Citrus Sinensis ID: 032514

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------14
MMSSGSSSCCSCRAVDVVTKSIDKKMDFALLTRKSPMRVVPRGTSITSTRRSVCGVGVRASVVDSYESSSNFVKRMEQAWLISQQPRPVSCSSCNSNGHIDCKWCAGTGFFILGDNMLCQVPSRNTTCVICAGKVVWFT
ccccccccccccccHHHHHHHcccHHHHHHHccccccEEcccccccccccccEEEEEEEEEEccccccHHHHHHHHHHHHHHHcccccEEcccccccccEEccccccccEEEEccEEEEEccccccccEEEccEEEEEc
ccccccccEcccccEEEEEEcEcccccEEEEEcccccEEEEcccccccccccEEEEEEEEEEEccccccHHHHHHHHHHHHHcccccccEEccccccccEEEccccccEEEEEccccccccccccccEEEEccEEEEEc
mmssgsssccscravDVVTKSIDKKMDFAlltrkspmrvvprgtsitstrrsvcgvGVRASVVDSYESSSNFVKRMEQAWLisqqprpvscsscnsnghidckwcagtgffilgdnmlcqvpsrnttcvicagkvvwft
mmssgsssccscrAVDVVTKSIDKKMdfalltrkspmrvvprgtsitstrrsvcgvgVRASVVDSYESSSNFVKRMEQAWLISQQPRPVSCSSCNSNGHIDCKWCAGTGFFILGDNMLCQVPSRNTTCVICAGKVVWFT
MMssgsssccscRAVDVVTKSIDKKMDFALLTRKSPMRVVPRGTSITSTRRSVCGVGVRASVVDSYESSSNFVKRMEQAWLISQQPRPVSCSSCNSNGHIDCKWCAGTGFFILGDNMLCQVPSRNTTCVICAGKVVWFT
********CCSCRAVDVVTKSIDKKMDFALLTRKSPMRVVPRGTSITSTRRSVCGVGVRASVVDSYESSSNFVKRMEQAWLISQQPRPVSCSSCNSNGHIDCKWCAGTGFFILGDNMLCQVPSRNTTCVICAGKVVWF*
************RAVDVVTKSIDKKMDFALLTRKS**************RRSVCGVGVRA***********FVKRMEQAWLISQQP**********NGHIDCKWCAGTGFFILGDNMLCQVPSRNTTCVICAGKVVWFT
***********CRAVDVVTKSIDKKMDFALLTRKSPMRVVPRGTSITSTRRSVCGVGVRASVVDSYESSSNFVKRMEQAWLI************NSNGHIDCKWCAGTGFFILGDNMLCQVPSRNTTCVICAGKVVWFT
*****SSSCCSCRAVDVVTKSIDKKMDFALLTRKSPMRVVPRGTSITSTRRSVCGVGVRASVVDSYESSSNFVKRMEQAWLISQQPRPVSCSSCNSNGHIDCKWCAGTGFFILGDNMLCQVPSRNTTCVICAGKVVWFT
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMSSGSSSCCSCRAVDVVTKSIDKKMDFALLTRKSPMRVVPRGTSITSTRRSVCGVGVRASVVDSYESSSNFVKRMEQAWLISQQPRPVSCSSCNSNGHIDCKWCAGTGFFILGDNMLCQVPSRNTTCVICAGKVVWFT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query139
255548678144 conserved hypothetical protein [Ricinus 0.712 0.687 0.8 4e-39
224089396139 predicted protein [Populus trichocarpa] 0.784 0.784 0.729 5e-39
225430533146 PREDICTED: uncharacterized protein LOC10 0.561 0.534 0.858 3e-34
296082159109 unnamed protein product [Vitis vinifera] 0.561 0.715 0.858 4e-34
224141989100 predicted protein [Populus trichocarpa] 0.553 0.77 0.857 6e-33
449455499153 PREDICTED: uncharacterized protein LOC10 0.877 0.797 0.619 8e-33
18400663144 DnaJ/Hsp40 cysteine-rich domain-containi 0.834 0.805 0.592 3e-32
297825509145 hypothetical protein ARALYDRAFT_481346 [ 0.669 0.641 0.618 8e-32
4337001154 Tsi1-interacting protein TSIP1 [Nicotian 0.848 0.766 0.528 4e-30
226529773149 tsi1-interacting protein TSIP1 [Zea mays 0.647 0.604 0.684 6e-29
>gi|255548678|ref|XP_002515395.1| conserved hypothetical protein [Ricinus communis] gi|223545339|gb|EEF46844.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
 Score =  166 bits (419), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 84/105 (80%), Positives = 91/105 (86%), Gaps = 6/105 (5%)

Query: 32  TRKSP--MRVVPRGTSITSTRRSVCGVGVRASVVDSYESSSNFVKRMEQAWLISQQPRPV 89
           T ++P  M VVPRGT+    R  VC V  RASVVDSYESSSNF+KRMEQAWLISQQPRPV
Sbjct: 19  TNRAPINMGVVPRGTTTAFAR--VCRV--RASVVDSYESSSNFIKRMEQAWLISQQPRPV 74

Query: 90  SCSSCNSNGHIDCKWCAGTGFFILGDNMLCQVPSRNTTCVICAGK 134
            C+SCNSNGH+DCKWCAGTGFFILGDN+LCQVPSRNTTCVICAGK
Sbjct: 75  GCTSCNSNGHVDCKWCAGTGFFILGDNILCQVPSRNTTCVICAGK 119

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224089396|ref|XP_002308715.1| predicted protein [Populus trichocarpa] gi|222854691|gb|EEE92238.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225430533|ref|XP_002285576.1| PREDICTED: uncharacterized protein LOC100242360 [Vitis vinifera] Back     alignment and taxonomy information
>gi|296082159|emb|CBI21164.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224141989|ref|XP_002324343.1| predicted protein [Populus trichocarpa] gi|222865777|gb|EEF02908.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449455499|ref|XP_004145490.1| PREDICTED: uncharacterized protein LOC101210374 [Cucumis sativus] gi|449485210|ref|XP_004157101.1| PREDICTED: uncharacterized LOC101210374 [Cucumis sativus] Back     alignment and taxonomy information
>gi|18400663|ref|NP_565578.1| DnaJ/Hsp40 cysteine-rich domain-containing protein [Arabidopsis thaliana] gi|15294198|gb|AAK95276.1|AF410290_1 At2g24860/F27C12.22 [Arabidopsis thaliana] gi|20197874|gb|AAD23026.2| expressed protein [Arabidopsis thaliana] gi|20453299|gb|AAM19888.1| At2g24860/F27C12.22 [Arabidopsis thaliana] gi|21618127|gb|AAM67177.1| Tsi1-interacting protein TSIP1 [Arabidopsis thaliana] gi|51970710|dbj|BAD44047.1| unknown protein [Arabidopsis thaliana] gi|330252543|gb|AEC07637.1| DnaJ/Hsp40 cysteine-rich domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297825509|ref|XP_002880637.1| hypothetical protein ARALYDRAFT_481346 [Arabidopsis lyrata subsp. lyrata] gi|297326476|gb|EFH56896.1| hypothetical protein ARALYDRAFT_481346 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|4337001|gb|AAD18030.1| Tsi1-interacting protein TSIP1 [Nicotiana tabacum] Back     alignment and taxonomy information
>gi|226529773|ref|NP_001152460.1| tsi1-interacting protein TSIP1 [Zea mays] gi|195656531|gb|ACG47733.1| tsi1-interacting protein TSIP1 [Zea mays] gi|414885524|tpg|DAA61538.1| TPA: tsi1-interacting protein TSIP1 [Zea mays] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query139
TAIR|locus:2047426144 AT2G24860 [Arabidopsis thalian 0.705 0.680 0.69 5.8e-34
TAIR|locus:2047426 AT2G24860 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 369 (135.0 bits), Expect = 5.8e-34, P = 5.8e-34
 Identities = 69/100 (69%), Positives = 79/100 (79%)

Query:    35 SPMRVVPRGTSITSTRRSVCGVGVRASVVDSYESSSNFVKRMEQAWLISQQPRPVSCSSC 94
             SP R+   G  +   RR      V+AS VDS ESSSNF KRM+QAW+ISQQP PV CSSC
Sbjct:    22 SP-RITKLGF-VPVVRRFPATTTVKASAVDSPESSSNFAKRMDQAWIISQQPSPVGCSSC 79

Query:    95 NSNGHIDCKWCAGTGFFILGDNMLCQVPSRNTTCVICAGK 134
             NS GH++CKWCAGTGFFILGDNMLCQVPSRNT+CVIC+G+
Sbjct:    80 NSKGHVECKWCAGTGFFILGDNMLCQVPSRNTSCVICSGQ 119


Parameters:
  V=100
  filter=SEG
  E=0.001

  ctxfactor=1.00

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   +0      0   BLOSUM62        0.324   0.132   0.422    same    same    same
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a

  Query
  Frame  MatID  Length  Eff.Length     E     S W   T  X   E2     S2
   +0      0      139       129   0.00091  102 3  11 22  0.47    30
                                                     29  0.41    33


Statistics:

  Database:  /share/blast/go-seqdb.fasta
   Title:  go_20130330-seqdb.fasta
   Posted:  5:47:42 AM PDT Apr 1, 2013
   Created:  5:47:42 AM PDT Apr 1, 2013
   Format:  XDF-1
   # of letters in database:  169,044,731
   # of sequences in database:  368,745
   # of database sequences satisfying E:  1
  No. of states in DFA:  593 (63 KB)
  Total size of DFA:  144 KB (2087 KB)
  Time to generate neighborhood:  0.00u 0.00s 0.00t   Elapsed:  00:00:00
  No. of threads or processors used:  24
  Search cpu time:  14.61u 0.08s 14.69t   Elapsed:  00:00:03
  Total cpu time:  14.61u 0.08s 14.69t   Elapsed:  00:00:03
  Start:  Thu May  9 13:45:28 2013   End:  Thu May  9 13:45:31 2013
GO:0005576 "extracellular region" evidence=ISM
GO:0031072 "heat shock protein binding" evidence=IEA
GO:0051082 "unfolded protein binding" evidence=IEA

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.00061977
hypothetical protein (139 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 139
PLN03165111 chaperone protein dnaJ-related; Provisional 97.09
PF0068466 DnaJ_CXXCXGXG: DnaJ central domain; InterPro: IPR0 96.76
PRK14288 369 chaperone protein DnaJ; Provisional 96.19
PRK14278 378 chaperone protein DnaJ; Provisional 96.15
PRK10767 371 chaperone protein DnaJ; Provisional 96.08
PRK14285 365 chaperone protein DnaJ; Provisional 96.06
PRK14301 373 chaperone protein DnaJ; Provisional 95.98
TIGR02349 354 DnaJ_bact chaperone protein DnaJ. This model repre 95.96
PRK14298 377 chaperone protein DnaJ; Provisional 95.94
PRK14286 372 chaperone protein DnaJ; Provisional 95.91
PRK14285 365 chaperone protein DnaJ; Provisional 95.9
PRK14280 376 chaperone protein DnaJ; Provisional 95.85
PRK14282 369 chaperone protein DnaJ; Provisional 95.81
PF0068466 DnaJ_CXXCXGXG: DnaJ central domain; InterPro: IPR0 95.79
PRK14279 392 chaperone protein DnaJ; Provisional 95.79
PRK14294 366 chaperone protein DnaJ; Provisional 95.77
PRK14300 372 chaperone protein DnaJ; Provisional 95.75
PRK14290 365 chaperone protein DnaJ; Provisional 95.72
TIGR02349 354 DnaJ_bact chaperone protein DnaJ. This model repre 95.69
COG0484 371 DnaJ DnaJ-class molecular chaperone with C-termina 95.66
PRK14276 380 chaperone protein DnaJ; Provisional 95.63
PRK14280 376 chaperone protein DnaJ; Provisional 95.62
PRK14284 391 chaperone protein DnaJ; Provisional 95.59
PRK14277 386 chaperone protein DnaJ; Provisional 95.58
PRK14296 372 chaperone protein DnaJ; Provisional 95.49
PRK14287 371 chaperone protein DnaJ; Provisional 95.42
PRK14281 397 chaperone protein DnaJ; Provisional 95.36
PRK14283 378 chaperone protein DnaJ; Provisional 95.18
PRK14276 380 chaperone protein DnaJ; Provisional 95.18
COG1107 715 Archaea-specific RecJ-like exonuclease, contains D 95.11
PRK14295 389 chaperone protein DnaJ; Provisional 95.07
PRK14296 372 chaperone protein DnaJ; Provisional 94.94
PTZ00037 421 DnaJ_C chaperone protein; Provisional 94.93
PRK10767 371 chaperone protein DnaJ; Provisional 94.92
PRK14279 392 chaperone protein DnaJ; Provisional 94.82
PRK14297 380 chaperone protein DnaJ; Provisional 94.82
PRK14277 386 chaperone protein DnaJ; Provisional 94.78
PRK14278 378 chaperone protein DnaJ; Provisional 94.67
PRK14287 371 chaperone protein DnaJ; Provisional 94.65
PRK14286 372 chaperone protein DnaJ; Provisional 94.64
PRK14282 369 chaperone protein DnaJ; Provisional 94.6
COG0484 371 DnaJ DnaJ-class molecular chaperone with C-termina 94.59
PRK14291 382 chaperone protein DnaJ; Provisional 94.41
PTZ00037 421 DnaJ_C chaperone protein; Provisional 94.38
PRK14297 380 chaperone protein DnaJ; Provisional 94.36
PRK14288 369 chaperone protein DnaJ; Provisional 94.35
PRK14289 386 chaperone protein DnaJ; Provisional 94.27
PRK14301 373 chaperone protein DnaJ; Provisional 93.98
PRK14292 371 chaperone protein DnaJ; Provisional 93.78
PRK14293 374 chaperone protein DnaJ; Provisional 93.54
PRK14281 397 chaperone protein DnaJ; Provisional 93.51
PRK14291 382 chaperone protein DnaJ; Provisional 93.48
PRK14298 377 chaperone protein DnaJ; Provisional 93.4
PRK14293 374 chaperone protein DnaJ; Provisional 93.33
PRK14283 378 chaperone protein DnaJ; Provisional 93.31
PRK14300 372 chaperone protein DnaJ; Provisional 93.31
PRK14294 366 chaperone protein DnaJ; Provisional 93.15
PRK14295 389 chaperone protein DnaJ; Provisional 92.96
PRK14289 386 chaperone protein DnaJ; Provisional 92.39
TIGR02642186 phage_xxxx uncharacterized phage protein. This unc 91.82
PRK14292 371 chaperone protein DnaJ; Provisional 90.74
PRK14284 391 chaperone protein DnaJ; Provisional 89.94
PRK14290 365 chaperone protein DnaJ; Provisional 89.86
KOG2813 406 consensus Predicted molecular chaperone, contains 89.48
TIGR02642186 phage_xxxx uncharacterized phage protein. This unc 88.66
KOG2813 406 consensus Predicted molecular chaperone, contains 88.24
PLN03165111 chaperone protein dnaJ-related; Provisional 82.79
>PLN03165 chaperone protein dnaJ-related; Provisional Back     alignment and domain information 
Probab=97.09  E-value=0.00022  Score=53.18  Aligned_cols=28  Identities=25%  Similarity=0.764  Sum_probs=25.2

Q ss_pred             CCCceecccCCCCCeeeeeeccceeeeE
Q 032514           85 QPRPVSCSSCNSNGHIDCKWCAGTGFFI  112 (139)
Q Consensus        85 qprPv~CssC~s~G~vECkWCaGTGfFi  112 (139)
                      +-.++.|..|+|.|...|++|.|+|+..
T Consensus        38 ~~~~v~C~~C~GsG~~~C~~C~G~G~v~   65 (111)
T PLN03165         38 RENTQPCFPCSGTGAQVCRFCVGSGNVT   65 (111)
T ss_pred             hccCCCCCCCCCCCCcCCCCCcCcCeEE
Confidence            3458899999999999999999999976

>PF00684 DnaJ_CXXCXGXG: DnaJ central domain; InterPro: IPR001305 The hsp70 chaperone machine performs many diverse roles in the cell, including folding of nascent proteins, translocation of polypeptides across organelle membranes, coordinating responses to stress, and targeting selected proteins for degradation Back     alignment and domain information
>PRK14288 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14278 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK10767 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14285 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14301 chaperone protein DnaJ; Provisional Back     alignment and domain information
>TIGR02349 DnaJ_bact chaperone protein DnaJ Back     alignment and domain information
>PRK14298 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14286 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14285 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14280 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14282 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PF00684 DnaJ_CXXCXGXG: DnaJ central domain; InterPro: IPR001305 The hsp70 chaperone machine performs many diverse roles in the cell, including folding of nascent proteins, translocation of polypeptides across organelle membranes, coordinating responses to stress, and targeting selected proteins for degradation Back     alignment and domain information
>PRK14279 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14294 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14300 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14290 chaperone protein DnaJ; Provisional Back     alignment and domain information
>TIGR02349 DnaJ_bact chaperone protein DnaJ Back     alignment and domain information
>COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14276 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14280 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14284 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14277 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14296 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14287 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14281 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14283 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14276 chaperone protein DnaJ; Provisional Back     alignment and domain information
>COG1107 Archaea-specific RecJ-like exonuclease, contains DnaJ-type Zn finger domain [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14295 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14296 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PTZ00037 DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>PRK10767 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14279 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14297 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14277 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14278 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14287 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14286 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14282 chaperone protein DnaJ; Provisional Back     alignment and domain information
>COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14291 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PTZ00037 DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>PRK14297 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14288 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14289 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14301 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14292 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14293 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14281 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14291 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14298 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14293 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14283 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14300 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14294 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14295 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14289 chaperone protein DnaJ; Provisional Back     alignment and domain information
>TIGR02642 phage_xxxx uncharacterized phage protein Back     alignment and domain information
>PRK14292 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14284 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14290 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG2813 consensus Predicted molecular chaperone, contains DnaJ domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02642 phage_xxxx uncharacterized phage protein Back     alignment and domain information
>KOG2813 consensus Predicted molecular chaperone, contains DnaJ domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03165 chaperone protein dnaJ-related; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query139
1exk_A79 DNAJ protein; extended beta-hairpin, CXXCXGXG, zin 97.09
1exk_A79 DNAJ protein; extended beta-hairpin, CXXCXGXG, zin 97.04
2ctt_A104 DNAJ homolog subfamily A member 3; ZING finger, be 96.96
2ctt_A104 DNAJ homolog subfamily A member 3; ZING finger, be 96.8
1nlt_A 248 Protein YDJ1, mitochondrial protein import protein 96.15
1nlt_A 248 Protein YDJ1, mitochondrial protein import protein 95.87
2bx9_A53 Anti-trap, AT, tryptophan RNA-binding attenuator p 92.11
3lcz_A53 YCZA, inhibitor of trap, regulated by T-box (Trp) 90.7
3lcz_A53 YCZA, inhibitor of trap, regulated by T-box (Trp) 89.88
2bx9_A53 Anti-trap, AT, tryptophan RNA-binding attenuator p 82.63
>1exk_A DNAJ protein; extended beta-hairpin, CXXCXGXG, zinc-binding motif, chaperone; NMR {Escherichia coli} SCOP: g.54.1.1 Back     alignment and structure
Probab=97.09  E-value=0.00025  Score=45.61  Aligned_cols=27  Identities=30%  Similarity=0.749  Sum_probs=17.0

Q ss_pred             CCceecccCCCCCe------eeeeeccceeeeE
Q 032514           86 PRPVSCSSCNSNGH------IDCKWCAGTGFFI  112 (139)
Q Consensus        86 prPv~CssC~s~G~------vECkWCaGTGfFi  112 (139)
                      ++++.|..|.+.|.      ..|..|.|+|..+
T Consensus         9 ~~~~~C~~C~G~G~~~~~~~~~C~~C~G~G~~~   41 (79)
T 1exk_A            9 PTLEECDVCHGSGAKPGTQPQTCPTCHGSGQVQ   41 (79)
T ss_dssp             CCEEECGGGTTTSBCSSSCCEECTTTTTSSEEE
T ss_pred             ccceECCCCcccccCCCccCCCCCCCcCeEEEE
Confidence            45666777776663      4577777766554
>1exk_A DNAJ protein; extended beta-hairpin, CXXCXGXG, zinc-binding motif, chaperone; NMR {Escherichia coli} SCOP: g.54.1.1 Back     alignment and structure
>2ctt_A DNAJ homolog subfamily A member 3; ZING finger, beta-hairpin, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ctt_A DNAJ homolog subfamily A member 3; ZING finger, beta-hairpin, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1nlt_A Protein YDJ1, mitochondrial protein import protein MAS5; beta-strands, chaperone, heat shock, mitochondrion; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 g.54.1.1 Back     alignment and structure
>1nlt_A Protein YDJ1, mitochondrial protein import protein MAS5; beta-strands, chaperone, heat shock, mitochondrion; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 g.54.1.1 Back     alignment and structure
>2bx9_A Anti-trap, AT, tryptophan RNA-binding attenuator protein-inhibit protein; transcription regulation; 2.80A {Bacillus subtilis} PDB: 2ko8_A* 2zp8_E* 2zp9_C* Back     alignment and structure
>3lcz_A YCZA, inhibitor of trap, regulated by T-box (Trp) seque; anti-trap, tryptophan RNA-binding attenuation PROT transcription attenuation; 2.06A {Bacillus licheniformis} PDB: 3ld0_A Back     alignment and structure
>3lcz_A YCZA, inhibitor of trap, regulated by T-box (Trp) seque; anti-trap, tryptophan RNA-binding attenuation PROT transcription attenuation; 2.06A {Bacillus licheniformis} PDB: 3ld0_A Back     alignment and structure
>2bx9_A Anti-trap, AT, tryptophan RNA-binding attenuator protein-inhibit protein; transcription regulation; 2.80A {Bacillus subtilis} PDB: 2ko8_A* 2zp8_E* 2zp9_C* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query139
d1nlta374 Mitochondrial protein import protein mas5 (Hsp40, 97.7
d1exka_79 Cysteine-rich domain of the chaperone protein DnaJ 97.2
d1nlta374 Mitochondrial protein import protein mas5 (Hsp40, 96.76
d1exka_79 Cysteine-rich domain of the chaperone protein DnaJ 96.64
d1x64a231 PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus m 90.92
d1x62a131 PDZ and LIM domain protein 1 Elfin {Human (Homo sa 88.97
>d1nlta3 g.54.1.1 (A:139-212) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), insert domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: Small proteins
fold: DnaJ/Hsp40 cysteine-rich domain
superfamily: DnaJ/Hsp40 cysteine-rich domain
family: DnaJ/Hsp40 cysteine-rich domain
domain: Mitochondrial protein import protein mas5 (Hsp40, Ydj1), insert domain
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=97.70  E-value=1.5e-06  Score=55.96  Aligned_cols=49  Identities=24%  Similarity=0.631  Sum_probs=31.7

Q ss_pred             CceecccCCCCCe-----eeeeeccceeeeEecCe---eeeeCCCCCccceeecceeeee
Q 032514           87 RPVSCSSCNSNGH-----IDCKWCAGTGFFILGDN---MLCQVPSRNTTCVICAGKVVWF  138 (139)
Q Consensus        87 rPv~CssC~s~G~-----vECkWCaGTGfFilGdn---mlCevpsrnT~CvICsGKG~~~  138 (139)
                      |-+.|+.|++.|.     ..|..|.|+|+...=.+   |+-+   -..+|+.|.|+|.++
T Consensus         1 r~v~C~~C~G~G~~~~~~~~C~~C~G~G~~~~~~~~g~~~~~---~~~~C~~C~G~G~~i   57 (74)
T d1nlta3           1 KQILCKECEGRGGKKGAVKKCTSCNGQGIKFVTRQMGPMIQR---FQTECDVCHGTGDII   57 (74)
T ss_dssp             EEEECTTTTTCSBSTTTCCCCTTSSSSSCEEEEEESSSEEEE---EECSCTTCSSSSSCC
T ss_pred             CccCCcCCcccccCCCCCCCCCCCcceeeeeEEEEecCcEEE---EEEECccCccceEEe
Confidence            3578999999994     45999999998654222   2211   124566777766554
>d1exka_ g.54.1.1 (A:) Cysteine-rich domain of the chaperone protein DnaJ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nlta3 g.54.1.1 (A:139-212) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), insert domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1exka_ g.54.1.1 (A:) Cysteine-rich domain of the chaperone protein DnaJ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x64a2 g.39.1.3 (A:53-83) PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x62a1 g.39.1.3 (A:43-73) PDZ and LIM domain protein 1 Elfin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure