Citrus Sinensis ID: 032423

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-
MKEDIYTYWAPEENHSDWTLLINLQEPVSFNVLQVQEPIHMGQRISRFHLDILNEERKWKKVINGTTVGYQRLLQFPTVKSQQLRFVIDKSRAEPLISHLGIYMDKFSTVSSMSDSTSQTSLNGSHILQKSMSNHSEIAAI
cccccccEEEcccccccEEEEEEccccEEEEEEEEEccccccccEEEEEEEEEEccccEEEEEEEEEEccEEEEEcccEEEEEEEEEEEccccccEEcEEEEEcccccccccccccccEEEcccccEEEEEcccccccccc
cccccccEEEccccccEEEEEEEccccEEEEEEEEEEEcccccEEEEEEEEEEEccccEEEEccccEEcEEEEEEcccccccEEEEEEEccccccHHHEEEEEEcccccccccccccccccccccHHHEEcccccccEccc
mkediytywapeenhsdWTLLINlqepvsfnvlqvqepihmgqriSRFHLDILNEERKWKKVINgttvgyqrllqfptvksqqLRFVIDKSRAEPLISHLGIymdkfstvssmsdstsqtslngSHILQKSmsnhseiaai
MKEDIYTYWAPEENHSDWTLLINLQEPVSFNVLQVQEPIHMGQRISRFHLDILNEERKWKKVINGTTvgyqrllqfptvksqqlRFVIDKSRAEPLISHLGIYMDKFSTVSSMSDSTSQTSlngshilqksmsnhseiaai
MKEDIYTYWAPEENHSDWTLLINLQEPVSFNVLQVQEPIHMGQRISRFHLDILNEERKWKKVINGTTVGYQRLLQFPTVKSQQLRFVIDKSRAEPLISHLGIYMDKFstvssmsdstsqtsLNGSHILQKSMSNHSEIAAI
****IYTYWAPEENHSDWTLLINLQEPVSFNVLQVQEPIHMGQRISRFHLDILNEERKWKKVINGTTVGYQRLLQFPTVKSQQLRFVIDKSRAEPLISHLGIYMDKF**********************************
MKEDIYTYWAPEENHSDWTLLINLQEPVSFNVLQVQEPIHMGQRISRFHLDILNEERKWKKVINGTTVGYQRLLQFPTVKSQQLRFVIDKSRAEPLISHLGIYMDKFST********************************
MKEDIYTYWAPEENHSDWTLLINLQEPVSFNVLQVQEPIHMGQRISRFHLDILNEERKWKKVINGTTVGYQRLLQFPTVKSQQLRFVIDKSRAEPLISHLGIYMDKFST*************NGSHILQKSMSNHSEIAAI
****IYTYWAPEENHSDWTLLINLQEPVSFNVLQVQEPIHMGQRISRFHLDILNEERKWKKVINGTTVGYQRLLQFPTVKSQQLRFVIDKSRAEPLISHLGIYMDKFSTVSSMS***S******S***Q************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKEDIYTYWAPEENHSDWTLLINLQEPVSFNVLQVQEPIHMGQRISRFHLDILNEERKWKKVINGTTVGYQRLLQFPTVKSQQLRFVIDKSRAEPLISHLGIYMDKFSTVSSMSDSTSQTSLNGSHILQKSMSNHSEIAAI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query141 2.2.26 [Sep-21-2011]
Q7XUR3517 Putative alpha-L-fucosida yes no 0.900 0.245 0.460 1e-32
Q8GW72506 Alpha-L-fucosidase 1 OS=A yes no 0.787 0.219 0.522 6e-30
>sp|Q7XUR3|FUCO1_ORYSJ Putative alpha-L-fucosidase 1 OS=Oryza sativa subsp. japonica GN=Os04g0560400 PE=3 SV=2 Back     alignment and function desciption
 Score =  137 bits (346), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 59/128 (46%), Positives = 89/128 (69%), Gaps = 1/128 (0%)

Query: 1   MKEDIYTYWAPEENHSDWTLLINLQEPVSFNVLQVQEPIHMGQRISRFHLDILNEERKWK 60
           ++E IY+YWAPEE  S W +L +L +  SFNV+Q+QEPI MGQR+ +F ++IL +E  W+
Sbjct: 375 LQESIYSYWAPEEGQSSWEMLFDLGQSASFNVIQLQEPIQMGQRVIKFRVEILVDEL-WQ 433

Query: 61  KVINGTTVGYQRLLQFPTVKSQQLRFVIDKSRAEPLISHLGIYMDKFSTVSSMSDSTSQT 120
            ++ GTT+GY+RL QFP V+ Q L+  ID +RA+PLIS  G++ D FS   S+ +    +
Sbjct: 434 TIVEGTTIGYKRLFQFPVVEGQFLKLSIDGARADPLISFFGVFTDSFSVTYSLENHEKPS 493

Query: 121 SLNGSHIL 128
            +N S ++
Sbjct: 494 VVNSSEVI 501
Alpha-L-fucosidase is responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Active only against 2'-fucosyl-lactitol when heterologously expressed.
Oryza sativa subsp. japonica (taxid: 39947)
EC: 3EC: .EC: 2EC: .EC: 1EC: .EC: 5EC: 1
>sp|Q8GW72|FUCO1_ARATH Alpha-L-fucosidase 1 OS=Arabidopsis thaliana GN=FUC1 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query141
225436498 545 PREDICTED: alpha-L-fucosidase 1 [Vitis v 1.0 0.258 0.542 1e-45
224104699 457 predicted protein [Populus trichocarpa] 0.765 0.236 0.777 3e-44
357453973 537 Alpha-L-fucosidase [Medicago truncatula] 1.0 0.262 0.598 7e-44
449456042 534 PREDICTED: alpha-L-fucosidase 1-like [Cu 0.978 0.258 0.588 7e-42
255565425 562 alpha-l-fucosidase, putative [Ricinus co 0.936 0.234 0.641 8e-42
356547157 535 PREDICTED: alpha-L-fucosidase 1-like [Gl 0.950 0.250 0.582 4e-41
449496185 534 PREDICTED: LOW QUALITY PROTEIN: alpha-L- 0.978 0.258 0.574 5e-40
297734923 406 unnamed protein product [Vitis vinifera] 0.702 0.243 0.707 1e-37
356541946 541 PREDICTED: LOW QUALITY PROTEIN: alpha-L- 0.971 0.253 0.507 1e-33
116311131 517 B0103C08-B0602B01.14 [Oryza sativa Indic 0.900 0.245 0.468 2e-31
>gi|225436498|ref|XP_002276131.1| PREDICTED: alpha-L-fucosidase 1 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  187 bits (475), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 89/164 (54%), Positives = 119/164 (72%), Gaps = 23/164 (14%)

Query: 1   MKEDIYTYWAPEENHSDWTLLINLQEPVSFNVLQVQEPIHMGQRISRFHLDILNEERKWK 60
           ++E IYTYWAPEE+ SDW L  + +E VSFNVLQVQEPIHMGQR+S FHLDIL+E+R WK
Sbjct: 382 LEEGIYTYWAPEEDQSDWVLYFDFEEFVSFNVLQVQEPIHMGQRVSEFHLDILDEKRDWK 441

Query: 61  KVINGTTVGYQRLLQFPTVKSQQLRFVIDKSRAEPLISHLGIYMDKFSTVSSMSDST--- 117
           ++I+GTTVGY+RLL+FP V++Q LRFV+D+SRA+PLIS+LGI+MD FS +S++SD++   
Sbjct: 442 RLISGTTVGYKRLLRFPKVETQGLRFVVDRSRADPLISYLGIHMDPFSILSNISDTSLSS 501

Query: 118 --------------------SQTSLNGSHILQKSMSNHSEIAAI 141
                               S   LNGS  L++   NHS+++ I
Sbjct: 502 QPYVNGSQPYPNGSQAHFNASHAHLNGSQFLRQISPNHSQVSTI 545

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224104699|ref|XP_002313533.1| predicted protein [Populus trichocarpa] gi|222849941|gb|EEE87488.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357453973|ref|XP_003597267.1| Alpha-L-fucosidase [Medicago truncatula] gi|355486315|gb|AES67518.1| Alpha-L-fucosidase [Medicago truncatula] Back     alignment and taxonomy information
>gi|449456042|ref|XP_004145759.1| PREDICTED: alpha-L-fucosidase 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|255565425|ref|XP_002523703.1| alpha-l-fucosidase, putative [Ricinus communis] gi|223537007|gb|EEF38643.1| alpha-l-fucosidase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356547157|ref|XP_003541983.1| PREDICTED: alpha-L-fucosidase 1-like [Glycine max] Back     alignment and taxonomy information
>gi|449496185|ref|XP_004160066.1| PREDICTED: LOW QUALITY PROTEIN: alpha-L-fucosidase 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|297734923|emb|CBI17157.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356541946|ref|XP_003539433.1| PREDICTED: LOW QUALITY PROTEIN: alpha-L-fucosidase 1-like [Glycine max] Back     alignment and taxonomy information
>gi|116311131|emb|CAH68057.1| B0103C08-B0602B01.14 [Oryza sativa Indica Group] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query141
TAIR|locus:2046173506 FUC1 "alpha-L-fucosidase 1" [A 0.758 0.211 0.522 3.3e-28
TAIR|locus:2046173 FUC1 "alpha-L-fucosidase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 318 (117.0 bits), Expect = 3.3e-28, P = 3.3e-28
 Identities = 57/109 (52%), Positives = 85/109 (77%)

Query:     1 MKEDIYTYWAPEENHSDWTLLINLQEPVSFNVLQVQEPIHMGQRISRFHLDILNE-ERKW 59
             ++E +  YWAPEEN ++W L +  ++ VSFNVL+++EPIHMGQRI+ FHL+       +W
Sbjct:   373 LEEGLDKYWAPEENQNEWVLYLEFKDLVSFNVLEIREPIHMGQRIASFHLETRKTGSGEW 432

Query:    60 KKVINGTTVGYQRLLQF-PTVKSQQLRFVIDKSRAEPLISHLGIYMDKF 107
             ++V++GTTVG +RLL+F   V+S+ L+ V+DK+R +PLIS+LG+YMDKF
Sbjct:   433 ERVVSGTTVGNKRLLRFLNVVESRSLKLVVDKARTDPLISYLGLYMDKF 481


Parameters:
  V=100
  filter=SEG
  E=0.001

  ctxfactor=1.00

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   +0      0   BLOSUM62        0.320   0.135   0.402    same    same    same
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a

  Query
  Frame  MatID  Length  Eff.Length     E     S W   T  X   E2     S2
   +0      0      141       127   0.00091  102 3  11 22  0.37    31
                                                     29  0.40    33


Statistics:

  Database:  /share/blast/go-seqdb.fasta
   Title:  go_20130330-seqdb.fasta
   Posted:  5:47:42 AM PDT Apr 1, 2013
   Created:  5:47:42 AM PDT Apr 1, 2013
   Format:  XDF-1
   # of letters in database:  169,044,731
   # of sequences in database:  368,745
   # of database sequences satisfying E:  1
  No. of states in DFA:  564 (60 KB)
  Total size of DFA:  137 KB (2086 KB)
  Time to generate neighborhood:  0.00u 0.00s 0.00t   Elapsed:  00:00:00
  No. of threads or processors used:  24
  Search cpu time:  11.46u 0.10s 11.56t   Elapsed:  00:00:01
  Total cpu time:  11.46u 0.10s 11.56t   Elapsed:  00:00:01
  Start:  Sat May 11 04:59:50 2013   End:  Sat May 11 04:59:51 2013
GO:0003824 "catalytic activity" evidence=IEA
GO:0004560 "alpha-L-fucosidase activity" evidence=IEA;ISS;IDA
GO:0005576 "extracellular region" evidence=ISM
GO:0005975 "carbohydrate metabolic process" evidence=IEA
GO:0043169 "cation binding" evidence=IEA
GO:0005773 "vacuole" evidence=IDA
GO:0006516 "glycoprotein catabolic process" evidence=TAS

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query141
COG3669430 COG3669, COG3669, Alpha-L-fucosidase [Carbohydrate 0.001
>gnl|CDD|226195 COG3669, COG3669, Alpha-L-fucosidase [Carbohydrate transport and metabolism] Back     alignment and domain information 
 Score = 37.2 bits (86), Expect = 0.001
 Identities = 25/97 (25%), Positives = 45/97 (46%), Gaps = 4/97 (4%)

Query: 7   TYWAPEENHSDWTLLINLQEPVSFNVLQVQEPIHMGQRISRFHLDILNEERKWKKVINGT 66
             +   +      L +    P +F+V  + E + +GQRI+ + +       + ++V +G 
Sbjct: 338 GSFTASDADPFIQLDLRFTTPKTFDVALLMEWLTLGQRIAAYSV----TVEQDQRVGSGH 393

Query: 67  TVGYQRLLQFPTVKSQQLRFVIDKSRAEPLISHLGIY 103
           T+GY+RLL      + +LR  I  S    LI   G+Y
Sbjct: 394 TIGYKRLLHGAVATAPKLRLEIPSSAPALLIREPGLY 430

Length = 430

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 141
cd00057143 FA58C Substituted updates: Jan 31, 2002 99.74
PF00754129 F5_F8_type_C: F5/8 type C domain; InterPro: IPR000 99.55
smart00231139 FA58C Coagulation factor 5/8 C-terminal domain, di 99.19
COG3669430 Alpha-L-fucosidase [Carbohydrate transport and met 98.56
smart00607151 FTP eel-Fucolectin Tachylectin-4 Pentaxrin-1 Domai 98.17
PF07738135 Sad1_UNC: Sad1 / UNC-like C-terminal ; InterPro: I 97.96
cd08366139 APC10 APC10 subunit of the anaphase-promoting comp 97.66
cd08159129 APC10-like APC10-like DOC1 domains in E3 ubiquitin 97.62
KOG3516 1306 consensus Neurexin IV [Signal transduction mechani 97.18
cd08667131 APC10-ZZEF1 APC10/DOC1-like domain of uncharacteri 97.09
PF03256193 APC10: Anaphase-promoting complex, subunit 10 (APC 96.94
cd08365131 APC10-like1 APC10-like DOC1 domains of E3 ubiquiti 96.86
KOG3437184 consensus Anaphase-promoting complex (APC), subuni 96.7
cd08665131 APC10-CUL7 APC10-like DOC1 domain of CUL7, subunit 96.67
cd08666134 APC10-HECTD3 APC10-like DOC1 domain of HECTD3, a H 96.12
cd08664152 APC10-HERC2 APC10-like DOC1 domain present in HERC 95.93
PF13163 429 DUF3999: Protein of unknown function (DUF3999) 95.79
PF00055237 Laminin_N: Laminin N-terminal (Domain VI); InterPr 95.06
KOG4276113 consensus Predicted hormone receptor interactor [G 93.85
smart00136238 LamNT Laminin N-terminal domain (domain VI). N-ter 92.88
PF13163429 DUF3999: Protein of unknown function (DUF3999) 90.25
COG5156189 DOC1 Anaphase-promoting complex (APC), subunit 10 90.2
KOG1094 807 consensus Discoidin domain receptor DDR1 [Signal t 90.01
KOG2687414 consensus Spindle pole body protein, contains UNC- 89.62
PF06588199 Muskelin_N: Muskelin N-terminus; InterPro: IPR0105 89.61
PF07461 446 NADase_NGA: Nicotine adenine dinucleotide glycohyd 89.6
KOG4350 620 consensus Uncharacterized conserved protein, conta 89.43
PF03561152 Allantoicase: Allantoicase repeat; InterPro: IPR01 87.54
KOG4350620 consensus Uncharacterized conserved protein, conta 83.49
>cd00057 FA58C Substituted updates: Jan 31, 2002 Back     alignment and domain information 
Probab=99.74  E-value=9.1e-17  Score=116.51  Aligned_cols=100  Identities=14%  Similarity=0.258  Sum_probs=86.9

Q ss_pred             CCCcceEEecCCCCCCeEEEEEcCCCeEEeEEEEEcccC--CCceEEEEEEEEEeCCC-cEEEEEec----eeee-----
Q 032423            2 KEDIYTYWAPEENHSDWTLLINLQEPVSFNVLQVQEPIH--MGQRISRFHLDILNEER-KWKKVING----TTVG-----   69 (141)
Q Consensus         2 Dg~~~T~Wa~~~~~~~~~leldL~~~~~fn~V~l~E~i~--~gqrI~~f~Ie~~~~dG-~W~~ia~G----ttIG-----   69 (141)
                      |+|..|+|.+..++..+||+|||+++..|+.|+|+....  .++++++|+|++.+ || .|+.+.+.    ...|     
T Consensus        30 dg~~~t~W~~~~~~~~~wi~vDL~~~~~i~~v~i~~~~~~~~~~~~~~~~i~~s~-dg~~W~~~~~~~~~~~~~~~~~~~  108 (143)
T cd00057          30 RLNSDNAWTPAVNDPPQWLQVDLGKTRRVTGIQTQGRKGGGSSEWVTSYKVQYSL-DGETWTTYKDKGEEKVFTGNSDGS  108 (143)
T ss_pred             ecCCCCcccCCCCCCCceEEEECCCCEEEEEEEEccCCCCCccCeeEEEEEEEEC-CCCCEeEEEcCCcEEEEeCCcCCC
Confidence            889999999987677899999999999999999998765  58899999999999 88 69998862    1222     


Q ss_pred             eEEEEEcC-CeeeeEEEEEEEccCCCceecEEEEE
Q 032423           70 YQRLLQFP-TVKSQQLRFVIDKSRAEPLISHLGIY  103 (141)
Q Consensus        70 ~kri~~f~-~Vta~~vRl~i~~s~~~P~I~ef~vY  103 (141)
                      ..+.+.|+ |+.|++|||.+++..+.++| ||+||
T Consensus       109 ~~~~~~l~~pv~aRyvRl~~~~~~~~~~l-e~evy  142 (143)
T cd00057         109 TPVTNDFPPPIVARYIRILPTTWNGNISL-RLELY  142 (143)
T ss_pred             eEEEEeCCCCEEEEEEEEEEeecCCccEE-EEEEc
Confidence            45678888 69999999999988888999 99998

>PF00754 F5_F8_type_C: F5/8 type C domain; InterPro: IPR000421 Blood coagulation factors V and VIII contain a C-terminal, twice repeated, domain of about 150 amino acids, which is called F5/8 type C, FA58C, or C1/C2- like domain Back     alignment and domain information
>smart00231 FA58C Coagulation factor 5/8 C-terminal domain, discoidin domain Back     alignment and domain information
>COG3669 Alpha-L-fucosidase [Carbohydrate transport and metabolism] Back     alignment and domain information
>smart00607 FTP eel-Fucolectin Tachylectin-4 Pentaxrin-1 Domain Back     alignment and domain information
>PF07738 Sad1_UNC: Sad1 / UNC-like C-terminal ; InterPro: IPR012919 The Caenorhabditis elegans UNC-84 protein is a nuclear envelope protein that is involved in nuclear anchoring and migration during development Back     alignment and domain information
>cd08366 APC10 APC10 subunit of the anaphase-promoting complex (APC) that mediates substrate ubiquitination Back     alignment and domain information
>cd08159 APC10-like APC10-like DOC1 domains in E3 ubiquitin ligases that mediate substrate ubiquitination Back     alignment and domain information
>KOG3516 consensus Neurexin IV [Signal transduction mechanisms] Back     alignment and domain information
>cd08667 APC10-ZZEF1 APC10/DOC1-like domain of uncharacterized Zinc finger ZZ-type and EF-hand domain-containing protein 1 (ZZEF1) and homologs Back     alignment and domain information
>PF03256 APC10: Anaphase-promoting complex, subunit 10 (APC10); InterPro: IPR004939 The anaphase-promoting complex (APC) or cyclosome is a multi-subunit E3 protein ubiquitin ligase that regulates important events in mitosis such as the initiation of anaphase and exit from telophase Back     alignment and domain information
>cd08365 APC10-like1 APC10-like DOC1 domains of E3 ubiquitin ligases that mediate substrate ubiquitination Back     alignment and domain information
>KOG3437 consensus Anaphase-promoting complex (APC), subunit 10 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd08665 APC10-CUL7 APC10-like DOC1 domain of CUL7, subunit of the SCF-ROC1-like E3 ubiquitin ligase complex that mediates substrate ubiquitination Back     alignment and domain information
>cd08666 APC10-HECTD3 APC10-like DOC1 domain of HECTD3, a HECT E3 ubiquitin ligase protein that mediates substrate ubiquitination Back     alignment and domain information
>cd08664 APC10-HERC2 APC10-like DOC1 domain present in HERC2 (HECT domain and RLD2) Back     alignment and domain information
>PF13163 DUF3999: Protein of unknown function (DUF3999) Back     alignment and domain information
>PF00055 Laminin_N: Laminin N-terminal (Domain VI); InterPro: IPR008211 Laminin is a large molecular weight glycoprotein present only in basement membranes in almost every animal tissue Back     alignment and domain information
>KOG4276 consensus Predicted hormone receptor interactor [General function prediction only] Back     alignment and domain information
>smart00136 LamNT Laminin N-terminal domain (domain VI) Back     alignment and domain information
>PF13163 DUF3999: Protein of unknown function (DUF3999) Back     alignment and domain information
>COG5156 DOC1 Anaphase-promoting complex (APC), subunit 10 [Cell division and chromosome partitioning / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1094 consensus Discoidin domain receptor DDR1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG2687 consensus Spindle pole body protein, contains UNC-84 domain [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF06588 Muskelin_N: Muskelin N-terminus; InterPro: IPR010565 This entry represents the N-terminal region of muskelin and is found in conjunction with several IPR006652 from INTERPRO repeats Back     alignment and domain information
>PF07461 NADase_NGA: Nicotine adenine dinucleotide glycohydrolase (NADase); InterPro: IPR010900 This family consists of several bacterial nicotine adenine dinucleotide glycohydrolase (NGA) proteins which appear to be specific to Streptococcus pyogenes Back     alignment and domain information
>KOG4350 consensus Uncharacterized conserved protein, contains BTB/POZ domain [General function prediction only] Back     alignment and domain information
>PF03561 Allantoicase: Allantoicase repeat; InterPro: IPR015908 Allantoicase (also known as allantoate amidinohydrolase) is involved in purine degradation, facilitating the utilization of purines as secondary nitrogen sources under nitrogen-limiting conditions Back     alignment and domain information
>KOG4350 consensus Uncharacterized conserved protein, contains BTB/POZ domain [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query141
3uet_A478 Crystal Structure Of Alpha-1,34-Fucosidase From Bif 2e-08
3ues_A478 Crystal Structure Of Alpha-1,34-Fucosidase From Bif 2e-08
3mo4_A480 The Crystal Structure Of An Alpha-(1-3,4)-Fucosidas 6e-08
3eyp_A469 Crystal Structure Of Putative Alpha-L-Fucosidase Fr 5e-07
3gza_A443 Crystal Structure Of Putative Alpha-L-Fucosidase (N 5e-06
>pdb|3UET|A Chain A, Crystal Structure Of Alpha-1,34-Fucosidase From Bifidobacterium Longum Subsp. Infantis D172aE217A MUTANT COMPLEXED WITH LACTO-N- Fucopentaose Ii Length = 478 Back     alignment and structure 
Iteration: 1

 Score = 54.3 bits (129), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 26/92 (28%), Positives = 48/92 (52%)
Query: 7   TYWAPEENHSDWTLLINLQEPVSFNVLQVQEPIHMGQRISRFHLDILNEERKWKKVINGT 66
           T+W P+ + +   + + L +P + N + ++E I  GQRI    +     +   + +    
Sbjct: 380 TFWRPDADDAAPAITLTLPQPTTINAIVIEEAIEHGQRIEHLRVTGALPDGTERVLGQAG 439
Query: 67  TVGYQRLLQFPTVKSQQLRFVIDKSRAEPLIS 98
           TVGY+R+L+F  V+   +   +D SR  P+IS
Sbjct: 440 TVGYRRILRFDDVEVSSVTLHVDGSRLAPMIS 471
>pdb|3UES|A Chain A, Crystal Structure Of Alpha-1,34-Fucosidase From Bifidobacterium Longum Subsp. Infantis Complexed With Deoxyfuconojirimycin Length = 478 Back     alignment and structure
>pdb|3MO4|A Chain A, The Crystal Structure Of An Alpha-(1-3,4)-Fucosidase From Bifidobacterium Longum Subsp. Infantis Atcc 15697 Length = 480 Back     alignment and structure
>pdb|3EYP|A Chain A, Crystal Structure Of Putative Alpha-L-Fucosidase From Bacteroides Thetaiotaomicron Length = 469 Back     alignment and structure
>pdb|3GZA|A Chain A, Crystal Structure Of Putative Alpha-L-Fucosidase (Np_812709.1) From Bacteroides Thetaiotaomicron Vpi-5482 At 1.60 A Resolution Length = 443 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query141
3ues_A478 Alpha-1,3/4-fucosidase; TIM barrel, hydrolase-hydr 1e-38
3eyp_A469 Putative alpha-L-fucosidase; structural genomics, 2e-36
3gza_A443 Putative alpha-L-fucosidase; NP_812709.1, structur 2e-27
>3ues_A Alpha-1,3/4-fucosidase; TIM barrel, hydrolase-hydrolase inhibitor complex; HET: DFU; 1.60A {Bifidobacterium longum subsp} PDB: 3mo4_A* 3uet_A* Length = 478 Back     alignment and structure
 Score =  135 bits (340), Expect = 1e-38
 Identities = 26/103 (25%), Positives = 50/103 (48%)

Query: 1   MKEDIYTYWAPEENHSDWTLLINLQEPVSFNVLQVQEPIHMGQRISRFHLDILNEERKWK 60
           +  +  T+W P+ + +   + + L +P + N + ++E I  GQRI    +     +   +
Sbjct: 374 VDGNRDTFWRPDADDAAPAITLTLPQPTTINAIVIEEAIEHGQRIEHLRVTGALPDGTER 433

Query: 61  KVINGTTVGYQRLLQFPTVKSQQLRFVIDKSRAEPLISHLGIY 103
            +    TVGY+R+L+F  V+   +   +D SR  P+IS     
Sbjct: 434 VLGQAGTVGYRRILRFDDVEVSSVTLHVDGSRLAPMISRAAAV 476
>3eyp_A Putative alpha-L-fucosidase; structural genomics, hydrolase, lipoprotein, PSI-2, protein initiative; 1.90A {Bacteroides thetaiotaomicron} Length = 469 Back     alignment and structure
>3gza_A Putative alpha-L-fucosidase; NP_812709.1, structural genomic center for structural genomics, JCSG; HET: MSE EPE; 1.60A {Bacteroides thetaiotaomicron vpi-5482} Length = 443 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query141
3ues_A478 Alpha-1,3/4-fucosidase; TIM barrel, hydrolase-hydr 99.96
3eyp_A469 Putative alpha-L-fucosidase; structural genomics, 99.95
3gza_A443 Putative alpha-L-fucosidase; NP_812709.1, structur 99.94
4a3z_A161 GH89_CBM32, alpha-N-acetylglucosaminidase family p 99.81
3lei_A153 Platelet aggregation factor SM-HPAF; lectin domain 99.75
4a42_A149 GH89_CBM32-4, alpha-N-acetylglucosaminidase family 99.74
3f2z_A159 Uncharacterized protein BF3579; the present C-term 99.74
4a41_A161 GH89_CBM32-5, alpha-N-acetylglucosaminidase family 99.74
2j1a_A150 Hyaluronidase, CBM32; protein-carbohydrate interac 99.73
2jda_A145 Yecbm32; hypothetical protein, carbohydrate- bindi 99.72
1tvg_A153 LOC51668 protein; cell cycle, structural genomics, 99.71
3ggl_A169 Putative chitobiase; X-RAY, structure genomics, NE 99.71
2v72_A143 CBM32, EXO-alpha-sialidase; galactose, bacterial p 99.7
4gwi_A153 Lectinolysin, platelet aggregation factor SM-HPAF; 99.65
2yc2_A139 IFT25, intraflagellar transport protein 25; transp 99.64
4a4a_A 914 Alpha-N-acetylglucosaminidase family protein; hydr 99.6
2j1v_A151 Fucolectin-related protein; carbohydrate-binding p 99.6
3cqo_A293 FBP32; F-lectin, fucolectin, sugar binding protein 99.5
3bn6_A158 Lactadherin; anticoagulation, anti-coagulation, an 99.49
2v5d_A737 O-GLCNACASE NAGJ; family 32 carbohydrate binding m 99.48
1w8o_A601 Bacterial sialidase; 3D-structure, glycosidase, hy 99.48
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 99.44
2j22_A148 Fucolectin-related protein; carbohydrate-binding p 99.44
3cqo_A 293 FBP32; F-lectin, fucolectin, sugar binding protein 99.42
2qqi_A 318 Neuropilin-1; VEGF receptor, semaphorin receptor, 99.41
1k12_A158 Lectin; beta barrel, protein carbohydrate complex, 99.4
3hnm_A172 Putative chitobiase; PSI-2, protein structure init 99.37
2w1s_A192 Hyaluronoglucosaminidase; hexosaminidase, family 3 99.36
1czt_A160 Protein (coagulation factor V); membrane-binding, 99.29
2vm9_A257 Discoidin-2, discoidin II; DDR, lectin, aggregatio 99.22
4deq_A218 Neuropilin-1, vascular endothelial growth factor; 99.21
2qqj_A 325 Neuropilin-2; VEGF receptor, semaphorin receptor, 99.18
2qqm_A 450 Neuropilin-1; VEGF receptor, semaphorin receptor, 99.17
3hny_M159 Coagulation factor VIII; blood clotting, acute pha 99.13
1sdd_B 647 Coagulation factor V; copper-binding protein, cofa 99.09
2wuh_A178 Discoidin domain receptor 2; receptor-peptide comp 99.07
2qqi_A318 Neuropilin-1; VEGF receptor, semaphorin receptor, 99.06
2qqm_A450 Neuropilin-1; VEGF receptor, semaphorin receptor, 99.03
2qqj_A325 Neuropilin-2; VEGF receptor, semaphorin receptor, 99.02
2zxq_A1376 Endo-alpha-N-acetylgalactosaminidase; broken TIM b 98.99
2qqo_A460 Neuropilin-2; VEGF receptor, semaphorin receptor, 98.85
2yfu_A155 Carbohydrate binding family 6; sugar binding prote 98.8
2qqk_A 579 Neuropilin-2; VEGF receptor, semaphorin receptor, 98.77
2qqk_A579 Neuropilin-2; VEGF receptor, semaphorin receptor, 98.77
2r7e_B 770 Coagulation factor VIII; ceruloplasmin fold, cuppe 98.72
2qqo_A 460 Neuropilin-2; VEGF receptor, semaphorin receptor, 98.71
1sdd_B647 Coagulation factor V; copper-binding protein, cofa 98.68
2cho_A716 Glucosaminidase, hexosaminiase; O-GLCNACASE, hydro 98.66
4gz9_A577 Neuropilin-1, A5 protein; multi-domain, cell-CELL 98.65
4gz9_A 577 Neuropilin-1, A5 protein; multi-domain, cell-CELL 98.62
2wn3_A254 Discoidin-1 subunit A; type-H lectin, cell adhesio 98.56
4ag4_A 351 Epithelial discoidin domain-containing receptor 1; 98.55
2r7e_B770 Coagulation factor VIII; ceruloplasmin fold, cuppe 98.41
3gdb_A937 Endo-D, putative uncharacterized protein SPR0440; 98.31
1jhj_A171 APC10; beta sandwich, jellyroll, cell cycle; 1.60A 97.82
4dxt_A198 SUN domain-containing protein 2; beta-sandwich, LI 96.55
1gqp_A221 DOC1/APC10; cell cycle, APC10/DOC1, APC/cyclosome, 96.15
4aqs_A 525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 94.03
4aqt_A 375 Laminin subunit gamma-1; cell adhesion; HET: NAG B 92.31
2y38_A 403 Laminin subunit alpha-5; structural protein, cell 91.37
3zyj_B 426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 90.04
3ecq_A1531 Protein SPR0328, endo-alpha-N-acetylgalactosaminid 88.67
3tbd_A 338 Netrin-G2, laminet-2; laminin N-terminal domain, d 87.07
3nng_A168 Uncharacterized protein; F5_F8_TYPE_C domain, NESG 86.95
>3ues_A Alpha-1,3/4-fucosidase; TIM barrel, hydrolase-hydrolase inhibitor complex; HET: DFU; 1.60A {Bifidobacterium longum subsp} PDB: 3mo4_A* 3uet_A* Back     alignment and structure
Probab=99.96  E-value=1.1e-29  Score=220.11  Aligned_cols=103  Identities=25%  Similarity=0.472  Sum_probs=100.6

Q ss_pred             CCCCcceEEecCCCCCCeEEEEEcCCCeEEeEEEEEcccCCCceEEEEEEEEEeCC-CcEEEEEeceeeeeEEEEEcCCe
Q 032423            1 MKEDIYTYWAPEENHSDWTLLINLQEPVSFNVLQVQEPIHMGQRISRFHLDILNEE-RKWKKVINGTTVGYQRLLQFPTV   79 (141)
Q Consensus         1 ~Dg~~~T~Wa~~~~~~~~~leldL~~~~~fn~V~l~E~i~~gqrI~~f~Ie~~~~d-G~W~~ia~GttIG~kri~~f~~V   79 (141)
                      +|||.+|||++++++..+||+|||+++++||.|+|+|+|..||||++|+||+++ | |+|++|++|++|||+|+++|+||
T Consensus       374 ~Dgn~~TyW~a~~~~~~~~l~idLg~~~~~n~v~IqE~i~~gqRV~~y~Ve~~~-dgg~W~~va~gttiG~kri~~f~~v  452 (478)
T 3ues_A          374 VDGNRDTFWRPDADDAAPAITLTLPQPTTINAIVIEEAIEHGQRIEHLRVTGAL-PDGTERVLGQAGTVGYRRILRFDDV  452 (478)
T ss_dssp             SSSCTTCCBCCCTTCSSCEEEEEEEEEEEEEEEEEEECGGGCCCEEEEEEEEEC-TTSCEEEEEEESCCTTCEEEEEEEE
T ss_pred             ccCCCCceEeCCCCCCCeeEEEECCCCcEEEEEEEeecccCCCceEEEEEEEEe-CCCCEEEEEeccccCceEEEEeCCe
Confidence            699999999999999999999999999999999999999999999999999999 7 79999999999999999999999


Q ss_pred             eeeEEEEEEEccCCCceecEEEEEe
Q 032423           80 KSQQLRFVIDKSRAEPLISHLGIYM  104 (141)
Q Consensus        80 ta~~vRl~i~~s~~~P~I~ef~vY~  104 (141)
                      +|++|||+|+++++.|+|++|+||+
T Consensus       453 ~ar~VRl~I~~s~~~p~Ise~~vY~  477 (478)
T 3ues_A          453 EVSSVTLHVDGSRLAPMISRAAAVR  477 (478)
T ss_dssp             EEEEEEEEEEEESSSCCEEEEEEEC
T ss_pred             eeEEEEEEEeccCCCeEEEEEEEEe
Confidence            9999999999999999999999996
>3eyp_A Putative alpha-L-fucosidase; structural genomics, hydrolase, lipoprotein, PSI-2, protein initiative; 1.90A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3gza_A Putative alpha-L-fucosidase; NP_812709.1, structural genomic center for structural genomics, JCSG; HET: MSE EPE; 1.60A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>4a3z_A GH89_CBM32, alpha-N-acetylglucosaminidase family protein; hydrolase, family 32 carbohydrate-binding module; HET: MSE; 1.55A {Clostridium perfringens} PDB: 4a6o_A* Back     alignment and structure
>3lei_A Platelet aggregation factor SM-HPAF; lectin domain of lectinolysin, fucose, blood clotting, nicke; HET: FUC; 1.90A {Streptococcus mitis} PDB: 3leg_A* 3le0_A* 3lek_A* Back     alignment and structure
>4a42_A GH89_CBM32-4, alpha-N-acetylglucosaminidase family protein; hydrolase, family 89 glycoside hydrolase, family 32 carbohyd binding module; HET: MSE; 1.55A {Clostridium perfringens} Back     alignment and structure
>3f2z_A Uncharacterized protein BF3579; the present C-terminal domain is predominantly composed of B strands., structural genomics, PSI-2; 1.30A {Bacteroides fragilis} PDB: 2kd7_A Back     alignment and structure
>4a41_A GH89_CBM32-5, alpha-N-acetylglucosaminidase family protein; hydrolase, family 89 glycoside hydrolase, family 32 carbohyd binding module; HET: GAL; 1.55A {Clostridium perfringens} PDB: 4a44_A* 4a45_A* 4aax_A* Back     alignment and structure
>2j1a_A Hyaluronidase, CBM32; protein-carbohydrate interaction, glycoside hydrolase, GH84C, hydrolase; HET: GAL; 1.49A {Clostridium perfringens} PDB: 2j1e_A* 2j7m_A* Back     alignment and structure
>2jda_A Yecbm32; hypothetical protein, carbohydrate- binding module, sugar-binding protein, pectin, plant cell WALL, galacturonic acid; 1.35A {Yersinia enterocolitica} PDB: 2jd9_A Back     alignment and structure
>1tvg_A LOC51668 protein; cell cycle, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 1.60A {Homo sapiens} SCOP: b.18.1.9 PDB: 1xpw_A Back     alignment and structure
>3ggl_A Putative chitobiase; X-RAY, structure genomics, NESG, BTR324A, Q8A9F0_bactn, BT_0865, PSI-2, protein structure initiative; 3.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2v72_A CBM32, EXO-alpha-sialidase; galactose, bacterial pathogen, carbohydrate-binding module, sugar-binding protein; HET: GAL; 2.25A {Clostridium perfringens} Back     alignment and structure
>4gwi_A Lectinolysin, platelet aggregation factor SM-HPAF; cholesterol-dependent cytolysins, lewis antigens, F-type LEC glycan binding; HET: BDZ; 1.60A {Streptococcus mitis} PDB: 4gwj_A* 3lei_A* 3leg_A* 3le0_A* 3lek_A* Back     alignment and structure
>2yc2_A IFT25, intraflagellar transport protein 25; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_A Back     alignment and structure
>4a4a_A Alpha-N-acetylglucosaminidase family protein; hydrolase, 2 hydrolase, family 89 glycoside hydrolase, mucin carbohydrate-active enzyme; HET: NDG GAL; 1.90A {Clostridium perfringens} PDB: 2vcc_A 2vc9_A* 2vcb_A* 2vca_A Back     alignment and structure
>2j1v_A Fucolectin-related protein; carbohydrate-binding protein, carbohydrate binding protein; HET: NAG GAL FUC; 1.45A {Streptococcus pneumoniae} PDB: 2j1r_A* 2j1t_A* 2j1u_A* 2j1s_A* Back     alignment and structure
>3cqo_A FBP32; F-lectin, fucolectin, sugar binding protein; HET: FUC; 2.32A {Morone saxatilis} Back     alignment and structure
>3bn6_A Lactadherin; anticoagulation, anti-coagulation, anticoagulant, anti- coagulant, membrane binding, phosphatidyl-serine binding; 1.67A {Bos taurus} PDB: 2pqs_A Back     alignment and structure
>2v5d_A O-GLCNACASE NAGJ; family 32 carbohydrate binding module, glycosidase, GH84, GH84C, CBM32, hydrolase, coiled coil; 3.30A {Clostridium perfringens} Back     alignment and structure
>1w8o_A Bacterial sialidase; 3D-structure, glycosidase, hydrolase, beta- propeller; HET: LBT CIT; 1.70A {Micromonospora viridifaciens} SCOP: b.1.18.2 b.18.1.1 b.68.1.1 PDB: 1w8n_A* 1eut_A 1euu_A* 1wcq_A* 2bzd_A* 2ber_A* 1eur_A 1eus_A* Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>2j22_A Fucolectin-related protein; carbohydrate-binding protein, carbohydrate binding protein; 1.8A {Streptococcus pneumoniae} Back     alignment and structure
>3cqo_A FBP32; F-lectin, fucolectin, sugar binding protein; HET: FUC; 2.32A {Morone saxatilis} Back     alignment and structure
>2qqi_A Neuropilin-1; VEGF receptor, semaphorin receptor, angiogenesis, developmen protein, differentiation, glycoprotein, heparan sulfate, ME neurogenesis; 1.80A {Homo sapiens} SCOP: b.18.1.2 b.18.1.2 PDB: 2orz_A 2orx_A 2qqn_A 3i97_A* 1kex_A Back     alignment and structure
>1k12_A Lectin; beta barrel, protein carbohydrate complex, sugar binding protein; HET: FUC; 1.90A {Anguilla anguilla} SCOP: b.18.1.15 Back     alignment and structure
>3hnm_A Putative chitobiase; PSI-2, protein structure initiative, northeast structural genomics consortium, NESG, BTR319D.BT_411; 3.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2w1s_A Hyaluronoglucosaminidase; hexosaminidase, family 32 carbohydrate binding module, toxin, secreted, virulence, hydrolase, glycosidase; HET: MSE BTB; 1.45A {Clostridium perfringens} PDB: 2w1q_A* 2w1u_A* 2wdb_A* Back     alignment and structure
>1czt_A Protein (coagulation factor V); membrane-binding, discoidin family, calcium- independent, blood clotting; 1.87A {Homo sapiens} SCOP: b.18.1.2 PDB: 1czs_A 1czv_A Back     alignment and structure
>2vm9_A Discoidin-2, discoidin II; DDR, lectin, aggregation, cell adhesion; 1.75A {Dictyostelium discoideum} PDB: 2vmc_A* 2vmd_A* 2vme_A* Back     alignment and structure
>4deq_A Neuropilin-1, vascular endothelial growth factor; coagulation factor domain, heparin binding domain, angiogene protein binding-cytokine complex; 2.65A {Homo sapiens} PDB: 1kmx_A 1vgh_A 2vgh_A Back     alignment and structure
>2qqj_A Neuropilin-2; VEGF receptor, semaphorin receptor, developmental protein, differentiation, glycoprotein, membrane, neurogenesis, transmembrane; 1.95A {Homo sapiens} Back     alignment and structure
>2qqm_A Neuropilin-1; VEGF receptor, semaphorin receptor, calcium-binding domain, angiogenesis, developmental protein, differentiation; HET: NAG FUC; 2.00A {Homo sapiens} SCOP: b.18.1.2 b.18.1.2 b.23.1.1 Back     alignment and structure
>3hny_M Coagulation factor VIII; blood clotting, acute phase, blood coagulation, calcium, DIS mutation, disulfide bond, glycoprotein, hemophilia; 1.07A {Homo sapiens} SCOP: b.18.1.2 PDB: 3hnb_M 3hob_M 1d7p_M 1iqd_C 1cfg_A 1fac_A Back     alignment and structure
>1sdd_B Coagulation factor V; copper-binding protein, cofactor, blood clottin; HET: NAG NDG; 2.80A {Bos taurus} SCOP: b.6.1.3 b.6.1.3 b.18.1.2 b.18.1.2 Back     alignment and structure
>2wuh_A Discoidin domain receptor 2; receptor-peptide complex, transferase, nucleotide-binding, tyrosine-protein kinase; 1.60A {Homo sapiens} PDB: 2z4f_A Back     alignment and structure
>2qqi_A Neuropilin-1; VEGF receptor, semaphorin receptor, angiogenesis, developmen protein, differentiation, glycoprotein, heparan sulfate, ME neurogenesis; 1.80A {Homo sapiens} SCOP: b.18.1.2 b.18.1.2 PDB: 2orz_A 2orx_A 2qqn_A 3i97_A* 1kex_A Back     alignment and structure
>2qqm_A Neuropilin-1; VEGF receptor, semaphorin receptor, calcium-binding domain, angiogenesis, developmental protein, differentiation; HET: NAG FUC; 2.00A {Homo sapiens} SCOP: b.18.1.2 b.18.1.2 b.23.1.1 Back     alignment and structure
>2qqj_A Neuropilin-2; VEGF receptor, semaphorin receptor, developmental protein, differentiation, glycoprotein, membrane, neurogenesis, transmembrane; 1.95A {Homo sapiens} Back     alignment and structure
>2zxq_A Endo-alpha-N-acetylgalactosaminidase; broken TIM barrel, glycosidase, hydrolase; 2.00A {Bifidobacterium longum} Back     alignment and structure
>2qqo_A Neuropilin-2; VEGF receptor, semaphorin receptor, calcium-binding domain, developmental protein, differentiation, glycoprotein, membr neurogenesis; 2.30A {Homo sapiens} Back     alignment and structure
>2yfu_A Carbohydrate binding family 6; sugar binding protein; 1.65A {Clostridium thermocellum} PDB: 2y8j_A* 2y9i_A* 2y9s_A 2yb7_A* 2y8m_A 2yfz_A* 2yg0_A* Back     alignment and structure
>2qqk_A Neuropilin-2; VEGF receptor, semaphorin receptor, phage-derived antibody, developmental protein, differentiation, glycoprotein; HET: NAG; 2.75A {Homo sapiens} PDB: 2qql_A Back     alignment and structure
>2qqk_A Neuropilin-2; VEGF receptor, semaphorin receptor, phage-derived antibody, developmental protein, differentiation, glycoprotein; HET: NAG; 2.75A {Homo sapiens} PDB: 2qql_A Back     alignment and structure
>2r7e_B Coagulation factor VIII; ceruloplasmin fold, cupper protein fold, C2 domain fold, ACU blood coagulation, disease mutation, glycoprotein; HET: NAG BMA MAN; 3.70A {Homo sapiens} PDB: 3cdz_B* Back     alignment and structure
>2qqo_A Neuropilin-2; VEGF receptor, semaphorin receptor, calcium-binding domain, developmental protein, differentiation, glycoprotein, membr neurogenesis; 2.30A {Homo sapiens} Back     alignment and structure
>1sdd_B Coagulation factor V; copper-binding protein, cofactor, blood clottin; HET: NAG NDG; 2.80A {Bos taurus} SCOP: b.6.1.3 b.6.1.3 b.18.1.2 b.18.1.2 Back     alignment and structure
>2cho_A Glucosaminidase, hexosaminiase; O-GLCNACASE, hydrolase, N-acetylglucosamine; 1.85A {Bacteroides thetaiotaomicron} SCOP: a.246.1.1 c.1.8.10 d.92.2.3 PDB: 2chn_A 2vvn_A* 2vvs_A* 2x0h_A* 2xm2_A* 2w4x_A* 2w66_A* 2w67_A* 2wca_A* 2xj7_A* 2xm1_A* 2j47_A* 2jiw_A* 2wzh_A* 2wzi_A* 2j4g_A* Back     alignment and structure
>4gz9_A Neuropilin-1, A5 protein; multi-domain, cell-CELL signaling, plexin, semaphorin, VEGF, glycosilated, transmembrane, signaling protein; HET: NAG BMA; 2.70A {Mus musculus} PDB: 4gza_H Back     alignment and structure
>4gz9_A Neuropilin-1, A5 protein; multi-domain, cell-CELL signaling, plexin, semaphorin, VEGF, glycosilated, transmembrane, signaling protein; HET: NAG BMA; 2.70A {Mus musculus} PDB: 4gza_H Back     alignment and structure
>2wn3_A Discoidin-1 subunit A; type-H lectin, cell adhesion, discoidin domain, lectin; HET: NGA GAL 1PG; 1.59A {Dictyostelium discoideum} PDB: 2w94_A* 2wn2_A* 2w95_A* Back     alignment and structure
>4ag4_A Epithelial discoidin domain-containing receptor 1; immune system-transferase complex; HET: NAG; 2.80A {Homo sapiens} Back     alignment and structure
>2r7e_B Coagulation factor VIII; ceruloplasmin fold, cupper protein fold, C2 domain fold, ACU blood coagulation, disease mutation, glycoprotein; HET: NAG BMA MAN; 3.70A {Homo sapiens} PDB: 3cdz_B* Back     alignment and structure
>3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Back     alignment and structure
>1jhj_A APC10; beta sandwich, jellyroll, cell cycle; 1.60A {Homo sapiens} SCOP: b.18.1.9 Back     alignment and structure
>4dxt_A SUN domain-containing protein 2; beta-sandwich, LINC complex, structural protein; 2.22A {Homo sapiens} PDB: 3unp_A 4dxr_A* 4dxs_A* 4fi9_A Back     alignment and structure
>1gqp_A DOC1/APC10; cell cycle, APC10/DOC1, APC/cyclosome, ubiquitination, E3 ubiquitin ligase, beta sandwich, jelly roll; 2.2A {Saccharomyces cerevisiae} SCOP: b.18.1.9 Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Back     alignment and structure
>4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} Back     alignment and structure
>2y38_A Laminin subunit alpha-5; structural protein, cell adhesion, basement membrane; HET: NAG; 2.90A {Mus musculus} Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3ecq_A Protein SPR0328, endo-alpha-N-acetylgalactosaminidase; distorted (beta/alpha)8 (TIM) barrel glycoside hydrolase DOM WALL; 2.90A {Streptococcus pneumoniae} Back     alignment and structure
>3tbd_A Netrin-G2, laminet-2; laminin N-terminal domain, domain VI, LE-domain, N neuronal cell adhesion molecule, netrin G ligand 2, nervous system; HET: NAG; 1.80A {Homo sapiens} PDB: 3zyg_A* 3zyi_B* Back     alignment and structure
>3nng_A Uncharacterized protein; F5_F8_TYPE_C domain, NESG, structural genomics, PSI-2, prote structure initiative; 2.18A {Bacteroides fragilis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query141
d1w8oa2142 Sialidase, C-terminal domain {Micromonospora virid 99.62
d1tvga_136 Placental protein 25, pp25 {Human (Homo sapiens) [ 99.59
d1k3ia2162 Galactose oxidase, N-terminal domain {Fungi (Fusar 99.54
d1jhja_161 APC10/DOC1 subunit of the anaphase-promoting compl 99.42
d1k12a_158 Fucose binding lectin {European eel (Anguilla angu 99.35
d2qqia1156 C2 domain of factor VIII {Human (Homo sapiens) [Ta 99.3
d1gqpa_194 APC10/DOC1 subunit of the anaphase-promoting compl 99.28
d2qqia2155 B1 domain of neuropilin-1 {Human (Homo sapiens) [T 99.23
d1sddb3162 C2 domain of factor V {Cow (Bos taurus) [TaxId: 99 99.13
d1d7pm_159 C2 domain of factor VIII {Human (Homo sapiens) [Ta 99.07
d1czsa_160 C2 domain of factor V {Human (Homo sapiens) [TaxId 98.97
d1o59a1188 Allantoicase {Baker's yeast (Saccharomyces cerevis 91.62
d1o59a2150 Allantoicase {Baker's yeast (Saccharomyces cerevis 91.27
>d1w8oa2 b.18.1.1 (A:506-647) Sialidase, C-terminal domain {Micromonospora viridifaciens [TaxId: 1881]} Back     information, alignment and structure
class: All beta proteins
fold: Galactose-binding domain-like
superfamily: Galactose-binding domain-like
family: Galactose-binding domain
domain: Sialidase, C-terminal domain
species: Micromonospora viridifaciens [TaxId: 1881]

Probab=99.62  E-value=2e-15  Score=106.36  Aligned_cols=104  Identities=12%  Similarity=0.207  Sum_probs=81.2

Q ss_pred             CCCCcceEEecC-----CCCCCeEEEEEcCCCeEEeEEEEEccc-CCCceEEEEEEEEEeCCC-cEEEEEecee---eee
Q 032423            1 MKEDIYTYWAPE-----ENHSDWTLLINLQEPVSFNVLQVQEPI-HMGQRISRFHLDILNEER-KWKKVINGTT---VGY   70 (141)
Q Consensus         1 ~Dg~~~T~Wa~~-----~~~~~~~leldL~~~~~fn~V~l~E~i-~~gqrI~~f~Ie~~~~dG-~W~~ia~Gtt---IG~   70 (141)
                      +|||.+|||.++     ......||+|||+++..|+.|.|.=.. ....++.+|.|++.. || .|.++...++   .+.
T Consensus        25 ~Dg~~~T~W~s~~~~~~~~~~~~wi~idl~~~~~v~~i~i~~~~~~~~~~~~~~~i~~S~-dg~~w~~~~~~~~~~~~~~  103 (142)
T d1w8oa2          25 IDGNPSTFWHTEWSRADAPGYPHRISLDLGGTHTISGLQYTRRQNSANEQVADYEIYTSL-NGTTWDGPVASGRFTTSLA  103 (142)
T ss_dssp             GSSCTTCCEECCCSSTTCCCSCEEEEEEEEEEEEEEEEEEEECSSCSTTCBCEEEEEEES-SSSSCEEEEEEEECCSCSS
T ss_pred             EcCCCCCcccccCcCCCCCCccEEEEEECCCeEEeeEEEEECccccCcCCceeEEEEEec-CCCceEEEEEeeecCCCCc
Confidence            699999999863     233467999999999999999997222 223469999999998 77 7877754332   344


Q ss_pred             EEEEEcCCeeeeEEEEEEEccCC---CceecEEEEEee
Q 032423           71 QRLLQFPTVKSQQLRFVIDKSRA---EPLISHLGIYMD  105 (141)
Q Consensus        71 kri~~f~~Vta~~vRl~i~~s~~---~P~I~ef~vY~~  105 (141)
                      .+.+.|+|+++++|||+++...+   .+.|.||+||-.
T Consensus       104 ~~~~~~~~~~aryvRl~~~~~~~~~~~~~i~Ei~v~G~  141 (142)
T d1w8oa2         104 PQRAVFPARDARYIRLVALSEQTGHKYAAVAELEVEGQ  141 (142)
T ss_dssp             CEEEEEEEEEEEEEEEEECCBTTSCSCCEEEEEEEEEC
T ss_pred             eEEEecCceEEEEEEEEEEecCCCCceEEEEEEEEEEE
Confidence            45678999999999999987664   379999999953
>d1tvga_ b.18.1.9 (A:) Placental protein 25, pp25 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jhja_ b.18.1.9 (A:) APC10/DOC1 subunit of the anaphase-promoting complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k12a_ b.18.1.15 (A:) Fucose binding lectin {European eel (Anguilla anguilla) [TaxId: 7936]} Back     information, alignment and structure
>d2qqia1 b.18.1.2 (A:431-586) C2 domain of factor VIII {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gqpa_ b.18.1.9 (A:) APC10/DOC1 subunit of the anaphase-promoting complex {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2qqia2 b.18.1.2 (A:273-427) B1 domain of neuropilin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sddb3 b.18.1.2 (B:1863-2024) C2 domain of factor V {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1d7pm_ b.18.1.2 (M:) C2 domain of factor VIII {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1czsa_ b.18.1.2 (A:) C2 domain of factor V {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o59a1 b.18.1.22 (A:0-187) Allantoicase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1o59a2 b.18.1.22 (A:194-343) Allantoicase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure