pr 97.86
d2bnma2122 Hydroxypropylphosphonic acid epoxidase Fom4, C-ter 97.79
d1uika2185 Seed storage 7S protein {Soybean (Glycine max), be 97.72
d1y3ta1330 Hypothetical protein YxaG {Bacillus subtilis [TaxI 97.72
d1juha_ 348 Quercetin 2,3-dioxygenase {Aspergillus japonicus [ 97.61
d1y3ta1 330 Hypothetical protein YxaG {Bacillus subtilis [TaxI 97.61
d1lr5a_160 Auxin binding protein {Maize (Zea mays) [TaxId: 45 97.6
d2phla2162 Seed storage 7S protein {French bean (Phaseolus vu 97.54
d1rc6a_253 Hypothetical protein YlbA {Escherichia coli [TaxId 97.52
d1sfna_ 245 Hypothetical protein DR1152 {Deinococcus radiodura 97.51
d1j58a_ 372 Oxalate decarboxylase OxdC (YvrK) {Bacillus subtil 97.5
d2phla1200 Seed storage 7S protein {French bean (Phaseolus vu 97.49
d2et1a1201 Germin {Barley (Hordeum vulgare) [TaxId: 4513]} 97.48
d1sefa_ 250 Hypothetical protein EF2996 {Enterococcus faecalis 97.47
d2oyza193 Uncharacterized protein VPA0057 {Vibrio parahaemol 97.43
d1j58a_372 Oxalate decarboxylase OxdC (YvrK) {Bacillus subtil 97.37
d1x82a_190 Glucose-6-phosphate isomerase, GPI {Archaeon Pyroc 97.27
d1sefa_250 Hypothetical protein EF2996 {Enterococcus faecalis 97.25
d2d40a1 308 Gentisate 1,2-dioxygenase {Escherichia coli [TaxId 97.18
d1rc6a_ 253 Hypothetical protein YlbA {Escherichia coli [TaxId 97.14
d1sq4a_ 273 Glyoxylate-induced protein PA1140 {Pseudomonas aer 97.06
d2arca_161 Regulatory protein AraC {Escherichia coli [TaxId: 97.04
d1eyba_ 439 Homogentisate dioxygenase {Human (Homo sapiens) [T 96.98
d1vr3a1179 Acireductone dioxygenase {Mouse (Mus musculus) [Ta 96.96
d1zrra1179 Acireductone dioxygenase {Klebsiella pneumoniae [T 96.96
d1sfna_245 Hypothetical protein DR1152 {Deinococcus radiodura 96.92
d2phda1 351 Gentisate 1,2-dioxygenase {Pseudaminobacter salicy 96.79
d1sq4a_273 Glyoxylate-induced protein PA1140 {Pseudomonas aer 96.55
d3bu7a1 355 Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [ 96.48
d2d40a1308 Gentisate 1,2-dioxygenase {Escherichia coli [TaxId 96.45
d3bu7a1355 Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [ 96.27
d2phda1351 Gentisate 1,2-dioxygenase {Pseudaminobacter salicy 95.97
d1fxza1239 Seed storage 7S protein {Soybean (Glycine max), pr 94.52
d1zvfa1175 3-hydroxyanthranilate-3,4-dioxygenase {Baker's yea 94.44
d1yfua1174 3-hydroxyanthranilate-3,4-dioxygenase {Ralstonia m 94.08
d2o1qa1144 Putative acetyl/propionyl-CoA carboxylase subunit 93.83
d1qwra_315 Mannose-6-phosphate isomerase ManA {Bacillus subti 93.61
d1pmia_440 Phosphomannose isomerase {Yeast (Candida albicans) 92.88
d1zx5a1299 Putative mannosephosphate isomerase AF0035 {Archae 91.75
d1od5a1245 Seed storage 7S protein {Soybean (Glycine max), gl 90.91
d1q3ea_193 HCN pacemaker channel {Mouse (Mus musculus) [TaxId 88.2
d2pa7a1135 dTDP-6-deoxy-3,4-keto-hexulose isomerase FdtA {Ane 86.63
d1ne6a1136 Regulatory subunit of Protein kinase A {Cow (Bos t 85.41
d1h2ka_335 Hypoxia-inducible factor HIF ihhibitor (FIH1) {Hum 83.04
d2zcwa2112 Transcriptional regulator TTHA1359, N-terminal dom 81.96
d1o7fa3124 Regulatory domain of Epac2, domains 1 and 3 {Mouse 80.79
>d1o5ua_ b.82.1.8 (A:) Hypothetical protein TM1112 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
class: All beta proteins
fold: Double-stranded beta-helix
superfamily: RmlC-like cupins
family: Hypothetical protein TM1112
domain: Hypothetical protein TM1112
species: Thermotoga maritima [TaxId: 2336]

Probab=100.00  E-value=2.5e-36  Score=212.46  Aligned_cols=87  Identities=30%  Similarity=0.691  Sum_probs=84.4

Q ss_pred             ceEEecCCCHHHHhhcCCCceeeeeecCceeeeeeccceEEEEEEeEEEEEeCCCeeeEEEcCCcEEEEcCCCEEEEEEe
Q 032303           49 NVRVERQVSPERLKELDVSRWSMWKTGKCKLPWDWQVDQLVYIEEGEVRVVPEGSQRYMRFLAGDLIRYPKWFEADLFFN  128 (143)
Q Consensus        49 ~I~ve~~ps~~rl~~lGv~~wgiWec~pg~f~~~y~~dE~~yILEG~V~vt~d~G~~~~e~~AGDlv~fPkG~~gtW~V~  128 (143)
                      +|+|++ |+++||.+||+.+||+|+|+||+|+|+|+.+|+||||||+++|+++||++ ++|+|||+|+||+|++|+|+|+
T Consensus         1 ~i~i~~-~~~~~l~~lGv~~~gvW~~~pg~f~~~y~~~E~~~ileG~v~i~~~~G~~-~~~~aGD~~~~p~G~~~~W~v~   78 (88)
T d1o5ua_           1 EVKIEK-PTPEKLKELSVEKWPIWEKEVSEFDWYYDTNETCYILEGKVEVTTEDGKK-YVIEKGDLVTFPKGLRCRWKVL   78 (88)
T ss_dssp             CCEEEC-CCHHHHHHHTGGGSCEEEECSEEEEEECSSCEEEEEEEEEEEEEETTCCE-EEEETTCEEEECTTCEEEEEEE
T ss_pred             CcEEec-CCHHHHHhcCCcccceEeecCcEEEEEcCccEEEEEEEeEEEEEcCCCCE-EEEeCCCEEEECCCCEEEEEEC
Confidence            488998 79999999999999999999999999999999999999999999999998 8999999999999999999999


Q ss_pred             cceEEEEEE
Q 032303          129 GPYQERYSF  137 (143)
Q Consensus       129 e~vrK~Y~~  137 (143)
                      +++||+|+|
T Consensus        79 e~v~K~yvi   87 (88)
T d1o5ua_          79 EPVRKHYNL   87 (88)
T ss_dssp             EEEEEEEEE
T ss_pred             ceEEEEEEe
Confidence            999999997
>d2pyta1 b.82.1.24 (A:100-227) Ethanolamine utilization protein EutQ {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2b8ma1 b.82.1.18 (A:1-108) Hypothetical protein MJ0764 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1vj2a_ b.82.1.10 (A:) Hypothetical protein TM1459 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1v70a_ b.82.1.9 (A:) Hypothetical protein TTHA0104 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1dgwa_ b.82.1.2 (A:) Seed storage 7S protein {Jack bean (Canavalia ensiformis), canavalin/vinculin [TaxId: 3823]} Back     information, alignment and structure
>d1uika1 b.82.1.2 (A:148-350) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]} Back     information, alignment and structure
>d1od5a2 b.82.1.2 (A:321-493) Seed storage 7S protein {Soybean (Glycine max), glycinin A3B4 [TaxId: 3847]} Back     information, alignment and structure
>d1uija1 b.82.1.2 (A:6-175) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin beta subunit [TaxId: 3847]} Back     information, alignment and structure
>d1y9qa2 b.82.1.15 (A:83-181) Probable transcriptional regulator VC1968, C-terminal domain {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1juha_ b.82.1.5 (A:) Quercetin 2,3-dioxygenase {Aspergillus japonicus [TaxId: 34381]} Back     information, alignment and structure
>d1o4ta_ b.82.1.9 (A:) Hypothetical protein TM1287 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yhfa1 b.82.1.9 (A:1-112) Hypothetical protein SPy1581 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2f4pa1 b.82.1.9 (A:2-135) Hypothetical protein TM1010 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1fxza2 b.82.1.2 (A:297-470) Seed storage 7S protein {Soybean (Glycine max), proglycinin [TaxId: 3847]} Back     information, alignment and structure
>d2bnma2 b.82.1.10 (A:77-198) Hydroxypropylphosphonic acid epoxidase Fom4, C-terminal domain {Streptomyces wedmorensis [TaxId: 43759]} Back     information, alignment and structure
>d1uika2 b.82.1.2 (A:351-535) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]} Back     information, alignment and structure
>d1y3ta1 b.82.1.5 (A:5-334) Hypothetical protein YxaG {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1juha_ b.82.1.5 (A:) Quercetin 2,3-dioxygenase {Aspergillus japonicus [TaxId: 34381]} Back     information, alignment and structure
>d1y3ta1 b.82.1.5 (A:5-334) Hypothetical protein YxaG {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1lr5a_ b.82.1.2 (A:) Auxin binding protein {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2phla2 b.82.1.2 (A:220-381) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]} Back     information, alignment and structure
>d1rc6a_ b.82.1.11 (A:) Hypothetical protein YlbA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sfna_ b.82.1.11 (A:) Hypothetical protein DR1152 {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1j58a_ b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2phla1 b.82.1.2 (A:11-210) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]} Back     information, alignment and structure
>d2et1a1 b.82.1.2 (A:1-201) Germin {Barley (Hordeum vulgare) [TaxId: 4513]} Back     information, alignment and structure
>d1sefa_ b.82.1.11 (A:) Hypothetical protein EF2996 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2oyza1 b.82.1.22 (A:2-94) Uncharacterized protein VPA0057 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1j58a_ b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1x82a_ b.82.1.7 (A:) Glucose-6-phosphate isomerase, GPI {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1sefa_ b.82.1.11 (A:) Hypothetical protein EF2996 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2d40a1 b.82.1.23 (A:35-342) Gentisate 1,2-dioxygenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rc6a_ b.82.1.11 (A:) Hypothetical protein YlbA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sq4a_ b.82.1.11 (A:) Glyoxylate-induced protein PA1140 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2arca_ b.82.4.1 (A:) Regulatory protein AraC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1eyba_ b.82.1.4 (A:) Homogentisate dioxygenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vr3a1 b.82.1.6 (A:1-179) Acireductone dioxygenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zrra1 b.82.1.6 (A:1-179) Acireductone dioxygenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1sfna_ b.82.1.11 (A:) Hypothetical protein DR1152 {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d2phda1 b.82.1.23 (A:17-367) Gentisate 1,2-dioxygenase {Pseudaminobacter salicylatoxidans [TaxId: 93369]} Back     information, alignment and structure
>d1sq4a_ b.82.1.11 (A:) Glyoxylate-induced protein PA1140 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d3bu7a1 b.82.1.23 (A:19-373) Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [TaxId: 89184]} Back     information, alignment and structure
>d2d40a1 b.82.1.23 (A:35-342) Gentisate 1,2-dioxygenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3bu7a1 b.82.1.23 (A:19-373) Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [TaxId: 89184]} Back     information, alignment and structure
>d2phda1 b.82.1.23 (A:17-367) Gentisate 1,2-dioxygenase {Pseudaminobacter salicylatoxidans [TaxId: 93369]} Back     information, alignment and structure
>d1fxza1 b.82.1.2 (A:10-248) Seed storage 7S protein {Soybean (Glycine max), proglycinin [TaxId: 3847]} Back     information, alignment and structure
>d1zvfa1 b.82.1.20 (A:1-175) 3-hydroxyanthranilate-3,4-dioxygenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yfua1 b.82.1.20 (A:1-174) 3-hydroxyanthranilate-3,4-dioxygenase {Ralstonia metallidurans [TaxId: 119219]} Back     information, alignment and structure
>d2o1qa1 b.82.1.21 (A:1-144) Putative acetyl/propionyl-CoA carboxylase subunit alpha Mpe_A3659 {Rubrivivax gelatinosus [TaxId: 28068]} Back     information, alignment and structure
>d1qwra_ b.82.1.3 (A:) Mannose-6-phosphate isomerase ManA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1pmia_ b.82.1.3 (A:) Phosphomannose isomerase {Yeast (Candida albicans) [TaxId: 5476]} Back     information, alignment and structure
>d1zx5a1 b.82.1.3 (A:1-299) Putative mannosephosphate isomerase AF0035 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1od5a1 b.82.1.2 (A:7-251) Seed storage 7S protein {Soybean (Glycine max), glycinin A3B4 [TaxId: 3847]} Back     information, alignment and structure
>d1q3ea_ b.82.3.2 (A:) HCN pacemaker channel {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2pa7a1 b.82.1.1 (A:2-136) dTDP-6-deoxy-3,4-keto-hexulose isomerase FdtA {Aneurinibacillus thermoaerophilus [TaxId: 143495]} Back     information, alignment and structure
>d1ne6a1 b.82.3.2 (A:109-244) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1h2ka_ b.82.2.6 (A:) Hypoxia-inducible factor HIF ihhibitor (FIH1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o7fa3 b.82.3.2 (A:322-445) Regulatory domain of Epac2, domains 1 and 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure