Citrus Sinensis ID: 032443
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 140 | ||||||
| 356517052 | 545 | PREDICTED: anaphase-promoting complex su | 0.814 | 0.209 | 0.859 | 3e-50 | |
| 225461701 | 545 | PREDICTED: anaphase-promoting complex su | 0.814 | 0.209 | 0.877 | 8e-50 | |
| 356545461 | 547 | PREDICTED: anaphase-promoting complex su | 0.814 | 0.208 | 0.850 | 2e-49 | |
| 224116978 | 542 | predicted protein [Populus trichocarpa] | 0.814 | 0.210 | 0.850 | 3e-49 | |
| 255578574 | 469 | cell division cycle, putative [Ricinus c | 0.814 | 0.243 | 0.824 | 1e-48 | |
| 255565311 | 655 | cell division cycle, putative [Ricinus c | 0.814 | 0.174 | 0.824 | 2e-47 | |
| 449480915 | 497 | PREDICTED: LOW QUALITY PROTEIN: anaphase | 0.814 | 0.229 | 0.789 | 8e-45 | |
| 449457307 | 547 | PREDICTED: anaphase-promoting complex su | 0.814 | 0.208 | 0.789 | 1e-44 | |
| 326530103 | 584 | predicted protein [Hordeum vulgare subsp | 0.814 | 0.195 | 0.728 | 2e-41 | |
| 297839749 | 543 | cell division cycle family protein [Arab | 0.814 | 0.209 | 0.824 | 2e-40 |
| >gi|356517052|ref|XP_003527204.1| PREDICTED: anaphase-promoting complex subunit 6-like [Glycine max] | Back alignment and taxonomy information |
|---|
Score = 202 bits (515), Expect = 3e-50, Method: Compositional matrix adjust.
Identities = 98/114 (85%), Positives = 105/114 (92%)
Query: 1 MLGDAKVDEDGNVYDTKDINVMYLDKDGEDGEINISSAICFLRGKAYEALGNCAQARLWY 60
MLG+AKVD+DGNVYD KD NVMYLDKD ED EINISSAICFLRGKAYEAL N AQAR+WY
Sbjct: 94 MLGEAKVDDDGNVYDMKDSNVMYLDKDCEDREINISSAICFLRGKAYEALENRAQARMWY 153
Query: 61 KAAIIADPLCYEALECLIENHMLTCEQETSLLSSLEFGFEDGWLSSFYSCLIKK 114
KAAI ADPLCYEALECLIENHMLTCE+E +L+SSL+FG EDGWLSSFYSCLIKK
Sbjct: 154 KAAIKADPLCYEALECLIENHMLTCEEEANLISSLQFGSEDGWLSSFYSCLIKK 207
|
Source: Glycine max Species: Glycine max Genus: Glycine Family: Fabaceae Order: Fabales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225461701|ref|XP_002283201.1| PREDICTED: anaphase-promoting complex subunit 6 [Vitis vinifera] gi|302142883|emb|CBI20178.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356545461|ref|XP_003541161.1| PREDICTED: anaphase-promoting complex subunit 6-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|224116978|ref|XP_002331799.1| predicted protein [Populus trichocarpa] gi|222874495|gb|EEF11626.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255578574|ref|XP_002530149.1| cell division cycle, putative [Ricinus communis] gi|223530348|gb|EEF32241.1| cell division cycle, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|255565311|ref|XP_002523647.1| cell division cycle, putative [Ricinus communis] gi|223537099|gb|EEF38733.1| cell division cycle, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|449480915|ref|XP_004156029.1| PREDICTED: LOW QUALITY PROTEIN: anaphase-promoting complex subunit 6-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449457307|ref|XP_004146390.1| PREDICTED: anaphase-promoting complex subunit 6-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|326530103|dbj|BAK08331.1| predicted protein [Hordeum vulgare subsp. vulgare] | Back alignment and taxonomy information |
|---|
| >gi|297839749|ref|XP_002887756.1| cell division cycle family protein [Arabidopsis lyrata subsp. lyrata] gi|297333597|gb|EFH64015.1| cell division cycle family protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 140 | ||||||
| TAIR|locus:2037523 | 543 | APC6 "anaphase promoting compl | 0.814 | 0.209 | 0.815 | 7.1e-45 | |
| DICTYBASE|DDB_G0286233 | 865 | anapc6 "anaphase promoting com | 0.571 | 0.092 | 0.437 | 2.9e-14 | |
| POMBASE|SPAC6F12.15c | 671 | cut9 "anaphase-promoting compl | 0.685 | 0.143 | 0.346 | 6.8e-11 | |
| UNIPROTKB|E2R5H6 | 620 | CDC16 "Uncharacterized protein | 0.492 | 0.111 | 0.478 | 2.1e-10 | |
| UNIPROTKB|Q7Z651 | 526 | CDC16 "CDC16 cell division cyc | 0.492 | 0.131 | 0.463 | 5.5e-10 | |
| UNIPROTKB|E1BPM5 | 620 | CDC16 "Uncharacterized protein | 0.492 | 0.111 | 0.463 | 7.1e-10 | |
| UNIPROTKB|Q13042 | 620 | CDC16 "Cell division cycle pro | 0.492 | 0.111 | 0.463 | 7.1e-10 | |
| UNIPROTKB|I3L944 | 620 | CDC16 "Uncharacterized protein | 0.492 | 0.111 | 0.463 | 7.1e-10 | |
| MGI|MGI:1917207 | 620 | Cdc16 "CDC16 cell division cyc | 0.492 | 0.111 | 0.463 | 7.1e-10 | |
| RGD|1305076 | 620 | Cdc16 "cell division cycle 16" | 0.492 | 0.111 | 0.463 | 7.1e-10 |
| TAIR|locus:2037523 APC6 "anaphase promoting complex 6" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 472 (171.2 bits), Expect = 7.1e-45, P = 7.1e-45
Identities = 93/114 (81%), Positives = 100/114 (87%)
Query: 1 MLGDAKVDEDGNVYDTKDINVMYLDKDGEDGEINISSAICFLRGKAYEALGNCAQARLWY 60
MLGDAKVD+DG VYD KD NV+ DKDGED EINISSAICFLRGKAY AL N +QAR WY
Sbjct: 94 MLGDAKVDDDGIVYDAKDGNVIDFDKDGEDREINISSAICFLRGKAYGALQNRSQARQWY 153
Query: 61 KAAIIADPLCYEALECLIENHMLTCEQETSLLSSLEFGFEDGWLSSFYSCLIKK 114
KAAI ADPLCYEALECLIE+HMLT E+E+SLLSSL+F EDGWLSSFYSCLIKK
Sbjct: 154 KAAIKADPLCYEALECLIESHMLTSEEESSLLSSLQFSPEDGWLSSFYSCLIKK 207
|
|
| DICTYBASE|DDB_G0286233 anapc6 "anaphase promoting complex subunit 6" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| POMBASE|SPAC6F12.15c cut9 "anaphase-promoting complex subunit Cut9" [Schizosaccharomyces pombe (taxid:4896)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2R5H6 CDC16 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q7Z651 CDC16 "CDC16 cell division cycle 16 homolog (S. cerevisiae), isoform CRA_h" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BPM5 CDC16 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q13042 CDC16 "Cell division cycle protein 16 homolog" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3L944 CDC16 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1917207 Cdc16 "CDC16 cell division cycle 16" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1305076 Cdc16 "cell division cycle 16" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 140 | |||
| KOG1173 | 611 | consensus Anaphase-promoting complex (APC), Cdc16 | 99.92 | |
| PF00515 | 34 | TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 | 98.17 | |
| PF07719 | 34 | TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 | 97.91 | |
| PF13181 | 34 | TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ | 97.85 | |
| PF13428 | 44 | TPR_14: Tetratricopeptide repeat | 97.45 | |
| PF13414 | 69 | TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A | 97.44 | |
| smart00028 | 34 | TPR Tetratricopeptide repeats. Repeats present in | 97.14 | |
| PF13176 | 36 | TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ | 96.98 | |
| PF13414 | 69 | TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A | 96.69 | |
| PF13432 | 65 | TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL | 96.32 | |
| PF13432 | 65 | TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL | 95.6 | |
| PF13429 | 280 | TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 | 95.3 | |
| PRK11189 | 296 | lipoprotein NlpI; Provisional | 95.07 | |
| KOG4162 | 799 | consensus Predicted calmodulin-binding protein [Si | 95.05 | |
| PF13371 | 73 | TPR_9: Tetratricopeptide repeat | 95.03 | |
| cd00189 | 100 | TPR Tetratricopeptide repeat domain; typically con | 94.49 | |
| cd00189 | 100 | TPR Tetratricopeptide repeat domain; typically con | 94.26 | |
| TIGR02552 | 135 | LcrH_SycD type III secretion low calcium response | 94.16 | |
| PLN03088 | 356 | SGT1, suppressor of G2 allele of SKP1; Provisional | 94.02 | |
| PRK11189 | 296 | lipoprotein NlpI; Provisional | 93.98 | |
| PF13374 | 42 | TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT | 93.95 | |
| PRK15359 | 144 | type III secretion system chaperone protein SscB; | 93.94 | |
| KOG0553 | 304 | consensus TPR repeat-containing protein [General f | 93.9 | |
| PF13424 | 78 | TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 | 93.71 | |
| PRK15359 | 144 | type III secretion system chaperone protein SscB; | 93.5 | |
| PRK10370 | 198 | formate-dependent nitrite reductase complex subuni | 93.48 | |
| PF09976 | 145 | TPR_21: Tetratricopeptide repeat; InterPro: IPR018 | 93.32 | |
| PF13174 | 33 | TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ | 93.16 | |
| PF14853 | 53 | Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe | 92.56 | |
| PRK02603 | 172 | photosystem I assembly protein Ycf3; Provisional | 92.55 | |
| TIGR02552 | 135 | LcrH_SycD type III secretion low calcium response | 92.11 | |
| PLN03088 | 356 | SGT1, suppressor of G2 allele of SKP1; Provisional | 91.91 | |
| KOG1129 | 478 | consensus TPR repeat-containing protein [General f | 91.76 | |
| PF13424 | 78 | TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 | 91.36 | |
| KOG4626 | 966 | consensus O-linked N-acetylglucosamine transferase | 91.1 | |
| TIGR00990 | 615 | 3a0801s09 mitochondrial precursor proteins import | 91.09 | |
| TIGR00990 | 615 | 3a0801s09 mitochondrial precursor proteins import | 90.94 | |
| TIGR02521 | 234 | type_IV_pilW type IV pilus biogenesis/stability pr | 90.85 | |
| PRK10153 | 517 | DNA-binding transcriptional activator CadC; Provis | 90.81 | |
| PF14559 | 68 | TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN | 90.49 | |
| TIGR02795 | 119 | tol_pal_ybgF tol-pal system protein YbgF. Members | 90.48 | |
| KOG0543 | 397 | consensus FKBP-type peptidyl-prolyl cis-trans isom | 90.3 | |
| TIGR02521 | 234 | type_IV_pilW type IV pilus biogenesis/stability pr | 90.19 | |
| TIGR02917 | 899 | PEP_TPR_lipo putative PEP-CTERM system TPR-repeat | 90.01 | |
| PRK15363 | 157 | pathogenicity island 2 chaperone protein SscA; Pro | 89.65 | |
| PRK12370 | 553 | invasion protein regulator; Provisional | 89.41 | |
| PF12895 | 84 | Apc3: Anaphase-promoting complex, cyclosome, subun | 89.17 | |
| KOG2002 | 1018 | consensus TPR-containing nuclear phosphoprotein th | 88.96 | |
| KOG1155 | 559 | consensus Anaphase-promoting complex (APC), Cdc23 | 88.83 | |
| PRK14720 | 906 | transcript cleavage factor/unknown domain fusion p | 88.67 | |
| CHL00033 | 168 | ycf3 photosystem I assembly protein Ycf3 | 88.67 | |
| PRK10153 | 517 | DNA-binding transcriptional activator CadC; Provis | 88.65 | |
| KOG1125 | 579 | consensus TPR repeat-containing protein [General f | 88.21 | |
| PRK11788 | 389 | tetratricopeptide repeat protein; Provisional | 88.08 | |
| KOG0553 | 304 | consensus TPR repeat-containing protein [General f | 87.97 | |
| PF13431 | 34 | TPR_17: Tetratricopeptide repeat | 87.9 | |
| KOG1125 | 579 | consensus TPR repeat-containing protein [General f | 87.83 | |
| PRK12370 | 553 | invasion protein regulator; Provisional | 87.75 | |
| KOG1127 | 1238 | consensus TPR repeat-containing protein [RNA proce | 87.47 | |
| KOG0550 | 486 | consensus Molecular chaperone (DnaJ superfamily) [ | 87.25 | |
| PLN02789 | 320 | farnesyltranstransferase | 87.25 | |
| COG3063 | 250 | PilF Tfp pilus assembly protein PilF [Cell motilit | 87.07 | |
| PRK09782 | 987 | bacteriophage N4 receptor, outer membrane subunit; | 87.03 | |
| KOG4162 | 799 | consensus Predicted calmodulin-binding protein [Si | 86.73 | |
| KOG4507 | 886 | consensus Uncharacterized conserved protein, conta | 86.2 | |
| PRK02603 | 172 | photosystem I assembly protein Ycf3; Provisional | 86.16 | |
| TIGR02917 | 899 | PEP_TPR_lipo putative PEP-CTERM system TPR-repeat | 86.03 | |
| TIGR02795 | 119 | tol_pal_ybgF tol-pal system protein YbgF. Members | 85.82 | |
| PLN02789 | 320 | farnesyltranstransferase | 85.56 | |
| COG4235 | 287 | Cytochrome c biogenesis factor [Posttranslational | 85.44 | |
| PRK11447 | 1157 | cellulose synthase subunit BcsC; Provisional | 85.29 | |
| KOG2002 | 1018 | consensus TPR-containing nuclear phosphoprotein th | 85.28 | |
| PF13371 | 73 | TPR_9: Tetratricopeptide repeat | 84.98 | |
| PF14559 | 68 | TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN | 84.79 | |
| PLN03098 | 453 | LPA1 LOW PSII ACCUMULATION1; Provisional | 83.67 | |
| KOG0548 | 539 | consensus Molecular co-chaperone STI1 [Posttransla | 83.55 | |
| PRK11788 | 389 | tetratricopeptide repeat protein; Provisional | 83.27 | |
| KOG1126 | 638 | consensus DNA-binding cell division cycle control | 83.06 | |
| PF14929 | 547 | TAF1_subA: TAF RNA Polymerase I subunit A | 82.85 | |
| PF04212 | 69 | MIT: MIT (microtubule interacting and transport) d | 82.48 | |
| KOG1155 | 559 | consensus Anaphase-promoting complex (APC), Cdc23 | 82.44 | |
| PF04733 | 290 | Coatomer_E: Coatomer epsilon subunit; InterPro: IP | 82.4 | |
| COG2976 | 207 | Uncharacterized protein conserved in bacteria [Fun | 82.26 | |
| KOG2076 | 895 | consensus RNA polymerase III transcription factor | 82.22 | |
| COG4785 | 297 | NlpI Lipoprotein NlpI, contains TPR repeats [Gener | 81.97 | |
| COG3063 | 250 | PilF Tfp pilus assembly protein PilF [Cell motilit | 81.86 | |
| PRK15363 | 157 | pathogenicity island 2 chaperone protein SscA; Pro | 81.85 | |
| PF03704 | 146 | BTAD: Bacterial transcriptional activator domain; | 81.42 | |
| CHL00033 | 168 | ycf3 photosystem I assembly protein Ycf3 | 81.05 | |
| KOG4626 | 966 | consensus O-linked N-acetylglucosamine transferase | 80.75 | |
| PRK11447 | 1157 | cellulose synthase subunit BcsC; Provisional | 80.4 | |
| COG2956 | 389 | Predicted N-acetylglucosaminyl transferase [Carboh | 80.3 |
| >KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=99.92 E-value=2.6e-26 Score=207.50 Aligned_cols=133 Identities=38% Similarity=0.539 Sum_probs=116.8
Q ss_pred CCCCcccccCCCcccccc-cchhccCCCCCCCchhHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHhcCCCcHHHHHHHHH
Q 032443 1 MLGDAKVDEDGNVYDTKD-INVMYLDKDGEDGEINISSAICFLRGKAYEALGNCAQARLWYKAAIIADPLCYEALECLIE 79 (140)
Q Consensus 1 ~l~~~~~~~~g~v~~~~~-~~~~~~~~~~~d~gikl~ssmc~LRGk~yeal~N~~~A~~~YkeAL~~Dv~CyEAFe~Lv~ 79 (140)
+||+.+++..+-..++.+ ++.+..+...++++|+++|||||||||+|.+++||++|++||++||..|++|||||++||+
T Consensus 104 vl~~~~~~~~~f~yy~~~~~~~l~~n~~~~~~~~~~essic~lRgk~y~al~n~~~ar~~Y~~Al~~D~~c~Ea~~~lvs 183 (611)
T KOG1173|consen 104 VLGRGHVETNPFSYYEKDAANTLELNSAGEDLMINLESSICYLRGKVYVALDNREEARDKYKEALLADAKCFEAFEKLVS 183 (611)
T ss_pred HhcccchhhcchhhcchhhhceeccCcccccccccchhceeeeeeehhhhhccHHHHHHHHHHHHhcchhhHHHHHHHHH
Confidence 466667778888888888 8999999999999999999999999999999999999999999999999999999999999
Q ss_pred ccCCCHHHHHHHHhcCCCCc----hhHHHHHHHHHhhhccCCCcchhhhhccceeeecc
Q 032443 80 NHMLTCEQETSLLSSLEFGF----EDGWLSSFYSCLIKKCRRYPFSGAIVHNILLRQVS 134 (140)
Q Consensus 80 ~~lLt~~EE~eLl~sL~f~~----e~~~lk~lY~srL~Ky~~~~~~~~~~~~~~~~~~~ 134 (140)
+||||++|||+|+.+||++. +.+.++.+|..++.|+.+....- ..|+.++-.+.
T Consensus 184 ~~mlt~~Ee~~ll~~l~~a~~~~ed~e~l~~lyel~~~k~~n~~~~~-r~~~~sl~~l~ 241 (611)
T KOG1173|consen 184 AHMLTAQEEFELLESLDLAMLTKEDVERLEILYELKLCKNRNEESLT-RNEDESLIGLA 241 (611)
T ss_pred HHhcchhHHHHHHhcccHHhhhhhHHHHHHHHHHhhhhhhccccccc-cCchhhhhhhh
Confidence 99999999999999999983 66899999999988888776552 35555443333
|
|
| >PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A | Back alignment and domain information |
|---|
| >PF13428 TPR_14: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A | Back alignment and domain information |
|---|
| >smart00028 TPR Tetratricopeptide repeats | Back alignment and domain information |
|---|
| >PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A | Back alignment and domain information |
|---|
| >PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A | Back alignment and domain information |
|---|
| >PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B | Back alignment and domain information |
|---|
| >PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B | Back alignment and domain information |
|---|
| >PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B | Back alignment and domain information |
|---|
| >PRK11189 lipoprotein NlpI; Provisional | Back alignment and domain information |
|---|
| >KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13371 TPR_9: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C | Back alignment and domain information |
|---|
| >cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C | Back alignment and domain information |
|---|
| >TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD | Back alignment and domain information |
|---|
| >PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional | Back alignment and domain information |
|---|
| >PRK11189 lipoprotein NlpI; Provisional | Back alignment and domain information |
|---|
| >PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A | Back alignment and domain information |
|---|
| >PRK15359 type III secretion system chaperone protein SscB; Provisional | Back alignment and domain information |
|---|
| >KOG0553 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H | Back alignment and domain information |
|---|
| >PRK15359 type III secretion system chaperone protein SscB; Provisional | Back alignment and domain information |
|---|
| >PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional | Back alignment and domain information |
|---|
| >PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function | Back alignment and domain information |
|---|
| >PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A | Back alignment and domain information |
|---|
| >PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A | Back alignment and domain information |
|---|
| >PRK02603 photosystem I assembly protein Ycf3; Provisional | Back alignment and domain information |
|---|
| >TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD | Back alignment and domain information |
|---|
| >PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional | Back alignment and domain information |
|---|
| >KOG1129 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H | Back alignment and domain information |
|---|
| >KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) | Back alignment and domain information |
|---|
| >TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) | Back alignment and domain information |
|---|
| >TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW | Back alignment and domain information |
|---|
| >PRK10153 DNA-binding transcriptional activator CadC; Provisional | Back alignment and domain information |
|---|
| >PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A | Back alignment and domain information |
|---|
| >TIGR02795 tol_pal_ybgF tol-pal system protein YbgF | Back alignment and domain information |
|---|
| >KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW | Back alignment and domain information |
|---|
| >TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional | Back alignment and domain information |
|---|
| >PRK12370 invasion protein regulator; Provisional | Back alignment and domain information |
|---|
| >PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A | Back alignment and domain information |
|---|
| >KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional | Back alignment and domain information |
|---|
| >CHL00033 ycf3 photosystem I assembly protein Ycf3 | Back alignment and domain information |
|---|
| >PRK10153 DNA-binding transcriptional activator CadC; Provisional | Back alignment and domain information |
|---|
| >KOG1125 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11788 tetratricopeptide repeat protein; Provisional | Back alignment and domain information |
|---|
| >KOG0553 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF13431 TPR_17: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >KOG1125 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK12370 invasion protein regulator; Provisional | Back alignment and domain information |
|---|
| >KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN02789 farnesyltranstransferase | Back alignment and domain information |
|---|
| >COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional | Back alignment and domain information |
|---|
| >KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] | Back alignment and domain information |
|---|
| >PRK02603 photosystem I assembly protein Ycf3; Provisional | Back alignment and domain information |
|---|
| >TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >TIGR02795 tol_pal_ybgF tol-pal system protein YbgF | Back alignment and domain information |
|---|
| >PLN02789 farnesyltranstransferase | Back alignment and domain information |
|---|
| >COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK11447 cellulose synthase subunit BcsC; Provisional | Back alignment and domain information |
|---|
| >KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF13371 TPR_9: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A | Back alignment and domain information |
|---|
| >PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional | Back alignment and domain information |
|---|
| >KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK11788 tetratricopeptide repeat protein; Provisional | Back alignment and domain information |
|---|
| >KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF14929 TAF1_subA: TAF RNA Polymerase I subunit A | Back alignment and domain information |
|---|
| >PF04212 MIT: MIT (microtubule interacting and transport) domain; InterPro: IPR007330 The MIT domain is found in vacuolar sorting proteins, spastin (probable ATPase involved in the assembly or function of nuclear protein complexes), and a sorting nexin, which may play a role in intracellular trafficking | Back alignment and domain information |
|---|
| >KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment | Back alignment and domain information |
|---|
| >COG2976 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] | Back alignment and domain information |
|---|
| >COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional | Back alignment and domain information |
|---|
| >PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production | Back alignment and domain information |
|---|
| >CHL00033 ycf3 photosystem I assembly protein Ycf3 | Back alignment and domain information |
|---|
| >KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK11447 cellulose synthase subunit BcsC; Provisional | Back alignment and domain information |
|---|
| >COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 140 | ||||
| 2xpi_A | 597 | Crystal Structure Of ApcC HETERO-Tetramer Cut9-Hcn1 | 6e-11 |
| >pdb|2XPI|A Chain A, Crystal Structure Of ApcC HETERO-Tetramer Cut9-Hcn1 Length = 597 | Back alignment and structure |
|
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 140 | |||
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 6e-15 |
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 | Back alignment and structure |
|---|
Score = 69.1 bits (169), Expect = 6e-15
Identities = 29/86 (33%), Positives = 49/86 (56%)
Query: 29 EDGEINISSAICFLRGKAYEALGNCAQARLWYKAAIIADPLCYEALECLIENHMLTCEQE 88
+DG I + +++C+LRG+ Y L N +A+ YK A++ D CYEA + L+ NH+LT ++E
Sbjct: 192 QDGGIKLEASMCYLRGQVYTNLSNFDRAKECYKEALMVDAKCYEAFDQLVSNHLLTADEE 251
Query: 89 TSLLSSLEFGFEDGWLSSFYSCLIKK 114
L+ L + ++F L
Sbjct: 252 WDLVLKLNYSTYSKEDAAFLRSLYML 277
|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 140 | |||
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 97.9 | |
| 3vtx_A | 184 | MAMA; tetratricopeptide repeats (TPR) containing p | 97.6 | |
| 4gco_A | 126 | Protein STI-1; structural genomics, PSI-biology, m | 97.49 | |
| 4gco_A | 126 | Protein STI-1; structural genomics, PSI-biology, m | 97.13 | |
| 4ga2_A | 150 | E3 SUMO-protein ligase ranbp2; TPR motif, nuclear | 97.06 | |
| 4ga2_A | 150 | E3 SUMO-protein ligase ranbp2; TPR motif, nuclear | 96.99 | |
| 2kc7_A | 99 | BFR218_protein; tetratricopeptide repeat, all-alph | 96.95 | |
| 1na3_A | 91 | Designed protein CTPR2; de novo protein; HET: IPT; | 96.85 | |
| 3upv_A | 126 | Heat shock protein STI1; TPR-fold, adaptor protein | 96.83 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 96.75 | |
| 1na3_A | 91 | Designed protein CTPR2; de novo protein; HET: IPT; | 96.75 | |
| 3vtx_A | 184 | MAMA; tetratricopeptide repeats (TPR) containing p | 96.74 | |
| 3rkv_A | 162 | Putative peptidylprolyl isomerase; structural geno | 96.72 | |
| 3rkv_A | 162 | Putative peptidylprolyl isomerase; structural geno | 96.72 | |
| 2l6j_A | 111 | TPR repeat-containing protein associated with HSP; | 96.72 | |
| 1hxi_A | 121 | PEX5, peroxisome targeting signal 1 receptor PEX5; | 96.69 | |
| 3ma5_A | 100 | Tetratricopeptide repeat domain protein; NESG, str | 96.67 | |
| 3sz7_A | 164 | HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G | 96.65 | |
| 2l6j_A | 111 | TPR repeat-containing protein associated with HSP; | 96.61 | |
| 3q49_B | 137 | STIP1 homology and U box-containing protein 1; E3 | 96.49 | |
| 2kck_A | 112 | TPR repeat; tetratricopeptide repeat, structural g | 96.44 | |
| 3upv_A | 126 | Heat shock protein STI1; TPR-fold, adaptor protein | 96.43 | |
| 2dba_A | 148 | Smooth muscle cell associated protein-1, isoform 2 | 96.42 | |
| 2kat_A | 115 | Uncharacterized protein; NESG, structure, structur | 96.39 | |
| 1elw_A | 118 | TPR1-domain of HOP; HOP, TPR-domain, peptide-compl | 96.33 | |
| 2vyi_A | 131 | SGTA protein; chaperone, TPR repeat, phosphoprotei | 96.32 | |
| 3k9i_A | 117 | BH0479 protein; putative protein binding protein, | 96.3 | |
| 2lni_A | 133 | Stress-induced-phosphoprotein 1; structural genomi | 96.27 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 96.26 | |
| 2fbn_A | 198 | 70 kDa peptidylprolyl isomerase, putative; sulfur | 96.21 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 96.19 | |
| 3gyz_A | 151 | Chaperone protein IPGC; asymmetric homodimer, tetr | 96.19 | |
| 3sz7_A | 164 | HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G | 96.18 | |
| 3q49_B | 137 | STIP1 homology and U box-containing protein 1; E3 | 96.17 | |
| 4gcn_A | 127 | Protein STI-1; structural genomics, PSI-biology, m | 96.07 | |
| 2vgx_A | 148 | Chaperone SYCD; alternative dimer assembly, tetrat | 96.06 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 96.05 | |
| 1hxi_A | 121 | PEX5, peroxisome targeting signal 1 receptor PEX5; | 96.04 | |
| 1elw_A | 118 | TPR1-domain of HOP; HOP, TPR-domain, peptide-compl | 95.94 | |
| 2fbn_A | 198 | 70 kDa peptidylprolyl isomerase, putative; sulfur | 95.94 | |
| 2vyi_A | 131 | SGTA protein; chaperone, TPR repeat, phosphoprotei | 95.8 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 95.79 | |
| 2lni_A | 133 | Stress-induced-phosphoprotein 1; structural genomi | 95.78 | |
| 1a17_A | 166 | Serine/threonine protein phosphatase 5; hydrolase, | 95.76 | |
| 1na0_A | 125 | Designed protein CTPR3; de novo protein; HET: IPT; | 95.75 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 95.75 | |
| 2dba_A | 148 | Smooth muscle cell associated protein-1, isoform 2 | 95.72 | |
| 2kc7_A | 99 | BFR218_protein; tetratricopeptide repeat, all-alph | 95.7 | |
| 1elr_A | 131 | TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp | 95.68 | |
| 4i17_A | 228 | Hypothetical protein; TPR repeats protein, structu | 95.67 | |
| 1p5q_A | 336 | FKBP52, FK506-binding protein 4; isomerase; 2.80A | 95.67 | |
| 2xev_A | 129 | YBGF; tetratricopeptide, alpha-helical, metal bind | 95.67 | |
| 1a17_A | 166 | Serine/threonine protein phosphatase 5; hydrolase, | 95.66 | |
| 4i17_A | 228 | Hypothetical protein; TPR repeats protein, structu | 95.64 | |
| 2v5f_A | 104 | Prolyl 4-hydroxylase subunit alpha-1; endoplasmic | 95.63 | |
| 3gyz_A | 151 | Chaperone protein IPGC; asymmetric homodimer, tetr | 95.61 | |
| 4gcn_A | 127 | Protein STI-1; structural genomics, PSI-biology, m | 95.6 | |
| 2h6f_A | 382 | Protein farnesyltransferase/geranylgeranyltransfer | 95.58 | |
| 2e2e_A | 177 | Formate-dependent nitrite reductase complex NRFG; | 95.56 | |
| 1na0_A | 125 | Designed protein CTPR3; de novo protein; HET: IPT; | 95.55 | |
| 2xev_A | 129 | YBGF; tetratricopeptide, alpha-helical, metal bind | 95.54 | |
| 2kck_A | 112 | TPR repeat; tetratricopeptide repeat, structural g | 95.53 | |
| 1p5q_A | 336 | FKBP52, FK506-binding protein 4; isomerase; 2.80A | 95.47 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 95.41 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 95.37 | |
| 1elr_A | 131 | TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp | 95.34 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 95.29 | |
| 3mkr_A | 291 | Coatomer subunit epsilon; tetratricopeptide repeat | 95.24 | |
| 1kt0_A | 457 | FKBP51, 51 kDa FK506-binding protein; FKBP-like pp | 95.16 | |
| 2vgx_A | 148 | Chaperone SYCD; alternative dimer assembly, tetrat | 95.11 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 95.08 | |
| 2h6f_A | 382 | Protein farnesyltransferase/geranylgeranyltransfer | 95.04 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 94.99 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 94.95 | |
| 1kt0_A | 457 | FKBP51, 51 kDa FK506-binding protein; FKBP-like pp | 94.89 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 94.88 | |
| 1ihg_A | 370 | Cyclophilin 40; ppiase immunophilin tetratricopept | 94.79 | |
| 2v5f_A | 104 | Prolyl 4-hydroxylase subunit alpha-1; endoplasmic | 94.79 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 94.74 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 94.71 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 94.62 | |
| 1zu2_A | 158 | Mitochondrial import receptor subunit TOM20-3; TPR | 94.62 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 94.58 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 94.56 | |
| 1pc2_A | 152 | Mitochondria fission protein; unknown function; NM | 94.51 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 94.51 | |
| 2if4_A | 338 | ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, | 94.41 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 94.4 | |
| 3ma5_A | 100 | Tetratricopeptide repeat domain protein; NESG, str | 94.4 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 94.38 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 94.35 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 94.3 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 94.24 | |
| 2if4_A | 338 | ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, | 94.19 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 94.13 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 94.07 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 94.04 | |
| 1ihg_A | 370 | Cyclophilin 40; ppiase immunophilin tetratricopept | 94.02 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 94.0 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 93.96 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 93.94 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 93.89 | |
| 3bee_A | 93 | Putative YFRE protein; putaive YFRE protein, struc | 93.89 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 93.87 | |
| 4gyw_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 93.69 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 93.67 | |
| 2hr2_A | 159 | Hypothetical protein; alpha-alpha superhelix fold, | 93.58 | |
| 2e2e_A | 177 | Formate-dependent nitrite reductase complex NRFG; | 93.42 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 93.4 | |
| 2hr2_A | 159 | Hypothetical protein; alpha-alpha superhelix fold, | 93.4 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 93.35 | |
| 2r5s_A | 176 | Uncharacterized protein VP0806; APC090868.1, vibri | 93.2 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 93.18 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 93.17 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 93.16 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 93.16 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 93.16 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 93.15 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 93.12 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 93.12 | |
| 4gyw_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 93.11 | |
| 3k9i_A | 117 | BH0479 protein; putative protein binding protein, | 93.1 | |
| 2kat_A | 115 | Uncharacterized protein; NESG, structure, structur | 93.09 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 92.98 | |
| 1zu2_A | 158 | Mitochondrial import receptor subunit TOM20-3; TPR | 92.97 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 92.88 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 92.77 | |
| 1wao_1 | 477 | Serine/threonine protein phosphatase 5; hydrolase, | 92.77 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 92.68 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 92.63 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 92.17 | |
| 1wao_1 | 477 | Serine/threonine protein phosphatase 5; hydrolase, | 91.7 | |
| 3qky_A | 261 | Outer membrane assembly lipoprotein YFIO; membrane | 91.6 | |
| 2ond_A | 308 | Cleavage stimulation factor 77 kDa subunit; HAT do | 91.6 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 91.5 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 91.31 | |
| 2r5s_A | 176 | Uncharacterized protein VP0806; APC090868.1, vibri | 91.31 | |
| 3ro2_A | 338 | PINS homolog, G-protein-signaling modulator 2; TPR | 91.09 | |
| 3ly7_A | 372 | Transcriptional activator CADC; alpha/beta domain, | 91.07 | |
| 2yhc_A | 225 | BAMD, UPF0169 lipoprotein YFIO; essential BAM comp | 90.92 | |
| 3qky_A | 261 | Outer membrane assembly lipoprotein YFIO; membrane | 90.9 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 90.82 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 90.78 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 90.65 | |
| 3qou_A | 287 | Protein YBBN; thioredoxin-like fold, tetratricopep | 90.39 | |
| 3nf1_A | 311 | KLC 1, kinesin light chain 1; TPR, structural geno | 90.08 | |
| 3edt_B | 283 | KLC 2, kinesin light chain 2; superhelical, struct | 89.95 | |
| 4f3v_A | 282 | ESX-1 secretion system protein ECCA1; tetratricope | 89.88 | |
| 3ro3_A | 164 | PINS homolog, G-protein-signaling modulator 2; asy | 89.24 | |
| 1nzn_A | 126 | CGI-135 protein, fission protein FIS1P; TPR, unkno | 89.19 | |
| 3ro3_A | 164 | PINS homolog, G-protein-signaling modulator 2; asy | 89.11 | |
| 3dra_A | 306 | Protein farnesyltransferase/geranylgeranyltransfer | 88.86 | |
| 3qou_A | 287 | Protein YBBN; thioredoxin-like fold, tetratricopep | 88.7 | |
| 3q7a_A | 349 | Farnesyltransferase alpha subunit; protein prenylt | 88.63 | |
| 1ouv_A | 273 | Conserved hypothetical secreted protein; TPR repea | 88.51 | |
| 3bee_A | 93 | Putative YFRE protein; putaive YFRE protein, struc | 88.26 | |
| 1qqe_A | 292 | Vesicular transport protein SEC17; helix-turn-heli | 88.17 | |
| 3edt_B | 283 | KLC 2, kinesin light chain 2; superhelical, struct | 87.99 | |
| 3sf4_A | 406 | G-protein-signaling modulator 2; tetratricopeptide | 87.8 | |
| 1qqe_A | 292 | Vesicular transport protein SEC17; helix-turn-heli | 87.39 | |
| 3ro2_A | 338 | PINS homolog, G-protein-signaling modulator 2; TPR | 87.28 | |
| 3rjv_A | 212 | Putative SEL1 repeat protein; alpha-alpha superhel | 87.1 | |
| 3u3w_A | 293 | Transcriptional activator PLCR protein; ternary co | 86.77 | |
| 3nf1_A | 311 | KLC 1, kinesin light chain 1; TPR, structural geno | 86.55 | |
| 3rjv_A | 212 | Putative SEL1 repeat protein; alpha-alpha superhel | 86.51 | |
| 4a1s_A | 411 | PINS, partner of inscuteable; cell cycle, LGN, mit | 86.42 | |
| 3q15_A | 378 | PSP28, response regulator aspartate phosphatase H; | 86.41 | |
| 1ouv_A | 273 | Conserved hypothetical secreted protein; TPR repea | 86.29 | |
| 3ulq_A | 383 | Response regulator aspartate phosphatase F; tetrat | 86.16 | |
| 3gw4_A | 203 | Uncharacterized protein; structural genomics, PSI- | 86.11 | |
| 4f3v_A | 282 | ESX-1 secretion system protein ECCA1; tetratricope | 85.52 | |
| 2yhc_A | 225 | BAMD, UPF0169 lipoprotein YFIO; essential BAM comp | 85.24 | |
| 3dra_A | 306 | Protein farnesyltransferase/geranylgeranyltransfer | 85.03 | |
| 3ly7_A | 372 | Transcriptional activator CADC; alpha/beta domain, | 84.06 | |
| 3dss_A | 331 | Geranylgeranyl transferase type-2 subunit alpha; p | 83.74 | |
| 3q15_A | 378 | PSP28, response regulator aspartate phosphatase H; | 83.68 | |
| 1klx_A | 138 | Cysteine rich protein B; structural genomics, heli | 83.29 | |
| 3mkr_A | 291 | Coatomer subunit epsilon; tetratricopeptide repeat | 83.18 | |
| 2qfc_A | 293 | PLCR protein; TPR, HTH, transcription regulation; | 83.05 | |
| 4a1s_A | 411 | PINS, partner of inscuteable; cell cycle, LGN, mit | 82.95 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 82.65 | |
| 3dss_A | 331 | Geranylgeranyl transferase type-2 subunit alpha; p | 82.29 | |
| 3sf4_A | 406 | G-protein-signaling modulator 2; tetratricopeptide | 81.84 | |
| 2ifu_A | 307 | Gamma-SNAP; membrane fusion, snare complex disasse | 81.01 | |
| 3q7a_A | 349 | Farnesyltransferase alpha subunit; protein prenylt | 80.99 | |
| 1klx_A | 138 | Cysteine rich protein B; structural genomics, heli | 80.88 | |
| 3ulq_A | 383 | Response regulator aspartate phosphatase F; tetrat | 80.55 |
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
Probab=97.90 E-value=6.9e-05 Score=61.09 Aligned_cols=95 Identities=33% Similarity=0.628 Sum_probs=82.0
Q ss_pred CCCCchhHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHhcCCCcHHHHHHHHHccCCCHHHHHHHHhcCCCCc----hhHH
Q 032443 28 GEDGEINISSAICFLRGKAYEALGNCAQARLWYKAAIIADPLCYEALECLIENHMLTCEQETSLLSSLEFGF----EDGW 103 (140)
Q Consensus 28 ~~d~gikl~ssmc~LRGk~yeal~N~~~A~~~YkeAL~~Dv~CyEAFe~Lv~~~lLt~~EE~eLl~sL~f~~----e~~~ 103 (140)
..+.|+...+..++.+|.+|..+++.+.|..+|+++++.+|.+.+++..|...++.+..++++++..+.|.. ...+
T Consensus 191 ~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~p~~~~~~~~l~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~ 270 (597)
T 2xpi_A 191 MQDGGIKLEASMCYLRGQVYTNLSNFDRAKECYKEALMVDAKCYEAFDQLVSNHLLTADEEWDLVLKLNYSTYSKEDAAF 270 (597)
T ss_dssp CCCSSCCHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHTTCSCHHHHHHHHHHSCTHHHHGGGHHH
T ss_pred ccccccchhHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCchhhHHHHHHHHhhcccchhHHHHHHhcCCcccccchHHH
Confidence 345567778889999999999999999999999999999999999999999999999999999999998863 4567
Q ss_pred HHHHHHHhhhccCCCcchh
Q 032443 104 LSSFYSCLIKKCRRYPFSG 122 (140)
Q Consensus 104 lk~lY~srL~Ky~~~~~~~ 122 (140)
...+|...+.-|.....++
T Consensus 271 ~~~~~~~~~~~~~~~g~~~ 289 (597)
T 2xpi_A 271 LRSLYMLKLNKTSHEDELR 289 (597)
T ss_dssp HHHHHHTTSCTTTTHHHHH
T ss_pred HHHHHHHHHHHHcCcchHH
Confidence 7888888877776654433
|
| >3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A | Back alignment and structure |
|---|
| >4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* | Back alignment and structure |
|---|
| >4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* | Back alignment and structure |
|---|
| >2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} | Back alignment and structure |
|---|
| >1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A | Back alignment and structure |
|---|
| >3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A | Back alignment and structure |
|---|
| >3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A | Back alignment and structure |
|---|
| >3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A | Back alignment and structure |
|---|
| >3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} | Back alignment and structure |
|---|
| >2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* | Back alignment and structure |
|---|
| >2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} | Back alignment and structure |
|---|
| >1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} | Back alignment and structure |
|---|
| >2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A | Back alignment and structure |
|---|
| >3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A | Back alignment and structure |
|---|
| >3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} | Back alignment and structure |
|---|
| >3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* | Back alignment and structure |
|---|
| >4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} | Back alignment and structure |
|---|
| >2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A | Back alignment and structure |
|---|
| >1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* | Back alignment and structure |
|---|
| >2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} | Back alignment and structure |
|---|
| >1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A | Back alignment and structure |
|---|
| >4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A | Back alignment and structure |
|---|
| >2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A | Back alignment and structure |
|---|
| >4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A | Back alignment and structure |
|---|
| >3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A | Back alignment and structure |
|---|
| >4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... | Back alignment and structure |
|---|
| >2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} | Back alignment and structure |
|---|
| >1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A | Back alignment and structure |
|---|
| >2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} | Back alignment and structure |
|---|
| >1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A | Back alignment and structure |
|---|
| >2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A | Back alignment and structure |
|---|
| >2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A | Back alignment and structure |
|---|
| >2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A | Back alignment and structure |
|---|
| >2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A | Back alignment and structure |
|---|
| >3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A | Back alignment and structure |
|---|
| >4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} | Back alignment and structure |
|---|
| >2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 | Back alignment and structure |
|---|
| >2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A | Back alignment and structure |
|---|
| >2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A | Back alignment and structure |
|---|
| >4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* | Back alignment and structure |
|---|
| >3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} | Back alignment and structure |
|---|
| >2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* | Back alignment and structure |
|---|
| >1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 | Back alignment and structure |
|---|
| >3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} | Back alignment and structure |
|---|
| >2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* | Back alignment and structure |
|---|
| >2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A | Back alignment and structure |
|---|
| >2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A | Back alignment and structure |
|---|
| >3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* | Back alignment and structure |
|---|
| >3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A | Back alignment and structure |
|---|
| >4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} | Back alignment and structure |
|---|
| >1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A | Back alignment and structure |
|---|
| >3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} | Back alignment and structure |
|---|
| >3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} | Back alignment and structure |
|---|
| >3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* | Back alignment and structure |
|---|
| >3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* | Back alignment and structure |
|---|
| >1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A | Back alignment and structure |
|---|
| >3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A | Back alignment and structure |
|---|
| >3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A | Back alignment and structure |
|---|
| >3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} | Back alignment and structure |
|---|
| >3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A | Back alignment and structure |
|---|
| >3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* | Back alignment and structure |
|---|
| >3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} | Back alignment and structure |
|---|
| >2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} | Back alignment and structure |
|---|
| >4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* | Back alignment and structure |
|---|
| >3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} | Back alignment and structure |
|---|
| >3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* | Back alignment and structure |
|---|
| >1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 140 | |||
| d1xnfa_ | 259 | Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | 97.6 | |
| d2c2la1 | 201 | STIP1 homology and U box-containing protein 1, STU | 97.47 | |
| d1tjca_ | 95 | Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human | 97.43 | |
| d1hxia_ | 112 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 97.39 | |
| d1hh8a_ | 192 | Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H | 97.35 | |
| d1kt1a1 | 168 | FKBP51, C-terminal domain {Monkey (Saimiri bolivie | 97.12 | |
| d1nzna_ | 122 | Mitochondria fission protein Fis1 {Human (Homo sap | 97.08 | |
| d1w3ba_ | 388 | O-GlcNAc transferase p110 subunit, OGT {Human (Hom | 96.96 | |
| d2fbna1 | 153 | Putative 70 kda peptidylprolyl isomerase PFL2275c | 96.95 | |
| d1ihga1 | 169 | Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | 96.94 | |
| d1a17a_ | 159 | Protein phosphatase 5 {Human (Homo sapiens) [TaxId | 96.93 | |
| d1p5qa1 | 170 | FKBP52 (FKBP4), C-terminal domain {Human (Homo sap | 96.74 | |
| d1elwa_ | 117 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 96.74 | |
| d1elwa_ | 117 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 96.73 | |
| d1hxia_ | 112 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 96.57 | |
| d1a17a_ | 159 | Protein phosphatase 5 {Human (Homo sapiens) [TaxId | 96.52 | |
| d2fbna1 | 153 | Putative 70 kda peptidylprolyl isomerase PFL2275c | 96.48 | |
| d1ihga1 | 169 | Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | 96.47 | |
| d1tjca_ | 95 | Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human | 96.44 | |
| d1kt1a1 | 168 | FKBP51, C-terminal domain {Monkey (Saimiri bolivie | 96.41 | |
| d1xnfa_ | 259 | Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | 96.41 | |
| d1w3ba_ | 388 | O-GlcNAc transferase p110 subunit, OGT {Human (Hom | 96.22 | |
| d1p5qa1 | 170 | FKBP52 (FKBP4), C-terminal domain {Human (Homo sap | 96.16 | |
| d1fcha_ | 323 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 96.01 | |
| d1fcha_ | 323 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 95.9 | |
| d2c2la1 | 201 | STIP1 homology and U box-containing protein 1, STU | 95.9 | |
| d2h6fa1 | 315 | Protein farnesyltransferase alpha-subunit {Human ( | 95.64 | |
| d1elra_ | 128 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 95.63 | |
| d2h6fa1 | 315 | Protein farnesyltransferase alpha-subunit {Human ( | 95.45 | |
| d1elra_ | 128 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 95.25 | |
| d1dcea1 | 334 | Rab geranylgeranyltransferase alpha-subunit, N-ter | 95.13 | |
| d2pqrb1 | 124 | Mitochondria fission protein Fis1 {Baker's yeast ( | 95.1 | |
| d1zu2a1 | 145 | Mitochondrial import receptor subunit tom20-3 {Tha | 94.98 | |
| d2hr2a1 | 156 | Hypothetical protein CT2138 {Chlorobium tepidum [T | 94.98 | |
| d1ya0a1 | 497 | SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | 93.88 | |
| d1zu2a1 | 145 | Mitochondrial import receptor subunit tom20-3 {Tha | 93.14 | |
| d1hz4a_ | 366 | Transcription factor MalT domain III {Escherichia | 92.95 | |
| d2ff4a2 | 179 | Probable regulatory protein EmbR, middle domain {M | 92.46 | |
| d1dcea1 | 334 | Rab geranylgeranyltransferase alpha-subunit, N-ter | 91.01 | |
| d1hh8a_ | 192 | Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H | 89.88 | |
| d1hz4a_ | 366 | Transcription factor MalT domain III {Escherichia | 89.51 | |
| d2hr2a1 | 156 | Hypothetical protein CT2138 {Chlorobium tepidum [T | 88.81 | |
| d1ya0a1 | 497 | SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | 85.88 | |
| d1zbpa1 | 264 | Hypothetical protein VPA1032 {Vibrio parahaemolyti | 85.54 | |
| d1nzna_ | 122 | Mitochondria fission protein Fis1 {Human (Homo sap | 84.5 |
| >d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: alpha-alpha superhelix superfamily: TPR-like family: Tetratricopeptide repeat (TPR) domain: Lipoprotein NlpI species: Escherichia coli [TaxId: 562]
Probab=97.60 E-value=6e-05 Score=53.58 Aligned_cols=46 Identities=26% Similarity=0.269 Sum_probs=40.2
Q ss_pred HHHHHHHHHHHHHHcCCHHHHHHHHHHHHhcCCCcHHHHHHHHHcc
Q 032443 36 SSAICFLRGKAYEALGNCAQARLWYKAAIIADPLCYEALECLIENH 81 (140)
Q Consensus 36 ~ssmc~LRGk~yeal~N~~~A~~~YkeAL~~Dv~CyEAFe~Lv~~~ 81 (140)
.|.+.|.||.+|..+|++++|..+|++||.+||.+.+|+..|=.-+
T Consensus 36 ~a~~~~~~G~~y~~~g~~~~A~~~~~~al~l~p~~~~a~~~lg~~~ 81 (259)
T d1xnfa_ 36 RAQLLYERGVLYDSLGLRALARNDFSQALAIRPDMPEVFNYLGIYL 81 (259)
T ss_dssp HHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCCCCHHHHHHHHHHH
T ss_pred HHHHHHHHHHHHHHCCCHHHHHHHHHHhhccCCCCHHHHhhhchHH
Confidence 6778899999999999999999999999999999999987664433
|
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} | Back information, alignment and structure |
|---|
| >d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} | Back information, alignment and structure |
|---|
| >d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} | Back information, alignment and structure |
|---|
| >d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|