Citrus Sinensis ID: 032443


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140
MLGDAKVDEDGNVYDTKDINVMYLDKDGEDGEINISSAICFLRGKAYEALGNCAQARLWYKAAIIADPLCYEALECLIENHMLTCEQETSLLSSLEFGFEDGWLSSFYSCLIKKCRRYPFSGAIVHNILLRQVSHGAGNE
ccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHcccccHHHHHHHHHHcccccHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHcccc
cccccEEcccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHcccccHHHHHHHHHHcccccHcHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccc
mlgdakvdedgnvydtkdinvmyldkdgedgeinISSAICFLRGKAYEALGNCAQARLWYKAAIIADPLCYEALECLIENHMLTCEQETSLLSslefgfedgwlSSFYSCLIkkcrrypfsgaIVHNILLRQvshgagne
mlgdakvdedgnvydtkdiNVMYldkdgedgeINISSAICFLRGKAYEALGNCAQARLWYKAAIIADPLCYEALECLIENHMLTCEQETSLLSSLEFGFEDGWLSSFYSCLIKKCRRYPFSGAIVHNILlrqvshgagne
MLGDAKVDEDGNVYDTKDINVMYLDKDGEDGEINISSAICFLRGKAYEALGNCAQARLWYKAAIIADPLCYEALECLIENHMLTCEQETSLLSSLEFGFEDGWLSSFYSCLIKKCRRYPFSGAIVHNILLRQVSHGAGNE
************VYDTKDINVMYLDKDGEDGEINISSAICFLRGKAYEALGNCAQARLWYKAAIIADPLCYEALECLIENHMLTCEQETSLLSSLEFGFEDGWLSSFYSCLIKKCRRYPFSGAIVHNILLRQV*******
**G********************************SSAICFLRGKAYEALGNCAQARLWYKAAIIADPLCYEALECLIENHMLTCEQETSLLSSLEFGFEDGWLSSFYSCLIKKCRR*****AIVHNILL**********
MLGDAKVDEDGNVYDTKDINVMYLDKDGEDGEINISSAICFLRGKAYEALGNCAQARLWYKAAIIADPLCYEALECLIENHMLTCEQETSLLSSLEFGFEDGWLSSFYSCLIKKCRRYPFSGAIVHNILLRQVSHGAGNE
***DAKVDEDGNVYDTKDINVMYLDKDGEDGEINISSAICFLRGKAYEALGNCAQARLWYKAAIIADPLCYEALECLIENHMLTCEQETSLLSSLEFGFEDGWLSSFYSCLIKKCRRYPFSGAIVHNILLRQVSHG****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLGDAKVDEDGNVYDTKDINVMYLDKDGEDGEINISSAICFLRGKAYEALGNCAQARLWYKAAIIADPLCYEALECLIENHMLTCEQETSLLSSLEFGFEDGWLSSFYSCLIKKCRRYPFSGAIVHNILLRQVSHGAGNE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query140 2.2.26 [Sep-21-2011]
B3DNN5 543 Anaphase-promoting comple yes no 0.814 0.209 0.815 5e-42
Q1ZXE6 865 Anaphase-promoting comple yes no 0.621 0.100 0.413 7e-15
P41889 671 Anaphase-promoting comple yes no 0.692 0.144 0.342 4e-10
Q13042 620 Cell division cycle prote yes no 0.514 0.116 0.444 1e-09
Q8R349 620 Cell division cycle prote yes no 0.514 0.116 0.444 1e-09
P09798 840 Anaphase-promoting comple yes no 0.607 0.101 0.375 1e-08
>sp|B3DNN5|CDC16_ARATH Anaphase-promoting complex subunit 6 OS=Arabidopsis thaliana GN=APC6 PE=2 SV=1 Back     alignment and function desciption
 Score =  169 bits (427), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 93/114 (81%), Positives = 100/114 (87%)

Query: 1   MLGDAKVDEDGNVYDTKDINVMYLDKDGEDGEINISSAICFLRGKAYEALGNCAQARLWY 60
           MLGDAKVD+DG VYD KD NV+  DKDGED EINISSAICFLRGKAY AL N +QAR WY
Sbjct: 94  MLGDAKVDDDGIVYDAKDGNVIDFDKDGEDREINISSAICFLRGKAYGALQNRSQARQWY 153

Query: 61  KAAIIADPLCYEALECLIENHMLTCEQETSLLSSLEFGFEDGWLSSFYSCLIKK 114
           KAAI ADPLCYEALECLIE+HMLT E+E+SLLSSL+F  EDGWLSSFYSCLIKK
Sbjct: 154 KAAIKADPLCYEALECLIESHMLTSEEESSLLSSLQFSPEDGWLSSFYSCLIKK 207




Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin-protein ligase complex that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C complex controls several key steps in the cell cycle by mediating ubiquitination and subsequent degradation of target proteins such as cyclins. The APC/C complex is required for the female gametophyte development and is involved in several aspect of development by controlling cell division and cell elongation. Involved in the control of endoreduplication.
Arabidopsis thaliana (taxid: 3702)
>sp|Q1ZXE6|CDC16_DICDI Anaphase-promoting complex subunit 6 OS=Dictyostelium discoideum GN=anapc6 PE=3 SV=1 Back     alignment and function description
>sp|P41889|CUT9_SCHPO Anaphase-promoting complex subunit cut9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cut9 PE=1 SV=2 Back     alignment and function description
>sp|Q13042|CDC16_HUMAN Cell division cycle protein 16 homolog OS=Homo sapiens GN=CDC16 PE=1 SV=2 Back     alignment and function description
>sp|Q8R349|CDC16_MOUSE Cell division cycle protein 16 homolog OS=Mus musculus GN=Cdc16 PE=2 SV=1 Back     alignment and function description
>sp|P09798|CDC16_YEAST Anaphase-promoting complex subunit CDC16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC16 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query140
356517052 545 PREDICTED: anaphase-promoting complex su 0.814 0.209 0.859 3e-50
225461701 545 PREDICTED: anaphase-promoting complex su 0.814 0.209 0.877 8e-50
356545461 547 PREDICTED: anaphase-promoting complex su 0.814 0.208 0.850 2e-49
224116978 542 predicted protein [Populus trichocarpa] 0.814 0.210 0.850 3e-49
255578574 469 cell division cycle, putative [Ricinus c 0.814 0.243 0.824 1e-48
255565311 655 cell division cycle, putative [Ricinus c 0.814 0.174 0.824 2e-47
449480915 497 PREDICTED: LOW QUALITY PROTEIN: anaphase 0.814 0.229 0.789 8e-45
449457307 547 PREDICTED: anaphase-promoting complex su 0.814 0.208 0.789 1e-44
326530103 584 predicted protein [Hordeum vulgare subsp 0.814 0.195 0.728 2e-41
297839749 543 cell division cycle family protein [Arab 0.814 0.209 0.824 2e-40
>gi|356517052|ref|XP_003527204.1| PREDICTED: anaphase-promoting complex subunit 6-like [Glycine max] Back     alignment and taxonomy information
 Score =  202 bits (515), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 98/114 (85%), Positives = 105/114 (92%)

Query: 1   MLGDAKVDEDGNVYDTKDINVMYLDKDGEDGEINISSAICFLRGKAYEALGNCAQARLWY 60
           MLG+AKVD+DGNVYD KD NVMYLDKD ED EINISSAICFLRGKAYEAL N AQAR+WY
Sbjct: 94  MLGEAKVDDDGNVYDMKDSNVMYLDKDCEDREINISSAICFLRGKAYEALENRAQARMWY 153

Query: 61  KAAIIADPLCYEALECLIENHMLTCEQETSLLSSLEFGFEDGWLSSFYSCLIKK 114
           KAAI ADPLCYEALECLIENHMLTCE+E +L+SSL+FG EDGWLSSFYSCLIKK
Sbjct: 154 KAAIKADPLCYEALECLIENHMLTCEEEANLISSLQFGSEDGWLSSFYSCLIKK 207




Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225461701|ref|XP_002283201.1| PREDICTED: anaphase-promoting complex subunit 6 [Vitis vinifera] gi|302142883|emb|CBI20178.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356545461|ref|XP_003541161.1| PREDICTED: anaphase-promoting complex subunit 6-like [Glycine max] Back     alignment and taxonomy information
>gi|224116978|ref|XP_002331799.1| predicted protein [Populus trichocarpa] gi|222874495|gb|EEF11626.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255578574|ref|XP_002530149.1| cell division cycle, putative [Ricinus communis] gi|223530348|gb|EEF32241.1| cell division cycle, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|255565311|ref|XP_002523647.1| cell division cycle, putative [Ricinus communis] gi|223537099|gb|EEF38733.1| cell division cycle, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|449480915|ref|XP_004156029.1| PREDICTED: LOW QUALITY PROTEIN: anaphase-promoting complex subunit 6-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449457307|ref|XP_004146390.1| PREDICTED: anaphase-promoting complex subunit 6-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|326530103|dbj|BAK08331.1| predicted protein [Hordeum vulgare subsp. vulgare] Back     alignment and taxonomy information
>gi|297839749|ref|XP_002887756.1| cell division cycle family protein [Arabidopsis lyrata subsp. lyrata] gi|297333597|gb|EFH64015.1| cell division cycle family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query140
TAIR|locus:2037523 543 APC6 "anaphase promoting compl 0.814 0.209 0.815 7.1e-45
DICTYBASE|DDB_G0286233 865 anapc6 "anaphase promoting com 0.571 0.092 0.437 2.9e-14
POMBASE|SPAC6F12.15c 671 cut9 "anaphase-promoting compl 0.685 0.143 0.346 6.8e-11
UNIPROTKB|E2R5H6 620 CDC16 "Uncharacterized protein 0.492 0.111 0.478 2.1e-10
UNIPROTKB|Q7Z651 526 CDC16 "CDC16 cell division cyc 0.492 0.131 0.463 5.5e-10
UNIPROTKB|E1BPM5 620 CDC16 "Uncharacterized protein 0.492 0.111 0.463 7.1e-10
UNIPROTKB|Q13042 620 CDC16 "Cell division cycle pro 0.492 0.111 0.463 7.1e-10
UNIPROTKB|I3L944 620 CDC16 "Uncharacterized protein 0.492 0.111 0.463 7.1e-10
MGI|MGI:1917207 620 Cdc16 "CDC16 cell division cyc 0.492 0.111 0.463 7.1e-10
RGD|1305076 620 Cdc16 "cell division cycle 16" 0.492 0.111 0.463 7.1e-10
TAIR|locus:2037523 APC6 "anaphase promoting complex 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 472 (171.2 bits), Expect = 7.1e-45, P = 7.1e-45
 Identities = 93/114 (81%), Positives = 100/114 (87%)

Query:     1 MLGDAKVDEDGNVYDTKDINVMYLDKDGEDGEINISSAICFLRGKAYEALGNCAQARLWY 60
             MLGDAKVD+DG VYD KD NV+  DKDGED EINISSAICFLRGKAY AL N +QAR WY
Sbjct:    94 MLGDAKVDDDGIVYDAKDGNVIDFDKDGEDREINISSAICFLRGKAYGALQNRSQARQWY 153

Query:    61 KAAIIADPLCYEALECLIENHMLTCEQETSLLSSLEFGFEDGWLSSFYSCLIKK 114
             KAAI ADPLCYEALECLIE+HMLT E+E+SLLSSL+F  EDGWLSSFYSCLIKK
Sbjct:   154 KAAIKADPLCYEALECLIESHMLTSEEESSLLSSLQFSPEDGWLSSFYSCLIKK 207




GO:0005634 "nucleus" evidence=ISM
GO:0010087 "phloem or xylem histogenesis" evidence=IMP
GO:0032875 "regulation of DNA endoreduplication" evidence=RCA;IMP
GO:0005515 "protein binding" evidence=IPI
GO:0000278 "mitotic cell cycle" evidence=RCA
GO:0000280 "nuclear division" evidence=RCA
GO:0000724 "double-strand break repair via homologous recombination" evidence=RCA
GO:0000911 "cytokinesis by cell plate formation" evidence=RCA
GO:0006260 "DNA replication" evidence=RCA
GO:0006261 "DNA-dependent DNA replication" evidence=RCA
GO:0006270 "DNA replication initiation" evidence=RCA
GO:0006275 "regulation of DNA replication" evidence=RCA
GO:0006306 "DNA methylation" evidence=RCA
GO:0006346 "methylation-dependent chromatin silencing" evidence=RCA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=RCA
GO:0007067 "mitosis" evidence=RCA
GO:0007129 "synapsis" evidence=RCA
GO:0007131 "reciprocal meiotic recombination" evidence=RCA
GO:0007155 "cell adhesion" evidence=RCA
GO:0007276 "gamete generation" evidence=RCA
GO:0008283 "cell proliferation" evidence=RCA
GO:0009165 "nucleotide biosynthetic process" evidence=RCA
GO:0009555 "pollen development" evidence=RCA
GO:0009909 "regulation of flower development" evidence=RCA
GO:0009965 "leaf morphogenesis" evidence=RCA
GO:0010090 "trichome morphogenesis" evidence=RCA
GO:0010389 "regulation of G2/M transition of mitotic cell cycle" evidence=RCA
GO:0010564 "regulation of cell cycle process" evidence=RCA
GO:0016444 "somatic cell DNA recombination" evidence=RCA
GO:0016458 "gene silencing" evidence=RCA
GO:0016568 "chromatin modification" evidence=RCA
GO:0031047 "gene silencing by RNA" evidence=RCA
GO:0031048 "chromatin silencing by small RNA" evidence=RCA
GO:0034968 "histone lysine methylation" evidence=RCA
GO:0042023 "DNA endoreduplication" evidence=RCA
GO:0043687 "post-translational protein modification" evidence=RCA
GO:0045010 "actin nucleation" evidence=RCA
GO:0045893 "positive regulation of transcription, DNA-dependent" evidence=RCA
GO:0048765 "root hair cell differentiation" evidence=RCA
GO:0051225 "spindle assembly" evidence=RCA
GO:0051302 "regulation of cell division" evidence=RCA
GO:0051510 "regulation of unidimensional cell growth" evidence=RCA
GO:0051567 "histone H3-K9 methylation" evidence=RCA
GO:0051726 "regulation of cell cycle" evidence=RCA
GO:0071555 "cell wall organization" evidence=RCA
DICTYBASE|DDB_G0286233 anapc6 "anaphase promoting complex subunit 6" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
POMBASE|SPAC6F12.15c cut9 "anaphase-promoting complex subunit Cut9" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
UNIPROTKB|E2R5H6 CDC16 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q7Z651 CDC16 "CDC16 cell division cycle 16 homolog (S. cerevisiae), isoform CRA_h" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1BPM5 CDC16 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q13042 CDC16 "Cell division cycle protein 16 homolog" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|I3L944 CDC16 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1917207 Cdc16 "CDC16 cell division cycle 16" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1305076 Cdc16 "cell division cycle 16" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
B3DNN5CDC16_ARATHNo assigned EC number0.81570.81420.2099yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 140
KOG1173 611 consensus Anaphase-promoting complex (APC), Cdc16 99.92
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 98.17
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 97.91
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 97.85
PF1342844 TPR_14: Tetratricopeptide repeat 97.45
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.44
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 97.14
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 96.98
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 96.69
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 96.32
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 95.6
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 95.3
PRK11189 296 lipoprotein NlpI; Provisional 95.07
KOG4162799 consensus Predicted calmodulin-binding protein [Si 95.05
PF1337173 TPR_9: Tetratricopeptide repeat 95.03
cd00189100 TPR Tetratricopeptide repeat domain; typically con 94.49
cd00189100 TPR Tetratricopeptide repeat domain; typically con 94.26
TIGR02552135 LcrH_SycD type III secretion low calcium response 94.16
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 94.02
PRK11189296 lipoprotein NlpI; Provisional 93.98
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 93.95
PRK15359144 type III secretion system chaperone protein SscB; 93.94
KOG0553304 consensus TPR repeat-containing protein [General f 93.9
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 93.71
PRK15359144 type III secretion system chaperone protein SscB; 93.5
PRK10370198 formate-dependent nitrite reductase complex subuni 93.48
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 93.32
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 93.16
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 92.56
PRK02603172 photosystem I assembly protein Ycf3; Provisional 92.55
TIGR02552135 LcrH_SycD type III secretion low calcium response 92.11
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 91.91
KOG1129478 consensus TPR repeat-containing protein [General f 91.76
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 91.36
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 91.1
TIGR00990 615 3a0801s09 mitochondrial precursor proteins import 91.09
TIGR00990 615 3a0801s09 mitochondrial precursor proteins import 90.94
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 90.85
PRK10153517 DNA-binding transcriptional activator CadC; Provis 90.81
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 90.49
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 90.48
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 90.3
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 90.19
TIGR02917 899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 90.01
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 89.65
PRK12370 553 invasion protein regulator; Provisional 89.41
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 89.17
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 88.96
KOG1155 559 consensus Anaphase-promoting complex (APC), Cdc23 88.83
PRK14720 906 transcript cleavage factor/unknown domain fusion p 88.67
CHL00033168 ycf3 photosystem I assembly protein Ycf3 88.67
PRK10153517 DNA-binding transcriptional activator CadC; Provis 88.65
KOG1125579 consensus TPR repeat-containing protein [General f 88.21
PRK11788 389 tetratricopeptide repeat protein; Provisional 88.08
KOG0553304 consensus TPR repeat-containing protein [General f 87.97
PF1343134 TPR_17: Tetratricopeptide repeat 87.9
KOG1125 579 consensus TPR repeat-containing protein [General f 87.83
PRK12370 553 invasion protein regulator; Provisional 87.75
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 87.47
KOG0550 486 consensus Molecular chaperone (DnaJ superfamily) [ 87.25
PLN02789 320 farnesyltranstransferase 87.25
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 87.07
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 87.03
KOG4162799 consensus Predicted calmodulin-binding protein [Si 86.73
KOG4507 886 consensus Uncharacterized conserved protein, conta 86.2
PRK02603172 photosystem I assembly protein Ycf3; Provisional 86.16
TIGR02917 899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 86.03
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 85.82
PLN02789320 farnesyltranstransferase 85.56
COG4235287 Cytochrome c biogenesis factor [Posttranslational 85.44
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 85.29
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 85.28
PF1337173 TPR_9: Tetratricopeptide repeat 84.98
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 84.79
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 83.67
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 83.55
PRK11788 389 tetratricopeptide repeat protein; Provisional 83.27
KOG1126638 consensus DNA-binding cell division cycle control 83.06
PF14929547 TAF1_subA: TAF RNA Polymerase I subunit A 82.85
PF0421269 MIT: MIT (microtubule interacting and transport) d 82.48
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 82.44
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 82.4
COG2976207 Uncharacterized protein conserved in bacteria [Fun 82.26
KOG2076 895 consensus RNA polymerase III transcription factor 82.22
COG4785 297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 81.97
COG3063 250 PilF Tfp pilus assembly protein PilF [Cell motilit 81.86
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 81.85
PF03704146 BTAD: Bacterial transcriptional activator domain; 81.42
CHL00033168 ycf3 photosystem I assembly protein Ycf3 81.05
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 80.75
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 80.4
COG2956 389 Predicted N-acetylglucosaminyl transferase [Carboh 80.3
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
Probab=99.92  E-value=2.6e-26  Score=207.50  Aligned_cols=133  Identities=38%  Similarity=0.539  Sum_probs=116.8

Q ss_pred             CCCCcccccCCCcccccc-cchhccCCCCCCCchhHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHhcCCCcHHHHHHHHH
Q 032443            1 MLGDAKVDEDGNVYDTKD-INVMYLDKDGEDGEINISSAICFLRGKAYEALGNCAQARLWYKAAIIADPLCYEALECLIE   79 (140)
Q Consensus         1 ~l~~~~~~~~g~v~~~~~-~~~~~~~~~~~d~gikl~ssmc~LRGk~yeal~N~~~A~~~YkeAL~~Dv~CyEAFe~Lv~   79 (140)
                      +||+.+++..+-..++.+ ++.+..+...++++|+++|||||||||+|.+++||++|++||++||..|++|||||++||+
T Consensus       104 vl~~~~~~~~~f~yy~~~~~~~l~~n~~~~~~~~~~essic~lRgk~y~al~n~~~ar~~Y~~Al~~D~~c~Ea~~~lvs  183 (611)
T KOG1173|consen  104 VLGRGHVETNPFSYYEKDAANTLELNSAGEDLMINLESSICYLRGKVYVALDNREEARDKYKEALLADAKCFEAFEKLVS  183 (611)
T ss_pred             HhcccchhhcchhhcchhhhceeccCcccccccccchhceeeeeeehhhhhccHHHHHHHHHHHHhcchhhHHHHHHHHH
Confidence            466667778888888888 8999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccCCCHHHHHHHHhcCCCCc----hhHHHHHHHHHhhhccCCCcchhhhhccceeeecc
Q 032443           80 NHMLTCEQETSLLSSLEFGF----EDGWLSSFYSCLIKKCRRYPFSGAIVHNILLRQVS  134 (140)
Q Consensus        80 ~~lLt~~EE~eLl~sL~f~~----e~~~lk~lY~srL~Ky~~~~~~~~~~~~~~~~~~~  134 (140)
                      +||||++|||+|+.+||++.    +.+.++.+|..++.|+.+....- ..|+.++-.+.
T Consensus       184 ~~mlt~~Ee~~ll~~l~~a~~~~ed~e~l~~lyel~~~k~~n~~~~~-r~~~~sl~~l~  241 (611)
T KOG1173|consen  184 AHMLTAQEEFELLESLDLAMLTKEDVERLEILYELKLCKNRNEESLT-RNEDESLIGLA  241 (611)
T ss_pred             HHhcchhHHHHHHhcccHHhhhhhHHHHHHHHHHhhhhhhccccccc-cCchhhhhhhh
Confidence            99999999999999999983    66899999999988888776552 35555443333



>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF14929 TAF1_subA: TAF RNA Polymerase I subunit A Back     alignment and domain information
>PF04212 MIT: MIT (microtubule interacting and transport) domain; InterPro: IPR007330 The MIT domain is found in vacuolar sorting proteins, spastin (probable ATPase involved in the assembly or function of nuclear protein complexes), and a sorting nexin, which may play a role in intracellular trafficking Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query140
2xpi_A 597 Crystal Structure Of ApcC HETERO-Tetramer Cut9-Hcn1 6e-11
>pdb|2XPI|A Chain A, Crystal Structure Of ApcC HETERO-Tetramer Cut9-Hcn1 Length = 597 Back     alignment and structure

Iteration: 1

Score = 62.8 bits (151), Expect = 6e-11, Method: Compositional matrix adjust. Identities = 36/105 (34%), Positives = 59/105 (56%), Gaps = 8/105 (7%) Query: 15 DTKDINVMYLDKDGEDGEINISSAICFLRGKAYEALGNCAQARLWYKAAIIADPLCYEAL 74 D K+ N + + +DG I + +++C+LRG+ Y L N +A+ YK A++ D CYEA Sbjct: 182 DEKNANKLLM----QDGGIKLEASMCYLRGQVYTNLSNFDRAKECYKEALMVDAKCYEAF 237 Query: 75 ECLIENHMLTCEQETSLLSSLEFGF---ED-GWLSSFYSCLIKKC 115 + L+ NH+LT ++E L+ L + ED +L S Y + K Sbjct: 238 DQLVSNHLLTADEEWDLVLKLNYSTYSKEDAAFLRSLYMLKLNKT 282

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query140
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 6e-15
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
 Score = 69.1 bits (169), Expect = 6e-15
 Identities = 29/86 (33%), Positives = 49/86 (56%)

Query: 29  EDGEINISSAICFLRGKAYEALGNCAQARLWYKAAIIADPLCYEALECLIENHMLTCEQE 88
           +DG I + +++C+LRG+ Y  L N  +A+  YK A++ D  CYEA + L+ NH+LT ++E
Sbjct: 192 QDGGIKLEASMCYLRGQVYTNLSNFDRAKECYKEALMVDAKCYEAFDQLVSNHLLTADEE 251

Query: 89  TSLLSSLEFGFEDGWLSSFYSCLIKK 114
             L+  L +       ++F   L   
Sbjct: 252 WDLVLKLNYSTYSKEDAAFLRSLYML 277


Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query140
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 97.9
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 97.6
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 97.49
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 97.13
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 97.06
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 96.99
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 96.95
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 96.85
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 96.83
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 96.75
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 96.75
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 96.74
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 96.72
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 96.72
2l6j_A111 TPR repeat-containing protein associated with HSP; 96.72
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 96.69
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 96.67
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 96.65
2l6j_A111 TPR repeat-containing protein associated with HSP; 96.61
3q49_B137 STIP1 homology and U box-containing protein 1; E3 96.49
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 96.44
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 96.43
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 96.42
2kat_A115 Uncharacterized protein; NESG, structure, structur 96.39
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 96.33
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 96.32
3k9i_A117 BH0479 protein; putative protein binding protein, 96.3
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 96.27
3u4t_A272 TPR repeat-containing protein; structural genomics 96.26
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 96.21
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 96.19
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 96.19
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 96.18
3q49_B137 STIP1 homology and U box-containing protein 1; E3 96.17
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 96.07
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 96.06
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 96.05
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 96.04
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 95.94
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 95.94
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 95.8
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 95.79
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 95.78
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 95.76
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 95.75
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 95.75
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 95.72
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 95.7
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 95.68
4i17_A228 Hypothetical protein; TPR repeats protein, structu 95.67
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 95.67
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 95.67
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 95.66
4i17_A228 Hypothetical protein; TPR repeats protein, structu 95.64
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 95.63
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 95.61
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 95.6
2h6f_A 382 Protein farnesyltransferase/geranylgeranyltransfer 95.58
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 95.56
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 95.55
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 95.54
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 95.53
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 95.47
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 95.41
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 95.37
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 95.34
1xnf_A 275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 95.29
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 95.24
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 95.16
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 95.11
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 95.08
2h6f_A 382 Protein farnesyltransferase/geranylgeranyltransfer 95.04
2pl2_A 217 Hypothetical conserved protein TTC0263; TPR, prote 94.99
3u4t_A272 TPR repeat-containing protein; structural genomics 94.95
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 94.89
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 94.88
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 94.79
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 94.79
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 94.74
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 94.71
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 94.62
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 94.62
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 94.58
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 94.56
1pc2_A152 Mitochondria fission protein; unknown function; NM 94.51
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 94.51
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 94.41
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 94.4
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 94.4
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 94.38
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 94.35
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 94.3
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 94.24
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 94.19
2gw1_A 514 Mitochondrial precursor proteins import receptor; 94.13
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 94.07
4eqf_A 365 PEX5-related protein; accessory protein, tetratric 94.04
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 94.02
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 94.0
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 93.96
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 93.94
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 93.89
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 93.89
1fch_A 368 Peroxisomal targeting signal 1 receptor; protein-p 93.87
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 93.69
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 93.67
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 93.58
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 93.42
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 93.4
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 93.4
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 93.35
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 93.2
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 93.18
3cv0_A 327 Peroxisome targeting signal 1 receptor PEX5; TPR m 93.17
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 93.16
4eqf_A365 PEX5-related protein; accessory protein, tetratric 93.16
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 93.16
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 93.15
2ho1_A 252 Type 4 fimbrial biogenesis protein PILF; type IV p 93.12
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 93.12
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 93.11
3k9i_A117 BH0479 protein; putative protein binding protein, 93.1
2kat_A115 Uncharacterized protein; NESG, structure, structur 93.09
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 92.98
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 92.97
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 92.88
2gw1_A514 Mitochondrial precursor proteins import receptor; 92.77
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 92.77
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 92.68
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 92.63
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 92.17
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 91.7
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 91.6
2ond_A 308 Cleavage stimulation factor 77 kDa subunit; HAT do 91.6
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 91.5
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 91.31
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 91.31
3ro2_A 338 PINS homolog, G-protein-signaling modulator 2; TPR 91.09
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 91.07
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 90.92
3qky_A 261 Outer membrane assembly lipoprotein YFIO; membrane 90.9
4g1t_A 472 Interferon-induced protein with tetratricopeptide 90.82
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 90.78
4g1t_A 472 Interferon-induced protein with tetratricopeptide 90.65
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 90.39
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 90.08
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 89.95
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 89.88
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 89.24
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 89.19
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 89.11
3dra_A 306 Protein farnesyltransferase/geranylgeranyltransfer 88.86
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 88.7
3q7a_A 349 Farnesyltransferase alpha subunit; protein prenylt 88.63
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 88.51
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 88.26
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 88.17
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 87.99
3sf4_A 406 G-protein-signaling modulator 2; tetratricopeptide 87.8
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 87.39
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 87.28
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 87.1
3u3w_A293 Transcriptional activator PLCR protein; ternary co 86.77
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 86.55
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 86.51
4a1s_A 411 PINS, partner of inscuteable; cell cycle, LGN, mit 86.42
3q15_A378 PSP28, response regulator aspartate phosphatase H; 86.41
1ouv_A 273 Conserved hypothetical secreted protein; TPR repea 86.29
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 86.16
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 86.11
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 85.52
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 85.24
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 85.03
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 84.06
3dss_A 331 Geranylgeranyl transferase type-2 subunit alpha; p 83.74
3q15_A378 PSP28, response regulator aspartate phosphatase H; 83.68
1klx_A138 Cysteine rich protein B; structural genomics, heli 83.29
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 83.18
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 83.05
4a1s_A 411 PINS, partner of inscuteable; cell cycle, LGN, mit 82.95
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 82.65
3dss_A 331 Geranylgeranyl transferase type-2 subunit alpha; p 82.29
3sf4_A 406 G-protein-signaling modulator 2; tetratricopeptide 81.84
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 81.01
3q7a_A 349 Farnesyltransferase alpha subunit; protein prenylt 80.99
1klx_A138 Cysteine rich protein B; structural genomics, heli 80.88
3ulq_A 383 Response regulator aspartate phosphatase F; tetrat 80.55
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
Probab=97.90  E-value=6.9e-05  Score=61.09  Aligned_cols=95  Identities=33%  Similarity=0.628  Sum_probs=82.0

Q ss_pred             CCCCchhHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHhcCCCcHHHHHHHHHccCCCHHHHHHHHhcCCCCc----hhHH
Q 032443           28 GEDGEINISSAICFLRGKAYEALGNCAQARLWYKAAIIADPLCYEALECLIENHMLTCEQETSLLSSLEFGF----EDGW  103 (140)
Q Consensus        28 ~~d~gikl~ssmc~LRGk~yeal~N~~~A~~~YkeAL~~Dv~CyEAFe~Lv~~~lLt~~EE~eLl~sL~f~~----e~~~  103 (140)
                      ..+.|+...+..++.+|.+|..+++.+.|..+|+++++.+|.+.+++..|...++.+..++++++..+.|..    ...+
T Consensus       191 ~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~p~~~~~~~~l~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~  270 (597)
T 2xpi_A          191 MQDGGIKLEASMCYLRGQVYTNLSNFDRAKECYKEALMVDAKCYEAFDQLVSNHLLTADEEWDLVLKLNYSTYSKEDAAF  270 (597)
T ss_dssp             CCCSSCCHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHTTCSCHHHHHHHHHHSCTHHHHGGGHHH
T ss_pred             ccccccchhHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCchhhHHHHHHHHhhcccchhHHHHHHhcCCcccccchHHH
Confidence            345567778889999999999999999999999999999999999999999999999999999999998863    4567


Q ss_pred             HHHHHHHhhhccCCCcchh
Q 032443          104 LSSFYSCLIKKCRRYPFSG  122 (140)
Q Consensus       104 lk~lY~srL~Ky~~~~~~~  122 (140)
                      ...+|...+.-|.....++
T Consensus       271 ~~~~~~~~~~~~~~~g~~~  289 (597)
T 2xpi_A          271 LRSLYMLKLNKTSHEDELR  289 (597)
T ss_dssp             HHHHHHTTSCTTTTHHHHH
T ss_pred             HHHHHHHHHHHHcCcchHH
Confidence            7888888877776654433



>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query140
d1xnfa_ 259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 97.6
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 97.47
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 97.43
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 97.39
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 97.35
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.12
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 97.08
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 96.96
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 96.95
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 96.94
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 96.93
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 96.74
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 96.74
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 96.73
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 96.57
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 96.52
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 96.48
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 96.47
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 96.44
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 96.41
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 96.41
d1w3ba_ 388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 96.22
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 96.16
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 96.01
d1fcha_ 323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 95.9
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 95.9
d2h6fa1 315 Protein farnesyltransferase alpha-subunit {Human ( 95.64
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 95.63
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 95.45
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 95.25
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 95.13
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 95.1
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 94.98
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 94.98
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 93.88
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 93.14
d1hz4a_ 366 Transcription factor MalT domain III {Escherichia 92.95
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 92.46
d1dcea1 334 Rab geranylgeranyltransferase alpha-subunit, N-ter 91.01
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 89.88
d1hz4a_366 Transcription factor MalT domain III {Escherichia 89.51
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 88.81
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 85.88
d1zbpa1 264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 85.54
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 84.5
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: Lipoprotein NlpI
species: Escherichia coli [TaxId: 562]
Probab=97.60  E-value=6e-05  Score=53.58  Aligned_cols=46  Identities=26%  Similarity=0.269  Sum_probs=40.2

Q ss_pred             HHHHHHHHHHHHHHcCCHHHHHHHHHHHHhcCCCcHHHHHHHHHcc
Q 032443           36 SSAICFLRGKAYEALGNCAQARLWYKAAIIADPLCYEALECLIENH   81 (140)
Q Consensus        36 ~ssmc~LRGk~yeal~N~~~A~~~YkeAL~~Dv~CyEAFe~Lv~~~   81 (140)
                      .|.+.|.||.+|..+|++++|..+|++||.+||.+.+|+..|=.-+
T Consensus        36 ~a~~~~~~G~~y~~~g~~~~A~~~~~~al~l~p~~~~a~~~lg~~~   81 (259)
T d1xnfa_          36 RAQLLYERGVLYDSLGLRALARNDFSQALAIRPDMPEVFNYLGIYL   81 (259)
T ss_dssp             HHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCCCCHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHCCCHHHHHHHHHHhhccCCCCHHHHhhhchHH
Confidence            6778899999999999999999999999999999999987664433



>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure