Citrus Sinensis ID: 032561
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 138 | ||||||
| 297745584 | 222 | unnamed protein product [Vitis vinifera] | 0.949 | 0.590 | 0.661 | 1e-41 | |
| 224083348 | 209 | predicted protein [Populus trichocarpa] | 0.942 | 0.622 | 0.620 | 1e-40 | |
| 147815138 | 682 | hypothetical protein VITISV_024651 [Viti | 0.949 | 0.192 | 0.632 | 6e-40 | |
| 449455631 | 227 | PREDICTED: peptidyl-prolyl cis-trans iso | 0.840 | 0.511 | 0.664 | 2e-37 | |
| 359491859 | 187 | PREDICTED: probable FKBP-type peptidyl-p | 0.724 | 0.534 | 0.762 | 6e-36 | |
| 357467145 | 228 | hypothetical protein MTR_3g115970 [Medic | 0.746 | 0.451 | 0.704 | 2e-35 | |
| 255539292 | 219 | FK506 binding protein, putative [Ricinus | 0.942 | 0.593 | 0.636 | 8e-35 | |
| 15218039 | 232 | peptidylprolyl isomerase [Arabidopsis th | 0.949 | 0.564 | 0.559 | 3e-33 | |
| 8886936 | 233 | F2D10.32 [Arabidopsis thaliana] | 0.934 | 0.553 | 0.560 | 1e-32 | |
| 388514903 | 243 | unknown [Lotus japonicus] | 0.753 | 0.427 | 0.650 | 1e-32 |
| >gi|297745584|emb|CBI40749.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 174 bits (440), Expect = 1e-41, Method: Compositional matrix adjust.
Identities = 90/136 (66%), Positives = 106/136 (77%), Gaps = 5/136 (3%)
Query: 1 MASIRSFGKWTVDHQI-CPQHTTIQA---KQAVVSIPISRRAAAILISSLPFSVISLPKC 56
MASIRS +W VD+ + P + IQ K ++ +PISRR A ILIS LPFSVIS P
Sbjct: 1 MASIRSIHRWDVDNLLLTPTSSAIQTQPPKHVILPMPISRRCA-ILISVLPFSVISQPHS 59
Query: 57 SEARERRNKKAIPLEDYHTTSDGLKYYDIVEGKGPVAQKGSTVQVHFDCIFRGITAVSSR 116
S+ARERR KK IPLEDY T+ DGLKYYD+V+G GPVA+KGS+VQVHFDCI+R ITAVSSR
Sbjct: 60 SDARERRTKKNIPLEDYLTSPDGLKYYDVVDGNGPVAEKGSSVQVHFDCIYRSITAVSSR 119
Query: 117 ESKLLAGNRSIAEVYL 132
ESKLLAGNR IA+ Y+
Sbjct: 120 ESKLLAGNRIIAQPYV 135
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224083348|ref|XP_002306991.1| predicted protein [Populus trichocarpa] gi|222856440|gb|EEE93987.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|147815138|emb|CAN59776.1| hypothetical protein VITISV_024651 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449455631|ref|XP_004145556.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP18, chloroplastic-like [Cucumis sativus] gi|449530267|ref|XP_004172117.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP18, chloroplastic-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|359491859|ref|XP_002273060.2| PREDICTED: probable FKBP-type peptidyl-prolyl cis-trans isomerase 1, chloroplastic [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|357467145|ref|XP_003603857.1| hypothetical protein MTR_3g115970 [Medicago truncatula] gi|355492905|gb|AES74108.1| hypothetical protein MTR_3g115970 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|255539292|ref|XP_002510711.1| FK506 binding protein, putative [Ricinus communis] gi|223551412|gb|EEF52898.1| FK506 binding protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|15218039|ref|NP_173504.1| peptidylprolyl isomerase [Arabidopsis thaliana] gi|18203241|sp|Q9LM71.2|FKB18_ARATH RecName: Full=Peptidyl-prolyl cis-trans isomerase FKBP18, chloroplastic; Short=PPIase FKBP18; AltName: Full=FK506-binding protein 18; Short=AtFKBP18; AltName: Full=Immunophilin FKBP18; AltName: Full=Rotamase; Flags: Precursor gi|26449905|dbj|BAC42074.1| unknown protein [Arabidopsis thaliana] gi|28827556|gb|AAO50622.1| putative FKBP-type peptidyl-prolyl cis-trans isomerase [Arabidopsis thaliana] gi|332191905|gb|AEE30026.1| peptidylprolyl isomerase [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|8886936|gb|AAF80622.1|AC069251_15 F2D10.32 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|388514903|gb|AFK45513.1| unknown [Lotus japonicus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 138 | ||||||
| TAIR|locus:2030502 | 232 | AT1G20810 "AT1G20810" [Arabido | 0.949 | 0.564 | 0.573 | 5.2e-33 | |
| UNIPROTKB|Q0E4I6 | 234 | Os02g0117600 "Peptidyl-prolyl | 0.681 | 0.401 | 0.666 | 6.4e-28 | |
| UNIPROTKB|A8JC71 | 228 | FKB16-4 "Peptidyl-prolyl cis-t | 0.731 | 0.442 | 0.365 | 6.4e-09 | |
| TAIR|locus:2100063 | 230 | AT3G10060 "AT3G10060" [Arabido | 0.731 | 0.439 | 0.317 | 9.8e-08 |
| TAIR|locus:2030502 AT1G20810 "AT1G20810" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 360 (131.8 bits), Expect = 5.2e-33, P = 5.2e-33
Identities = 82/143 (57%), Positives = 104/143 (72%)
Query: 1 MASIRSFGKWTVD-HQICPQHTTI-QAKQA-----VV--SIPISRR-AAAILISSLPFS- 49
MASI S +W + H P+ T+I +A Q+ VV S+PISRR A+ IL+SS+P +
Sbjct: 1 MASISSLHRWASNQHSRLPRITSISEADQSRPINQVVAFSVPISRRDASIILLSSIPLTS 60
Query: 50 -VISLPKCSEARERRNKKAIPLEDYHTTSDGLKYYDIVEGKGPVAQKGSTVQVHFDCIFR 108
+ P SEARERR++K IPLE+Y T +GLK+YDI EGKGPVA +GST QVHFDC +R
Sbjct: 61 FFVLTPSSSEARERRSRKVIPLEEYSTGPEGLKFYDIEEGKGPVATEGSTAQVHFDCRYR 120
Query: 109 GITAVSSRESKLLAGNRSIAEVY 131
ITA+S+RESKLLAGNRSIA+ Y
Sbjct: 121 SITAISTRESKLLAGNRSIAQPY 143
|
|
| UNIPROTKB|Q0E4I6 Os02g0117600 "Peptidyl-prolyl cis-trans isomerase" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A8JC71 FKB16-4 "Peptidyl-prolyl cis-trans isomerase" [Chlamydomonas reinhardtii (taxid:3055)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2100063 AT3G10060 "AT3G10060" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00002914001 | RecName- Full=Peptidyl-prolyl cis-trans isomerase; EC=5.2.1.8; (222 aa) | |||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 138 | |||
| COG0545 | 205 | COG0545, FkpA, FKBP-type peptidyl-prolyl cis-trans | 3e-05 |
| >gnl|CDD|223619 COG0545, FkpA, FKBP-type peptidyl-prolyl cis-trans isomerases 1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Score = 41.6 bits (98), Expect = 3e-05
Identities = 14/40 (35%), Positives = 20/40 (50%), Gaps = 3/40 (7%)
Query: 64 NKKAIPLEDYHTTSDGLKYYDIVEGKGPVAQKGSTVQVHF 103
N K ++ T GL+Y + G G +KG TV VH+
Sbjct: 90 NAKEKGVK---TLPSGLQYKVLKAGDGAAPKKGDTVTVHY 126
|
Length = 205 |
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 138 | |||
| COG0545 | 205 | FkpA FKBP-type peptidyl-prolyl cis-trans isomerase | 99.61 | |
| KOG0544 | 108 | consensus FKBP-type peptidyl-prolyl cis-trans isom | 99.42 | |
| PRK11570 | 206 | peptidyl-prolyl cis-trans isomerase; Provisional | 99.37 | |
| PRK10902 | 269 | FKBP-type peptidyl-prolyl cis-trans isomerase; Pro | 99.19 | |
| KOG0552 | 226 | consensus FKBP-type peptidyl-prolyl cis-trans isom | 99.14 | |
| TIGR03516 | 177 | ppisom_GldI peptidyl-prolyl isomerase, gliding mot | 99.07 | |
| KOG0549 | 188 | consensus FKBP-type peptidyl-prolyl cis-trans isom | 98.87 | |
| PF00254 | 94 | FKBP_C: FKBP-type peptidyl-prolyl cis-trans isomer | 98.15 | |
| KOG0543 | 397 | consensus FKBP-type peptidyl-prolyl cis-trans isom | 97.85 | |
| PRK15095 | 156 | FKBP-type peptidyl-prolyl cis-trans isomerase; Pro | 97.05 | |
| KOG0543 | 397 | consensus FKBP-type peptidyl-prolyl cis-trans isom | 96.03 | |
| COG1047 | 174 | SlpA FKBP-type peptidyl-prolyl cis-trans isomerase | 94.76 | |
| KOG0545 | 329 | consensus Aryl-hydrocarbon receptor-interacting pr | 94.7 | |
| PRK10737 | 196 | FKBP-type peptidyl-prolyl cis-trans isomerase; Pro | 93.57 | |
| TIGR00115 | 408 | tig trigger factor. Trigger factor is a ribosome-a | 89.36 | |
| PRK01490 | 435 | tig trigger factor; Provisional | 88.38 |
| >COG0545 FkpA FKBP-type peptidyl-prolyl cis-trans isomerases 1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=99.61 E-value=1.4e-15 Score=122.28 Aligned_cols=63 Identities=25% Similarity=0.287 Sum_probs=57.2
Q ss_pred ccCCCCCCCceeCCCCcEEEEeecCCCCCCCCCCEEEEEEEEEe-CCeEeeeccccccccCCccccccEEEEE
Q 032561 64 NKKAIPLEDYHTTSDGLKYYDIVEGKGPVAQKGSTVQVHFDCIF-RGITAVSSRESKLLAGNRSIAEVYLGFV 135 (138)
Q Consensus 64 ~~~~~p~~~~~t~psGL~y~dlk~G~G~~p~~Gd~V~VhY~G~l-dG~~FDSS~~r~~~~G~r~i~eP~~F~v 135 (138)
..+.....+++++++||+|.+++.|+|+.|++|++|.|||+|+| ||++||||++|+ +|++|.+
T Consensus 87 ~~~~~k~~~v~~~~sgl~y~~~~~G~G~~~~~~~~V~vhY~G~l~~G~vFDsS~~rg---------~p~~f~l 150 (205)
T COG0545 87 LEKNAKEKGVKTLPSGLQYKVLKAGDGAAPKKGDTVTVHYTGTLIDGTVFDSSYDRG---------QPAEFPL 150 (205)
T ss_pred HhhhcccCCceECCCCcEEEEEeccCCCCCCCCCEEEEEEEEecCCCCccccccccC---------CCceeec
Confidence 33445567889999999999999999999999999999999999 999999999996 8999976
|
|
| >KOG0544 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK11570 peptidyl-prolyl cis-trans isomerase; Provisional | Back alignment and domain information |
|---|
| >PRK10902 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional | Back alignment and domain information |
|---|
| >KOG0552 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR03516 ppisom_GldI peptidyl-prolyl isomerase, gliding motility-associated | Back alignment and domain information |
|---|
| >KOG0549 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF00254 FKBP_C: FKBP-type peptidyl-prolyl cis-trans isomerase; InterPro: IPR001179 Synonym(s): Peptidylprolyl cis-trans isomerase FKBP-type peptidylprolyl isomerases (5 | Back alignment and domain information |
|---|
| >KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK15095 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional | Back alignment and domain information |
|---|
| >KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG1047 SlpA FKBP-type peptidyl-prolyl cis-trans isomerases 2 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10737 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional | Back alignment and domain information |
|---|
| >TIGR00115 tig trigger factor | Back alignment and domain information |
|---|
| >PRK01490 tig trigger factor; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 138 | |||
| 3uf8_A | 209 | Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- | 4e-07 | |
| 1u79_A | 129 | FKBP-type peptidyl-prolyl CIS-trans isomerase 3; T | 5e-07 | |
| 2y78_A | 133 | Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, | 1e-06 | |
| 3b7x_A | 134 | FK506-binding protein 6; isomerase, repeat, rotama | 2e-06 | |
| 2f4e_A | 180 | ATFKBP42; FKBP-like, alpha-beta, signaling protein | 3e-06 | |
| 3oe2_A | 219 | Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, | 8e-06 | |
| 1fd9_A | 213 | Protein (macrophage infectivity potentiator prote; | 2e-05 | |
| 1q6h_A | 224 | FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; | 3e-05 | |
| 1yat_A | 113 | FK506 binding protein; HET: FK5; 2.50A {Saccharomy | 6e-05 | |
| 2lgo_A | 130 | FKBP; infectious disease, isomerase, giardiasis, s | 9e-05 | |
| 3o5q_A | 128 | Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 | 3e-04 | |
| 3o5e_A | 144 | Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 | 4e-04 | |
| 1jvw_A | 167 | Macrophage infectivity potentiator; chagas disease | 5e-04 | |
| 2vn1_A | 129 | 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR | 6e-04 | |
| 1r9h_A | 135 | FKB-6, FK506 binding protein family; structural ge | 6e-04 | |
| 3jxv_A | 356 | 70 kDa peptidyl-prolyl isomerase; FKBP- binding do | 6e-04 |
| >3uf8_A Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- isomerase; ssgcid, seattle structural genomics center for in disease; HET: FK5; 1.50A {Burkholderia pseudomallei} PDB: 4ggq_C* 3vaw_A* 3uqa_A* 4g50_A* 4fn2_A* 3uqb_A* 1euv_B 3v60_A 3v61_A 3v62_A* Length = 209 | Back alignment and structure |
|---|
Score = 46.3 bits (110), Expect = 4e-07
Identities = 17/45 (37%), Positives = 22/45 (48%)
Query: 58 EARERRNKKAIPLEDYHTTSDGLKYYDIVEGKGPVAQKGSTVQVH 102
+++ I TT GLKY D+ EG G A+ G TV VH
Sbjct: 84 NDIIEAHREQIGGSTVVTTESGLKYEDLTEGSGAEARAGQTVSVH 128
|
| >1u79_A FKBP-type peptidyl-prolyl CIS-trans isomerase 3; TFKBP13, FK-506 binding protein; 1.85A {Arabidopsis thaliana} SCOP: d.26.1.1 PDB: 1y0o_A Length = 129 | Back alignment and structure |
|---|
| >2y78_A Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, virulence; HET: SO4 GOL; 0.91A {Burkholderia pseudomallei} PDB: 2ke0_A 2ko7_A* 2l2s_A* 4dz2_A* 4dz3_A* Length = 133 | Back alignment and structure |
|---|
| >3b7x_A FK506-binding protein 6; isomerase, repeat, rotamase, TPR repeat, williams-beuren syndrome, structural genomics consortium, SGC; 2.10A {Homo sapiens} Length = 134 | Back alignment and structure |
|---|
| >2f4e_A ATFKBP42; FKBP-like, alpha-beta, signaling protein; 2.32A {Arabidopsis thaliana} Length = 180 | Back alignment and structure |
|---|
| >3oe2_A Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, FK506; HET: TAR SRT; 1.60A {Pseudomonas syringae PV} Length = 219 | Back alignment and structure |
|---|
| >1fd9_A Protein (macrophage infectivity potentiator prote; FKBP domain, long alpha helix, dimerisation VIA helical INTE isomerase; 2.41A {Legionella pneumophila} SCOP: d.26.1.1 PDB: 2uz5_A 2vcd_A* Length = 213 | Back alignment and structure |
|---|
| >1q6h_A FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; chaperone, peptidyl-prolyl isomerase, heat shock protein, FK family; HET: MSE; 1.97A {Escherichia coli} SCOP: d.26.1.1 PDB: 1q6i_A* 1q6u_A Length = 224 | Back alignment and structure |
|---|
| >1yat_A FK506 binding protein; HET: FK5; 2.50A {Saccharomyces cerevisiae} SCOP: d.26.1.1 Length = 113 | Back alignment and structure |
|---|
| >2lgo_A FKBP; infectious disease, isomerase, giardiasis, ssgcid, structura genomics, seattle structural genomics center for infectious; NMR {Giardia lamblia} Length = 130 | Back alignment and structure |
|---|
| >3o5q_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 0.96A {Homo sapiens} PDB: 3o5m_A 3o5l_A 3o5o_A 3o5p_A 3o5r_A* 4drq_A* 3o5j_A 3o5g_A 3o5i_A 3o5k_A Length = 128 | Back alignment and structure |
|---|
| >3o5e_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 1.60A {Homo sapiens} PDB: 3o5f_A Length = 144 | Back alignment and structure |
|---|
| >1jvw_A Macrophage infectivity potentiator; chagas disease, X-RAY rotamase, isomeras; 1.70A {Trypanosoma cruzi} SCOP: d.26.1.1 Length = 167 | Back alignment and structure |
|---|
| >2vn1_A 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR repeat; HET: FK5; 2.35A {Plasmodium falciparum} PDB: 2ofn_A 2ki3_A 3ihz_A* 3ni6_A 3pa7_A Length = 129 | Back alignment and structure |
|---|
| >1r9h_A FKB-6, FK506 binding protein family; structural genomics, peptidylprolyl isomerase, PSI, protein structure initiative; 1.80A {Caenorhabditis elegans} SCOP: d.26.1.1 Length = 135 | Back alignment and structure |
|---|
| >3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Length = 356 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 138 | |||
| 2lkn_A | 165 | AH receptor-interacting protein; FKBP-type domain, | 99.42 | |
| 1u79_A | 129 | FKBP-type peptidyl-prolyl CIS-trans isomerase 3; T | 99.38 | |
| 1jvw_A | 167 | Macrophage infectivity potentiator; chagas disease | 99.33 | |
| 1fd9_A | 213 | Protein (macrophage infectivity potentiator prote; | 99.32 | |
| 2y78_A | 133 | Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, | 99.31 | |
| 1q6h_A | 224 | FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; | 99.29 | |
| 1yat_A | 113 | FK506 binding protein; HET: FK5; 2.50A {Saccharomy | 99.29 | |
| 2lgo_A | 130 | FKBP; infectious disease, isomerase, giardiasis, s | 99.27 | |
| 3oe2_A | 219 | Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, | 99.23 | |
| 3kz7_A | 119 | FK506-binding protein 3; FKPB ppiase rapamycin, is | 99.22 | |
| 2f4e_A | 180 | ATFKBP42; FKBP-like, alpha-beta, signaling protein | 99.21 | |
| 3uf8_A | 209 | Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- | 99.2 | |
| 2ppn_A | 107 | FK506-binding protein 1A; high resolution protein | 99.17 | |
| 3o5e_A | 144 | Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 | 99.16 | |
| 3o5q_A | 128 | Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 | 99.16 | |
| 1r9h_A | 135 | FKB-6, FK506 binding protein family; structural ge | 99.15 | |
| 3b7x_A | 134 | FK506-binding protein 6; isomerase, repeat, rotama | 99.11 | |
| 4dip_A | 125 | Peptidyl-prolyl CIS-trans isomerase FKBP14; struct | 99.08 | |
| 2vn1_A | 129 | 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR | 99.06 | |
| 2if4_A | 338 | ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, | 99.06 | |
| 2jwx_A | 157 | FKBP38NTD, FK506-binding protein 8 variant; apopto | 99.04 | |
| 2awg_A | 118 | 38 kDa FK-506 binding protein; FKBP-type, ppiase, | 99.02 | |
| 2d9f_A | 135 | FK506-binding protein 8 variant; FKBP, rapamycin, | 99.0 | |
| 1q1c_A | 280 | FK506-binding protein 4; rotamase, TPR repeat, nuc | 98.98 | |
| 1kt0_A | 457 | FKBP51, 51 kDa FK506-binding protein; FKBP-like pp | 98.93 | |
| 3jxv_A | 356 | 70 kDa peptidyl-prolyl isomerase; FKBP- binding do | 98.87 | |
| 1p5q_A | 336 | FKBP52, FK506-binding protein 4; isomerase; 2.80A | 98.63 | |
| 3jxv_A | 356 | 70 kDa peptidyl-prolyl isomerase; FKBP- binding do | 98.58 | |
| 2pbc_A | 102 | FK506-binding protein 2; endoplasmic reticulum, is | 98.49 | |
| 1q1c_A | 280 | FK506-binding protein 4; rotamase, TPR repeat, nuc | 98.22 | |
| 4dt4_A | 169 | FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; | 97.97 | |
| 1hxv_A | 113 | Trigger factor; FKBP fold, ppiase, chaperone; NMR | 97.91 | |
| 3pr9_A | 157 | FKBP-type peptidyl-prolyl CIS-trans isomerase; FKB | 97.89 | |
| 1ix5_A | 151 | FKBP; ppiase, isomerase; NMR {Methanothermococcust | 97.69 | |
| 3prb_A | 231 | FKBP-type peptidyl-prolyl CIS-trans isomerase; cha | 97.69 | |
| 1kt0_A | 457 | FKBP51, 51 kDa FK506-binding protein; FKBP-like pp | 97.66 | |
| 2kr7_A | 151 | FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; | 96.78 | |
| 2kfw_A | 196 | FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD | 96.68 | |
| 2k8i_A | 171 | SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, | 96.59 | |
| 3cgm_A | 158 | SLYD, peptidyl-prolyl CIS-trans isomerase; chapero | 95.97 | |
| 1w26_A | 432 | Trigger factor, TF; chaperone, protein folding, ri | 95.91 | |
| 1t11_A | 392 | Trigger factor, TF; helix-turn-helix, four-helix-b | 95.65 | |
| 3gty_X | 433 | Trigger factor, TF; chaperone-client complex, cell | 83.87 |
| >2lkn_A AH receptor-interacting protein; FKBP-type domain, immunophilin homolog, protein binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.42 E-value=6.4e-14 Score=107.81 Aligned_cols=52 Identities=23% Similarity=0.383 Sum_probs=47.0
Q ss_pred eCCCCcEEEEeecCCCCCC--CCCCEEEEEEEEEe-C--CeEeeeccccccccCCccccccEEEEE
Q 032561 75 TTSDGLKYYDIVEGKGPVA--QKGSTVQVHFDCIF-R--GITAVSSRESKLLAGNRSIAEVYLGFV 135 (138)
Q Consensus 75 t~psGL~y~dlk~G~G~~p--~~Gd~V~VhY~G~l-d--G~~FDSS~~r~~~~G~r~i~eP~~F~v 135 (138)
++.+||+|+++++|+|..| ++|++|.|||+|+| | |++||||++|+ +||+|.+
T Consensus 7 ~~~~Gv~~~vl~~G~G~~p~~~~G~~V~vhY~g~l~d~~G~~FDsS~~rg---------~P~~f~l 63 (165)
T 2lkn_A 7 LREDGIQKRVIQEGRGELPDFQDGTKATFHYRTLHSDDEGTVLDDSRARG---------KPMELII 63 (165)
T ss_dssp HHTTSCCCCEEECCSSCCCCCCTTCEEEEECEEECSSSSCCEEEESTTTT---------CCEEEES
T ss_pred ccCCCeEEEEEECCcCCCCCCCCCCEEEEEEEEEEeCCCccEEEecccCC---------CCEEEEe
Confidence 4689999999999999764 68999999999999 5 99999999986 7999986
|
| >1u79_A FKBP-type peptidyl-prolyl CIS-trans isomerase 3; TFKBP13, FK-506 binding protein; 1.85A {Arabidopsis thaliana} SCOP: d.26.1.1 PDB: 1y0o_A | Back alignment and structure |
|---|
| >1jvw_A Macrophage infectivity potentiator; chagas disease, X-RAY rotamase, isomeras; 1.70A {Trypanosoma cruzi} SCOP: d.26.1.1 | Back alignment and structure |
|---|
| >1fd9_A Protein (macrophage infectivity potentiator prote; FKBP domain, long alpha helix, dimerisation VIA helical INTE isomerase; 2.41A {Legionella pneumophila} SCOP: d.26.1.1 PDB: 2uz5_A 2vcd_A* | Back alignment and structure |
|---|
| >2y78_A Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, virulence; HET: SO4 GOL; 0.91A {Burkholderia pseudomallei} PDB: 2ke0_A 2ko7_A* 2l2s_A* 4dz2_A* 4dz3_A* | Back alignment and structure |
|---|
| >1q6h_A FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; chaperone, peptidyl-prolyl isomerase, heat shock protein, FK family; HET: MSE; 1.97A {Escherichia coli} SCOP: d.26.1.1 PDB: 1q6i_A* 1q6u_A | Back alignment and structure |
|---|
| >1yat_A FK506 binding protein; HET: FK5; 2.50A {Saccharomyces cerevisiae} SCOP: d.26.1.1 | Back alignment and structure |
|---|
| >2lgo_A FKBP; infectious disease, isomerase, giardiasis, ssgcid, structura genomics, seattle structural genomics center for infectious; NMR {Giardia lamblia} | Back alignment and structure |
|---|
| >3oe2_A Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, FK506; HET: TAR SRT; 1.60A {Pseudomonas syringae PV} SCOP: d.26.1.0 | Back alignment and structure |
|---|
| >3kz7_A FK506-binding protein 3; FKPB ppiase rapamycin, isomerase, nucleus, phosphoprotein, R isomerase-inhibitor complex; HET: RAP; 1.95A {Mus musculus} SCOP: d.26.1.1 PDB: 1pbk_A* | Back alignment and structure |
|---|
| >2f4e_A ATFKBP42; FKBP-like, alpha-beta, signaling protein; 2.32A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3uf8_A Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- isomerase; ssgcid, seattle structural genomics center for in disease; HET: FK5; 1.50A {Burkholderia pseudomallei} PDB: 4ggq_C* 3vaw_A* 3uqa_A* 4g50_A* 4fn2_A* 3uqb_A* 4giv_A* 1euv_B 3v60_A 3v61_A 3v62_A* | Back alignment and structure |
|---|
| >2ppn_A FK506-binding protein 1A; high resolution protein structure, isomerase; 0.92A {Homo sapiens} SCOP: d.26.1.1 PDB: 1b6c_A 1a7x_A 1d7h_A 1d7i_A 1d7j_A* 1f40_A* 1fap_A* 1d6o_A* 1fkd_A* 1fkf_A* 1fkg_A* 1fkh_A* 1fki_A* 1fkj_A* 1fkr_A 1fks_A 1fkt_A 1j4h_A* 1j4i_A* 1j4r_A* ... | Back alignment and structure |
|---|
| >3o5e_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 1.60A {Homo sapiens} PDB: 3o5f_A | Back alignment and structure |
|---|
| >3o5q_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 0.96A {Homo sapiens} PDB: 3o5m_A 3o5l_A 3o5o_A 3o5p_A 3o5r_A* 4drk_A* 4drm_A* 4drn_A* 4dro_A* 4drp_A* 4drq_A* 3o5j_A 3o5g_A 3o5i_A 3o5k_A | Back alignment and structure |
|---|
| >1r9h_A FKB-6, FK506 binding protein family; structural genomics, peptidylprolyl isomerase, PSI, protein structure initiative; 1.80A {Caenorhabditis elegans} SCOP: d.26.1.1 | Back alignment and structure |
|---|
| >3b7x_A FK506-binding protein 6; isomerase, repeat, rotamase, TPR repeat, williams-beuren syndrome, structural genomics consortium, SGC; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >4dip_A Peptidyl-prolyl CIS-trans isomerase FKBP14; structural genomics, structural genomics consortium, SGC, PE prolyl CIS-trans isomerase; 1.82A {Homo sapiens} | Back alignment and structure |
|---|
| >2vn1_A 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR repeat; HET: FK5; 2.35A {Plasmodium falciparum} PDB: 2ofn_A 2ki3_A 3ihz_A* 3ni6_A 3pa7_A | Back alignment and structure |
|---|
| >2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2jwx_A FKBP38NTD, FK506-binding protein 8 variant; apoptosis, beta barrel, central helix, with flexible N-terminal extension, isomerase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2awg_A 38 kDa FK-506 binding protein; FKBP-type, ppiase, BCL-2 inhibitor, SHH signalling antagonist, structural genomics consortium, SGC; 1.60A {Homo sapiens} PDB: 2f2d_A 3ey6_A | Back alignment and structure |
|---|
| >2d9f_A FK506-binding protein 8 variant; FKBP, rapamycin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A | Back alignment and structure |
|---|
| >1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A | Back alignment and structure |
|---|
| >3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A | Back alignment and structure |
|---|
| >1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A | Back alignment and structure |
|---|
| >3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A | Back alignment and structure |
|---|
| >2pbc_A FK506-binding protein 2; endoplasmic reticulum, isomerase, polymorphism, rotamase, structural genomics, structural genomics consortium, SGC; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A | Back alignment and structure |
|---|
| >4dt4_A FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; FKBP domain, IF domain, chaperone, peptidyl-prolyl isomerase isomerase; 1.35A {Escherichia coli} | Back alignment and structure |
|---|
| >1hxv_A Trigger factor; FKBP fold, ppiase, chaperone; NMR {Mycoplasma genitalium} SCOP: d.26.1.1 | Back alignment and structure |
|---|
| >3pr9_A FKBP-type peptidyl-prolyl CIS-trans isomerase; FKBP protein, chaperone; 1.95A {Methanocaldococcus jannaschii} SCOP: d.26.1.0 PDB: 3pra_A | Back alignment and structure |
|---|
| >1ix5_A FKBP; ppiase, isomerase; NMR {Methanothermococcusthermolithotrophicus} SCOP: d.26.1.1 | Back alignment and structure |
|---|
| >3prb_A FKBP-type peptidyl-prolyl CIS-trans isomerase; chaperone; 2.20A {Methanocaldococcus jannaschii} PDB: 3prd_A | Back alignment and structure |
|---|
| >1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A | Back alignment and structure |
|---|
| >2kr7_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; protein, rotamase; NMR {Helicobacter pylori} | Back alignment and structure |
|---|
| >2kfw_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD; protein, cobalt, copper, cytoplasm, metal- binding, nickel, rotamase, zinc; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >2k8i_A SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, chaperone, rotamase; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >3cgm_A SLYD, peptidyl-prolyl CIS-trans isomerase; chaperone function, two domain P rotamase; 2.41A {Thermus thermophilus} PDB: 3cgn_A 3luo_A* | Back alignment and structure |
|---|
| >1w26_A Trigger factor, TF; chaperone, protein folding, ribosome associated protein, nascent chain, cell division, isomerase; 2.7A {Escherichia coli} SCOP: a.223.1.1 d.241.2.1 d.26.1.1 PDB: 2vrh_A 1w2b_5 | Back alignment and structure |
|---|
| >1t11_A Trigger factor, TF; helix-turn-helix, four-helix-bundle, ppiase, chaperone; 2.50A {Vibrio cholerae} SCOP: a.223.1.1 d.241.2.1 d.26.1.1 PDB: 1l1p_A | Back alignment and structure |
|---|
| >3gty_X Trigger factor, TF; chaperone-client complex, cell cycle, cell division, chapero isomerase, rotamase, ribonucleoprotein, binding; 3.40A {Thermotoga maritima} PDB: 3gu0_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 138 | ||||
| d1u79a_ | 125 | d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis tha | 7e-07 | |
| d1yata_ | 113 | d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeas | 2e-04 | |
| d1r9ha_ | 118 | d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabd | 8e-04 | |
| d1q1ca1 | 120 | d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Hu | 0.001 | |
| d1q1ca2 | 117 | d.26.1.1 (A:141-257) FKBP52, N-terminal domains {H | 0.004 | |
| d2ppna1 | 107 | d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12) | 0.004 | |
| d1kt1a3 | 115 | d.26.1.1 (A:139-253) FKBP51, N-terminal domains {M | 0.004 |
| >d1u79a_ d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 125 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: FKBP-like superfamily: FKBP-like family: FKBP immunophilin/proline isomerase domain: FKBP13 species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]
Score = 43.3 bits (101), Expect = 7e-07
Identities = 11/36 (30%), Positives = 18/36 (50%)
Query: 72 DYHTTSDGLKYYDIVEGKGPVAQKGSTVQVHFDCIF 107
++ + GL + D V G GP A KG ++ H+
Sbjct: 2 EFSVSPSGLAFCDKVVGYGPEAVKGQLIKAHYVGKL 37
|
| >d1yata_ d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 113 | Back information, alignment and structure |
|---|
| >d1r9ha_ d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabditis elegans [TaxId: 6239]} Length = 118 | Back information, alignment and structure |
|---|
| >d1q1ca1 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 120 | Back information, alignment and structure |
|---|
| >d1q1ca2 d.26.1.1 (A:141-257) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d2ppna1 d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]} Length = 107 | Back information, alignment and structure |
|---|
| >d1kt1a3 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 115 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 138 | |||
| d1u79a_ | 125 | FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: | 99.55 | |
| d1q6ha_ | 210 | Peptidyl-prolyl cis-trans isomerase FkpA {Escheric | 99.48 | |
| d1fd9a_ | 204 | Macrophage infectivity potentiator protein (MIP) { | 99.43 | |
| d1q1ca1 | 120 | FKBP52, N-terminal domains {Human (Homo sapiens) [ | 99.29 | |
| d1yata_ | 113 | Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyc | 99.28 | |
| d2ppna1 | 107 | FK-506 binding protein (FKBP12), an immunophilin { | 99.27 | |
| d1jvwa_ | 160 | Macrophage infectivity potentiator protein (MIP) { | 99.25 | |
| d1r9ha_ | 118 | FKB-6, N-terminal domain {Caenorhabditis elegans [ | 99.25 | |
| d1kt1a2 | 111 | FKBP51, N-terminal domains {Monkey (Saimiri bolivi | 99.21 | |
| d1pbka_ | 116 | FKBP25 {Human (Homo sapiens) [TaxId: 9606]} | 99.09 | |
| d1kt1a3 | 115 | FKBP51, N-terminal domains {Monkey (Saimiri bolivi | 98.67 | |
| d1q1ca2 | 117 | FKBP52, N-terminal domains {Human (Homo sapiens) [ | 98.42 | |
| d1ix5a_ | 151 | Archaeal FKBP {Archaeon Methanococcus thermolithot | 97.89 | |
| d1hxva_ | 85 | Trigger factor PPIase domain {Mycoplasma genitaliu | 96.92 | |
| d1t11a3 | 113 | Trigger factor PPIase domain {Vibrio cholerae [Tax | 88.47 | |
| d1l1pa_ | 106 | Trigger factor PPIase domain {Escherichia coli [Ta | 88.19 |
| >d1u79a_ d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: FKBP-like superfamily: FKBP-like family: FKBP immunophilin/proline isomerase domain: FKBP13 species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]
Probab=99.55 E-value=2.9e-15 Score=106.71 Aligned_cols=55 Identities=25% Similarity=0.369 Sum_probs=51.3
Q ss_pred CceeCCCCcEEEEeecCCCCCCCCCCEEEEEEEEEe-CCeEeeeccccccccCCccccccEEEEE
Q 032561 72 DYHTTSDGLKYYDIVEGKGPVAQKGSTVQVHFDCIF-RGITAVSSRESKLLAGNRSIAEVYLGFV 135 (138)
Q Consensus 72 ~~~t~psGL~y~dlk~G~G~~p~~Gd~V~VhY~G~l-dG~~FDSS~~r~~~~G~r~i~eP~~F~v 135 (138)
|++++|+||+|.++++|+|+.|+.||+|.|||+|++ ||++||||+++. +|++|++
T Consensus 2 ~~~~~psGl~y~~~~~G~G~~p~~gd~V~v~y~g~l~~G~~fdss~~~~---------~p~~~~~ 57 (125)
T d1u79a_ 2 EFSVSPSGLAFCDKVVGYGPEAVKGQLIKAHYVGKLENGKVFDSSYNRG---------KPLTFRI 57 (125)
T ss_dssp CCEECTTSCEEEEEECCSSCBCCTTCEEEEEEEEECTTSCEEEEHHHHT---------SCEEEET
T ss_pred CcEECCCCCEEEEEEeccCCCCCCCCEEEEEEEeeecCCcEEecccccC---------cceeEec
Confidence 789999999999999999999999999999999999 999999998874 6888875
|
| >d1q6ha_ d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase FkpA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1fd9a_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Legionella pneumophila [TaxId: 446]} | Back information, alignment and structure |
|---|
| >d1q1ca1 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yata_ d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ppna1 d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jvwa_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1r9ha_ d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1kt1a2 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} | Back information, alignment and structure |
|---|
| >d1pbka_ d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kt1a3 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} | Back information, alignment and structure |
|---|
| >d1q1ca2 d.26.1.1 (A:141-257) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ix5a_ d.26.1.1 (A:) Archaeal FKBP {Archaeon Methanococcus thermolithotrophicus [TaxId: 2186]} | Back information, alignment and structure |
|---|
| >d1hxva_ d.26.1.1 (A:) Trigger factor PPIase domain {Mycoplasma genitalium [TaxId: 2097]} | Back information, alignment and structure |
|---|
| >d1t11a3 d.26.1.1 (A:135-247) Trigger factor PPIase domain {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1l1pa_ d.26.1.1 (A:) Trigger factor PPIase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|