Citrus Sinensis ID: 032570

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------14
MESDLDLPVMNDAARTLSDFGVPYEIKILPPHQNCKEALSYALSAKERGIKIIIVGDGVEAHLSGVAAANSQILVIRVPLLSEDWSEDDVINSIRMPSHVQVASVPRNNAKNAALYAVKVLGIADEDLLERIRKYVEE
ccccccHHHHHHHHHHHHHHccccEEEEccccccHHHHHHHHHHHHHcccEEEEEccccccccHHHHHHcccccEEEEccccccccccHHHHHHccccccEEEcEEcccccHHHHHHHHHHccccHHHHHHHHHHHHc
EccHHHHHHHHHHHHHHHHcccEEEEEEccccccHHHHHHHHHHcccccccEEEEEEEccccHHHHHHHHccccEEEEEEcccccccHHHHHHHEccccccEEEEEEccHHHHHHHHHHHHHcccHHHHHHHHHHHcc
mesdldlpvmndaartlsdfgvpyeikilpphqncKEALSYALSAKERGIKIIIVGDGVEAHLSGVAAANSQILVIRVpllsedwseddvinsirmpshvqvasvprnnaknAALYAVKVLGIADEDLLERIRKYVEE
mesdldlpVMNDAARTLSDFGVPYEIKILPPHQNCKEALSYALSAKERGIKIIIVGDGVEAHLSGVAAANSQILVIRVPLLSEDWSEDDVINSIRMPSHVQVASVPRNNAKNAALYAVKVLGIADEDLLERIRKYVEE
MESDLDLPVMNDAARTLSDFGVPYEIKILPPHQNCKEALSYALSAKERGIKIIIVGDGVEAHLSGVAAANSQILVIRVPLLSEDWSEDDVINSIRMPSHVQVASVPRNNAKNAALYAVKVLGIADEDLLERIRKYVEE
*************ARTLSDFGVPYEIKILPPHQNCKEALSYALSAKERGIKIIIVGDGVEAHLSGVAAANSQILVIRVPLLSEDWSEDDVINSIRMPSHVQVASVPRNNAKNAALYAVKVLGIADEDLLERIRK****
*ESDLDLPVMNDAARTLSDFGVPYEIKILPPHQNCKEALSYALSAKERGIKIIIVGDGVEAHLSGVAAANSQILVIRVPLLSEDWSEDDVINSIRMPSHVQVASVPRNNAKNAALYAVKVLGIADEDLLERIRKY***
MESDLDLPVMNDAARTLSDFGVPYEIKILPPHQNCKEALSYALSAKERGIKIIIVGDGVEAHLSGVAAANSQILVIRVPLLSEDWSEDDVINSIRMPSHVQVASVPRNNAKNAALYAVKVLGIADEDLLERIRKYVEE
**SDLDLPVMNDAARTLSDFGVPYEIKILPPHQNCKEALSYALSAKERGIKIIIVGDGVEAHLSGVAAANSQILVIRVPLLSEDWSEDDVINSIRMPSHVQVASVPRNNAKNAALYAVKVLGIADEDLLERIRKYV**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MESDLDLPVMNDAARTLSDFGVPYEIKILPPHQNCKEALSYALSAKERGIKIIIVGDGVEAHLSGVAAANSQILVIRVPLLSEDWSEDDVINSIRMPSHVQVASVPRNNAKNAALYAVKVLGIADEDLLERIRKYVEE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query138 2.2.26 [Sep-21-2011]
O58058177 N5-carboxyaminoimidazole yes no 1.0 0.779 0.460 4e-28
P55195557 Phosphoribosylaminoimidaz N/A no 1.0 0.247 0.424 1e-24
Q9UY68174 N5-carboxyaminoimidazole yes no 1.0 0.793 0.438 5e-24
P21264571 Phosphoribosylaminoimidaz yes no 0.985 0.238 0.437 2e-23
Q9WYS7171 N5-carboxyaminoimidazole yes no 0.992 0.801 0.427 2e-23
Q92210568 Phosphoribosylaminoimidaz N/A no 0.985 0.239 0.423 2e-22
P50504557 Phosphoribosylaminoimidaz N/A no 0.985 0.244 0.423 2e-22
Q44679177 N5-carboxyaminoimidazole N/A no 0.992 0.774 0.391 2e-21
O74197570 Phosphoribosylaminoimidaz yes no 1.0 0.242 0.402 5e-21
O06456158 N5-carboxyaminoimidazole yes no 1.0 0.873 0.374 4e-20
>sp|O58058|PURE_PYRHO N5-carboxyaminoimidazole ribonucleotide mutase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=purE PE=3 SV=1 Back     alignment and function desciption
 Score =  123 bits (308), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 64/139 (46%), Positives = 98/139 (70%), Gaps = 1/139 (0%)

Query: 1   MESDLDLPVMNDAARTLSDFGVPYEIKILPPHQNCKEALSYALSAKERGIKIIIVGDGVE 60
           M SD DLPVM +AAR L +FGVPYEI I+  H+  + A  YA  A+ERGI++II G G  
Sbjct: 16  MGSDSDLPVMKEAARILEEFGVPYEITIISAHRTPERAYEYAKKAEERGIEVIIAGAGGA 75

Query: 61  AHLSGVAAANSQILVIRVPLLSEDWSE-DDVINSIRMPSHVQVASVPRNNAKNAALYAVK 119
           AHL G+ A+ + + VI VP+ S+  +  D +++ ++MPS + VA+V  +NAKNAAL A++
Sbjct: 76  AHLPGIIASLTVLPVIGVPIKSKALNGLDSLLSIVQMPSGIPVATVAIDNAKNAALLALR 135

Query: 120 VLGIADEDLLERIRKYVEE 138
           +LGI   ++ E++R+Y+++
Sbjct: 136 ILGIKYPEIKEKLRRYMKD 154
Catalyzes the conversion of N5-carboxyaminoimidazole ribonucleotide (N5-CAIR) to 4-carboxy-5-aminoimidazole ribonucleotide (CAIR).
Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (taxid: 70601)
EC: 5EC: .EC: 4EC: .EC: 9EC: 9EC: .EC: 1EC: 8
>sp|P55195|PUR6_VIGAC Phosphoribosylaminoimidazole carboxylase, chloroplastic (Fragment) OS=Vigna aconitifolia GN=PURKE PE=2 SV=1 Back     alignment and function description
>sp|Q9UY68|PURE_PYRAB N5-carboxyaminoimidazole ribonucleotide mutase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=purE PE=3 SV=1 Back     alignment and function description
>sp|P21264|PUR6_YEAST Phosphoribosylaminoimidazole carboxylase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADE2 PE=1 SV=1 Back     alignment and function description
>sp|Q9WYS7|PURE_THEMA N5-carboxyaminoimidazole ribonucleotide mutase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=purE PE=1 SV=1 Back     alignment and function description
>sp|Q92210|PUR6_CANAL Phosphoribosylaminoimidazole carboxylase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ADE2 PE=3 SV=2 Back     alignment and function description
>sp|P50504|PUR6_SCHOC Phosphoribosylaminoimidazole carboxylase OS=Schwanniomyces occidentalis GN=ADE2 PE=3 SV=1 Back     alignment and function description
>sp|Q44679|PURE_CORAM N5-carboxyaminoimidazole ribonucleotide mutase OS=Corynebacterium ammoniagenes GN=purE PE=3 SV=1 Back     alignment and function description
>sp|O74197|PUR6_CANGA Phosphoribosylaminoimidazole carboxylase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ADE2 PE=3 SV=2 Back     alignment and function description
>sp|O06456|PURE_SULSO N5-carboxyaminoimidazole ribonucleotide mutase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=purE PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query138
449442114 586 PREDICTED: phosphoribosylaminoimidazole 1.0 0.235 0.482 5e-27
449490248 586 PREDICTED: phosphoribosylaminoimidazole 1.0 0.235 0.482 5e-27
14590237177 phosphoribosylaminoimidazole carboxylase 1.0 0.779 0.460 3e-26
357441429 641 Phosphoribosylaminoimidazole carboxylase 1.0 0.215 0.467 7e-26
410667200164 phosphoribosylaminoimidazole carboxylase 0.992 0.835 0.492 1e-25
356535191 633 PREDICTED: phosphoribosylaminoimidazole 1.0 0.218 0.467 3e-25
37983592 621 phosphoribosylaminoimidazole carboxylase 1.0 0.222 0.474 3e-25
13173434 623 phosphoribosylaminoimidazole carboxylase 1.0 0.221 0.474 3e-25
3236251 645 putative phosphoribosylaminoimidazole ca 1.0 0.213 0.460 3e-25
42569706 642 phosphoribosylaminoimidazole carboxylase 1.0 0.214 0.460 3e-25
>gi|449442114|ref|XP_004138827.1| PREDICTED: phosphoribosylaminoimidazole carboxylase, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
 Score =  125 bits (314), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 67/139 (48%), Positives = 92/139 (66%), Gaps = 1/139 (0%)

Query: 1   MESDLDLPVMNDAARTLSDFGVPYEIKILPPHQNCKEALSYALSAKERGIKIIIVGDGVE 60
           M SD D PVM DAA+ L  FGVPYEIKI+  H+      SYA SA+ERGI++II G G  
Sbjct: 428 MGSDSDFPVMRDAAKVLDTFGVPYEIKIVSAHRTPHWMFSYASSAQERGIQVIIAGAGGA 487

Query: 61  AHLSGVAAANSQILVIRVPLLSEDWSE-DDVINSIRMPSHVQVASVPRNNAKNAALYAVK 119
           AHL G+ A+ + + VI VP+ +      D +++ ++MP  V VA+V  NNA NA L AV+
Sbjct: 488 AHLPGMVASLTPLPVIGVPVRASTLDGLDSLLSIVQMPRGVPVATVAINNATNAGLLAVR 547

Query: 120 VLGIADEDLLERIRKYVEE 138
           +LG+AD DLL R+ ++ E+
Sbjct: 548 MLGVADADLLSRMSQFQED 566

Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|449490248|ref|XP_004158550.1| PREDICTED: phosphoribosylaminoimidazole carboxylase, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|14590237|ref|NP_142303.1| phosphoribosylaminoimidazole carboxylase catalytic subunit [Pyrococcus horikoshii OT3] gi|3914493|sp|O58058.1|PURE_PYRHO RecName: Full=N5-carboxyaminoimidazole ribonucleotide mutase; Short=N5-CAIR mutase; AltName: Full=5-(carboxyamino)imidazole ribonucleotide mutase gi|3256711|dbj|BAA29394.1| 177aa long hypothetical phosphoribosylaminoimidazole carboxylase catalytic subunit [Pyrococcus horikoshii OT3] Back     alignment and taxonomy information
>gi|357441429|ref|XP_003590992.1| Phosphoribosylaminoimidazole carboxylase [Medicago truncatula] gi|355480040|gb|AES61243.1| Phosphoribosylaminoimidazole carboxylase [Medicago truncatula] Back     alignment and taxonomy information
>gi|410667200|ref|YP_006919571.1| phosphoribosylaminoimidazole carboxylase catalytic subunit PurE [Thermacetogenium phaeum DSM 12270] gi|409104947|gb|AFV11072.1| phosphoribosylaminoimidazole carboxylase catalytic subunit PurE [Thermacetogenium phaeum DSM 12270] Back     alignment and taxonomy information
>gi|356535191|ref|XP_003536132.1| PREDICTED: phosphoribosylaminoimidazole carboxylase, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|37983592|gb|AAR06291.1| phosphoribosylaminoimidazole carboxylase, partial [Nicotiana tabacum] Back     alignment and taxonomy information
>gi|13173434|gb|AAK14408.1| phosphoribosylaminoimidazole carboxylase [Nicotiana tabacum] Back     alignment and taxonomy information
>gi|3236251|gb|AAC23639.1| putative phosphoribosylaminoimidazole carboxylase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|42569706|ref|NP_181305.2| phosphoribosylaminoimidazole carboxylase [Arabidopsis thaliana] gi|28973715|gb|AAO64174.1| putative phosphoribosylaminoimidazole carboxylase [Arabidopsis thaliana] gi|30793959|gb|AAP40431.1| putative phosphoribosylaminoimidazole carboxylase [Arabidopsis thaliana] gi|110737176|dbj|BAF00537.1| phosphoribosylaminoimidazole carboxylase like protein [Arabidopsis thaliana] gi|330254341|gb|AEC09435.1| phosphoribosylaminoimidazole carboxylase [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query138
TAIR|locus:2051314162 AT2G05140 "AT2G05140" [Arabido 1.0 0.851 0.453 3.6e-25
TAIR|locus:2040771642 AT2G37690 [Arabidopsis thalian 1.0 0.214 0.460 3.8e-25
SGD|S000005654571 ADE2 "Phosphoribosylaminoimida 0.985 0.238 0.437 8.2e-22
CGD|CAL0003241568 ADE2 [Candida albicans (taxid: 0.985 0.239 0.423 4.7e-21
UNIPROTKB|Q92210568 ADE2 "Phosphoribosylaminoimida 0.985 0.239 0.423 4.7e-21
UNIPROTKB|P96880174 purE "N5-carboxyaminoimidazole 0.956 0.758 0.421 1e-20
TIGR_CMR|GSU_0611169 GSU_0611 "phosphoribosylaminoi 0.978 0.798 0.398 1e-20
TIGR_CMR|CHY_1069162 CHY_1069 "phosphoribosylaminoi 1.0 0.851 0.376 1.3e-20
POMBASE|SPCC1322.13552 ade6 "phosphoribosylaminoimida 0.992 0.248 0.384 2.3e-18
TIGR_CMR|CJE_0802164 CJE_0802 "phosphoribosylaminoi 0.971 0.817 0.350 7.5e-18
TAIR|locus:2051314 AT2G05140 "AT2G05140" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 286 (105.7 bits), Expect = 3.6e-25, P = 3.6e-25
 Identities = 63/139 (45%), Positives = 92/139 (66%)

Query:     1 MESDLDLPVMNDAARTLSDFGVPYEIKILPPHQNCKEALSYALSAKERGIKIIIVGDGVE 60
             M SD DL VM DAA+ L  FGV +E+KI+  H+  +   +YA SA  RG+++II G G  
Sbjct:     1 MGSDTDLLVMKDAAKILDMFGVTHEVKIVSAHRTPEMMYTYATSAHSRGVQVIIAGAGGA 60

Query:    61 AHLSGVAAANSQILVIRVPLLSEDWSE-DDVINSIRMPSHVQVASVPRNNAKNAALYAVK 119
             AHL G+ A+ + + VI VP+ +      D +++ ++MP  V VA+V  NNA NAAL AV+
Sbjct:    61 AHLPGMVASLTPLPVIGVPVQATRLDGVDSLLSIVQMPRGVPVATVAINNATNAALLAVR 120

Query:   120 VLGIADEDLLERIRKYVEE 138
             +LGI+D DL+ R+R+Y E+
Sbjct:   121 MLGISDNDLVSRMRQYQED 139
GO:0004638 "phosphoribosylaminoimidazole carboxylase activity" evidence=ISS
GO:0006189 "'de novo' IMP biosynthetic process" evidence=IEA;ISS
GO:0009320 "phosphoribosylaminoimidazole carboxylase complex" evidence=ISS
GO:0009507 "chloroplast" evidence=ISM
GO:0034023 "5-(carboxyamino)imidazole ribonucleotide mutase activity" evidence=IEA
TAIR|locus:2040771 AT2G37690 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
SGD|S000005654 ADE2 "Phosphoribosylaminoimidazole carboxylase" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
CGD|CAL0003241 ADE2 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
UNIPROTKB|Q92210 ADE2 "Phosphoribosylaminoimidazole carboxylase" [Candida albicans SC5314 (taxid:237561)] Back     alignment and assigned GO terms
UNIPROTKB|P96880 purE "N5-carboxyaminoimidazole ribonucleotide mutase" [Mycobacterium tuberculosis (taxid:1773)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_0611 GSU_0611 "phosphoribosylaminoimidazole carboxylase, catalytic subunit" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
TIGR_CMR|CHY_1069 CHY_1069 "phosphoribosylaminoimidazole carboxylase, catalytic subunit" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
POMBASE|SPCC1322.13 ade6 "phosphoribosylaminoimidazole carboxylase Ade6" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
TIGR_CMR|CJE_0802 CJE_0802 "phosphoribosylaminoimidazole carboxylase, catalytic subunit" [Campylobacter jejuni RM1221 (taxid:195099)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P43849PURE_HAEIN5, ., 4, ., 9, 9, ., 1, 80.32140.99270.8353yesno
Q5E1R4PURE_VIBF15, ., 4, ., 9, 9, ., 1, 80.34751.00.8571yesno
O06456PURE_SULSO5, ., 4, ., 9, 9, ., 1, 80.37411.00.8734yesno
O67239PURE_AQUAE5, ., 4, ., 9, 9, ., 1, 80.37411.00.8263yesno
Q87KE1PURE_VIBPA5, ., 4, ., 9, 9, ., 1, 80.37581.00.8571yesno
Q7MGL2PURE_VIBVY5, ., 4, ., 9, 9, ., 1, 80.39001.00.8571yesno
Q8DDD7PURE_VIBVU5, ., 4, ., 9, 9, ., 1, 80.39001.00.8571yesno
Q9WYS7PURE_THEMA5, ., 4, ., 9, 9, ., 1, 80.42750.99270.8011yesno
P72157PURE_PSEAE5, ., 4, ., 9, 9, ., 1, 80.32600.97820.8282yesno
P12044PURE_BACSU5, ., 4, ., 9, 9, ., 1, 80.38510.95650.8148yesno
Q9KVT7PURE_VIBCH5, ., 4, ., 9, 9, ., 1, 80.36950.97820.8385yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer5.4.99.180.824
3rd Layer5.4.990.766

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
purE
phosphoribosylaminoimidazole carboxylase catalytic subunit; This subunit can alone transform AIR to CAIR, but in association with purK, which possesses an ATPase activity, an enzyme complex is produced which is capable of converting AIR to CAIR efficiently under physiological condition (By similarity) (177 aa)
(Pyrococcus horikoshii)
Predicted Functional Partners:
purC
phosphoribosylaminoimidazole-succinocarboxamide synthase (238 aa)
•• • •• 0.999
purD
phosphoribosylamine--glycine ligase (438 aa)
••••••• 0.999
purT
phosphoribosylglycinamide formyltransferase 2; Catalyzes two reactions- the first one is the pr [...] (433 aa)
•• • •• 0.999
purF
amidophosphoribosyltransferase (449 aa)
• ••••• 0.998
purM
phosphoribosylaminoimidazole synthetase (334 aa)
• ••••• 0.997
purB
adenylosuccinate lyase (450 aa)
•  •••• 0.996
purQ
phosphoribosylformylglycinamidine synthase I (227 aa)
•  • •• 0.982
glnA
glutamine synthetase (443 aa)
•     • 0.976
purL
phosphoribosylformylglycinamidine synthase II (705 aa)
•    •• 0.964
purA
adenylosuccinate synthetase; Plays an important role in the de novo pathway of purine nucleotid [...] (339 aa)
•  •  • 0.961

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query138
TIGR01162156 TIGR01162, purE, phosphoribosylaminoimidazole carb 7e-40
pfam00731150 pfam00731, AIRC, AIR carboxylase 2e-38
COG0041162 COG0041, PurE, Phosphoribosylcarboxyaminoimidazole 2e-37
PLN02948577 PLN02948, PLN02948, phosphoribosylaminoimidazole c 8e-36
smart01001152 smart01001, AIRC, AIR carboxylase 5e-34
>gnl|CDD|130230 TIGR01162, purE, phosphoribosylaminoimidazole carboxylase, PurE protein Back     alignment and domain information 
 Score =  130 bits (330), Expect = 7e-40
 Identities = 62/139 (44%), Positives = 89/139 (64%), Gaps = 1/139 (0%)

Query: 1   MESDLDLPVMNDAARTLSDFGVPYEIKILPPHQNCKEALSYALSAKERGIKIIIVGDGVE 60
           M SD DLP M  AA  L +FG+PYE++++  H+  +  L YA  A+ERGIK+II G G  
Sbjct: 5   MGSDSDLPTMKKAADILEEFGIPYELRVVSAHRTPELMLEYAKEAEERGIKVIIAGAGGA 64

Query: 61  AHLSGVAAANSQILVIRVPL-LSEDWSEDDVINSIRMPSHVQVASVPRNNAKNAALYAVK 119
           AHL G+ AA + + VI VP+        D +++ ++MPS V VA+V   NA NAAL A +
Sbjct: 65  AHLPGMVAALTPLPVIGVPVPSKALSGLDSLLSIVQMPSGVPVATVAIGNAGNAALLAAQ 124

Query: 120 VLGIADEDLLERIRKYVEE 138
           +LGI D +L E++++Y E 
Sbjct: 125 ILGIKDPELAEKLKEYREN 143

Phosphoribosylaminoimidazole carboxylase is a fusion protein in plants and fungi, but consists of two non-interacting proteins in bacteria, PurK and PurE. This model represents PurK, an N5-CAIR mutase [Purines, pyrimidines, nucleosides, and nucleotides, Purine ribonucleotide biosynthesis]. Length = 156
>gnl|CDD|144362 pfam00731, AIRC, AIR carboxylase Back     alignment and domain information
>gnl|CDD|223119 COG0041, PurE, Phosphoribosylcarboxyaminoimidazole (NCAIR) mutase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|178534 PLN02948, PLN02948, phosphoribosylaminoimidazole carboxylase Back     alignment and domain information
>gnl|CDD|214965 smart01001, AIRC, AIR carboxylase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 138
TIGR01162156 purE phosphoribosylaminoimidazole carboxylase, Pur 100.0
COG0041162 PurE Phosphoribosylcarboxyaminoimidazole (NCAIR) m 100.0
PF00731150 AIRC: AIR carboxylase; InterPro: IPR000031 Phospho 100.0
PLN02948577 phosphoribosylaminoimidazole carboxylase 100.0
COG1691254 NCAIR mutase (PurE)-related proteins [General func 99.97
KOG2835373 consensus Phosphoribosylamidoimidazole-succinocarb 99.89
cd08550 349 GlyDH-like Glycerol_dehydrogenase-like. Families o 96.87
cd08170 351 GlyDH Glycerol dehydrogenases (GlyDH) catalyzes ox 96.84
PRK00843 350 egsA NAD(P)-dependent glycerol-1-phosphate dehydro 96.61
PRK09423 366 gldA glycerol dehydrogenase; Provisional 96.5
cd08175 348 G1PDH Glycerol-1-phosphate dehydrogenase (G1PDH) c 96.41
TIGR01357 344 aroB 3-dehydroquinate synthase. This model represe 96.25
cd08171 345 GlyDH-like2 Glycerol dehydrogenase-like. Glycerol 96.23
cd07766 332 DHQ_Fe-ADH Dehydroquinate synthase-like (DHQ-like) 96.19
cd08195 345 DHQS Dehydroquinate synthase (DHQS) catalyzes the 96.16
cd08551 370 Fe-ADH iron-containing alcohol dehydrogenases (Fe- 96.13
cd08173 339 Gro1PDH Sn-glycerol-1-phosphate dehydrogenase (Gro 95.98
cd08194 375 Fe-ADH6 Iron-containing alcohol dehydrogenases-lik 95.79
PRK15454 395 ethanol dehydrogenase EutG; Provisional 95.75
cd08183 374 Fe-ADH2 Iron-containing alcohol dehydrogenases-lik 95.74
cd08193 376 HVD 5-hydroxyvalerate dehydrogenase (HVD) catalyze 95.69
cd08192 370 Fe-ADH7 Iron-containing alcohol dehydrogenases-lik 95.62
cd08197 355 DOIS 2-deoxy-scyllo-inosose synthase (DOIS) cataly 95.62
cd08549 332 G1PDH_related Glycerol-1-phosphate_dehydrogenase a 95.61
PF06506176 PrpR_N: Propionate catabolism activator; InterPro: 95.56
PRK00002 358 aroB 3-dehydroquinate synthase; Reviewed 95.51
cd08182 367 HEPD Hydroxyethylphosphoate dehydrogenase (HEPD) c 95.5
cd08199 354 EEVS 2-epi-5-epi-valiolone synthase (EEVS). 2-epi- 95.44
cd08185 380 Fe-ADH1 Iron-containing alcohol dehydrogenases-lik 95.44
PRK15424 538 propionate catabolism operon regulatory protein Pr 95.42
cd08186 383 Fe-ADH8 Iron-containing alcohol dehydrogenase. Typ 95.41
cd08189 374 Fe-ADH5 Iron-containing alcohol dehydrogenases-lik 95.34
cd08174 331 G1PDH-like Glycerol-1-phosphate dehydrogenase-like 95.26
TIGR02638 379 lactal_redase lactaldehyde reductase. This clade o 95.22
cd08176 377 LPO Lactadehyde:propanediol oxidoreductase (LPO) c 95.19
PF00465 366 Fe-ADH: Iron-containing alcohol dehydrogenase ; In 95.18
cd08187 382 BDH Butanol dehydrogenase catalyzes the conversion 95.12
cd08178 398 AAD_C C-terminal alcohol dehydrogenase domain of t 94.87
COG2515323 Acd 1-aminocyclopropane-1-carboxylate deaminase [A 94.87
PRK14021 542 bifunctional shikimate kinase/3-dehydroquinate syn 94.78
cd08181 357 PPD-like 1,3-propanediol dehydrogenase-like (PPD). 94.72
cd08172 347 GlyDH-like1 Glycerol dehydrogenases-like. Glycerol 94.62
cd08179 375 NADPH_BDH NADPH-dependent butanol dehydrogenase in 94.56
PRK10624 382 L-1,2-propanediol oxidoreductase; Provisional 94.54
cd08188 377 Fe-ADH4 Iron-containing alcohol dehydrogenases-lik 94.52
PRK09860 383 putative alcohol dehydrogenase; Provisional 94.4
PLN02834 433 3-dehydroquinate synthase 94.4
cd08190 414 HOT Hydroxyacid-oxoacid transhydrogenase (HOT) inv 94.3
cd08177 337 MAR Maleylacetate reductase is involved in many ar 94.25
PRK06203 389 aroB 3-dehydroquinate synthase; Reviewed 94.08
cd08180 332 PDD 1,3-propanediol dehydrogenase (PPD) catalyzes 93.94
cd08191 386 HHD 6-hydroxyhexanoate dehydrogenase (HHD) catalyz 93.87
COG3199 355 Predicted inorganic polyphosphate/ATP-NAD kinase [ 93.67
cd08169 344 DHQ-like Dehydroquinate synthase-like which includ 93.66
PF04392 294 ABC_sub_bind: ABC transporter substrate binding pr 93.6
COG2984 322 ABC-type uncharacterized transport system, peripla 93.52
TIGR02329 526 propionate_PrpR propionate catabolism operon regul 93.51
cd08198 369 DHQS-like2 Dehydroquinate synthase (DHQS)-like. DH 93.39
PRK13055 334 putative lipid kinase; Reviewed 93.37
TIGR00147 293 lipid kinase, YegS/Rv2252/BmrU family. The E. coli 92.77
PRK11914 306 diacylglycerol kinase; Reviewed 92.62
COG069580 GrxC Glutaredoxin and related proteins [Posttransl 92.5
cd08196 346 DHQS-like1 Dehydroquinate synthase (DHQS)-like. DH 92.49
PRK10586 362 putative oxidoreductase; Provisional 92.24
COG0371 360 GldA Glycerol dehydrogenase and related enzymes [E 92.19
KOG2835373 consensus Phosphoribosylamidoimidazole-succinocarb 92.16
PF13685250 Fe-ADH_2: Iron-containing alcohol dehydrogenase; P 91.88
cd01575 268 PBP1_GntR Ligand-binding domain of DNA transcripti 91.68
COG1454 377 EutG Alcohol dehydrogenase, class IV [Energy produ 91.65
TIGR03702 293 lip_kinase_YegS lipid kinase YegS. Members of this 91.6
PRK15138 387 aldehyde reductase; Provisional 91.51
PRK13337 304 putative lipid kinase; Reviewed 91.4
TIGR0218999 GlrX-like_plant Glutaredoxin-like family. This fam 91.3
cd06275 269 PBP1_PurR Ligand-binding domain of purine represso 91.05
TIGR0218084 GRX_euk Glutaredoxin. This model represents eukary 91.02
cd08184 347 Fe-ADH3 Iron-containing alcohol dehydrogenases-lik 90.5
cd01988132 Na_H_Antiporter_C The C-terminal domain of a subfa 90.43
cd06280 263 PBP1_LacI_like_4 Ligand-binding domain of uncharac 90.32
cd01539 303 PBP1_GGBP Periplasmic glucose/galactose-binding pr 90.0
PRK13805 862 bifunctional acetaldehyde-CoA/alcohol dehydrogenas 89.76
cd0341982 GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX h 89.7
TIGR02417 327 fruct_sucro_rep D-fructose-responsive transcriptio 89.3
PRK00861 300 putative lipid kinase; Reviewed 89.19
PF10096243 DUF2334: Uncharacterized protein conserved in bact 88.67
PRK10481224 hypothetical protein; Provisional 88.42
cd01391 269 Periplasmic_Binding_Protein_Type_1 Type 1 periplas 88.27
cd01537 264 PBP1_Repressors_Sugar_Binding_like Ligand-binding 88.06
PF00532 279 Peripla_BP_1: Periplasmic binding proteins and sug 87.65
cd06298 268 PBP1_CcpA_like Ligand-binding domain of the catabo 87.6
PRK13054 300 lipid kinase; Reviewed 87.3
cd06310 273 PBP1_ABC_sugar_binding_like_2 Periplasmic sugar-bi 87.2
TIGR03405 355 Phn_Fe-ADH phosphonate metabolism-associated iron- 87.08
cd06267 264 PBP1_LacI_sugar_binding_like Ligand binding domain 87.04
PF0046260 Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Gl 87.04
cd06321 271 PBP1_ABC_sugar_binding_like_11 Periplasmic sugar-b 86.84
cd0341875 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX b 86.8
KOG3857 465 consensus Alcohol dehydrogenase, class IV [Energy 86.74
cd06283 267 PBP1_RegR_EndR_KdgR_like Ligand-binding domain of 86.54
cd06296 270 PBP1_CatR_like Ligand-binding domain of a LacI-lik 86.5
cd06273 268 PBP1_GntR_like_1 This group includes the ligand-bi 86.12
PRK13059 295 putative lipid kinase; Reviewed 86.12
cd06323 268 PBP1_ribose_binding Periplasmic sugar-binding doma 85.94
PRK13951 488 bifunctional shikimate kinase/3-dehydroquinate syn 85.48
cd06300 272 PBP1_ABC_sugar_binding_like_1 Periplasmic sugar-bi 85.42
cd06290 265 PBP1_LacI_like_9 Ligand-binding domain of uncharac 85.36
PF01761 260 DHQ_synthase: 3-dehydroquinate synthase; PDB: 3OKF 85.15
cd06318 282 PBP1_ABC_sugar_binding_like_9 Periplasmic sugar-bi 85.07
PRK11175 305 universal stress protein UspE; Provisional 84.92
cd06311 274 PBP1_ABC_sugar_binding_like_3 Periplasmic sugar-bi 84.88
cd01542 259 PBP1_TreR_like Ligand-binding domain of DNA transc 84.87
PF13407 257 Peripla_BP_4: Periplasmic binding protein domain; 84.72
TIGR0219079 GlrX-dom Glutaredoxin-family domain. This C-termin 84.47
COG1597 301 LCB5 Sphingosine kinase and enzymes related to euk 83.65
cd06292 273 PBP1_LacI_like_10 Ligand-binding domain of unchara 83.57
cd06274 264 PBP1_FruR Ligand binding domain of DNA transcripti 83.29
PRK13057 287 putative lipid kinase; Reviewed 83.27
cd0556496 PTS_IIB_chitobiose_lichenan PTS_IIB_chitobiose_lic 83.26
TIGR02634 302 xylF D-xylose ABC transporter, substrate-binding p 83.23
cd06320 275 PBP1_allose_binding Periplasmic allose-binding dom 83.03
PRK12361 547 hypothetical protein; Provisional 82.15
cd0302773 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Eg 82.03
PRK10653 295 D-ribose transporter subunit RbsB; Provisional 81.9
cd0302972 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hyb 81.74
PRK10014 342 DNA-binding transcriptional repressor MalI; Provis 81.62
TIGR0218179 GRX_bact Glutaredoxin, GrxC family. This family of 81.15
cd01538 288 PBP1_ABC_xylose_binding Periplasmic xylose-binding 81.13
cd06284 267 PBP1_LacI_like_6 Ligand-binding domain of an uncha 80.78
PRK10727 343 DNA-binding transcriptional regulator GalR; Provis 80.68
TIGR02717 447 AcCoA-syn-alpha acetyl coenzyme A synthetase (ADP 80.28
PRK11175305 universal stress protein UspE; Provisional 80.16
cd06313 272 PBP1_ABC_sugar_binding_like_5 Periplasmic sugar-bi 80.05
PRK10423 327 transcriptional repressor RbsR; Provisional 80.04
>TIGR01162 purE phosphoribosylaminoimidazole carboxylase, PurE protein Back     alignment and domain information 
Probab=100.00  E-value=4.2e-62  Score=375.18  Aligned_cols=138  Identities=46%  Similarity=0.726  Sum_probs=135.9

Q ss_pred             CCCcCCHHHHHHHHHHHHHhCCCeEEEEEccCCCchHHHHHHHHhhhcCCeEEEEecCcCCchhHHhhhccCCcEEEecC
Q 032570            1 MESDLDLPVMNDAARTLSDFGVPYEIKILPPHQNCKEALSYALSAKERGIKIIIVGDGVEAHLSGVAAANSQILVIRVPL   80 (138)
Q Consensus         1 mGS~SD~~~~~~~~~~L~~~gi~~~~~V~SaHR~p~~~~~~~~~~~~~~~~viIa~AG~~a~L~gvva~~t~~PVIgvP~   80 (138)
                      |||+||+++++|+.++|++|||+||++|+|+||+|+++.+|++++++++++|||++||++||||||+|++|++||||||+
T Consensus         5 mGS~SD~~~~~~a~~~L~~~gi~~dv~V~SaHRtp~~~~~~~~~a~~~g~~viIa~AG~aa~Lpgvva~~t~~PVIgvP~   84 (156)
T TIGR01162         5 MGSDSDLPTMKKAADILEEFGIPYELRVVSAHRTPELMLEYAKEAEERGIKVIIAGAGGAAHLPGMVAALTPLPVIGVPV   84 (156)
T ss_pred             ECcHhhHHHHHHHHHHHHHcCCCeEEEEECcccCHHHHHHHHHHHHHCCCeEEEEeCCccchhHHHHHhccCCCEEEecC
Confidence            89999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCCchh-hhhhhcCCCCCeeeEEecCCchhHHHHHHHHHccCCHHHHHHHHHHHhC
Q 032570           81 LSEDWSEDD-VINSIRMPSHVQVASVPRNNAKNAALYAVKVLGIADEDLLERIRKYVEE  138 (138)
Q Consensus        81 ~~~~~~G~d-LlS~lqmP~GvpvatV~I~~~~nAA~~AaqIl~~~~~~l~~kl~~~~~~  138 (138)
                      ++++++|+| ||||+|||+|+||+||+|||++|||++|+|||+++|++||+||++||++
T Consensus        85 ~~~~l~G~daLlS~vqmP~gvpvatv~I~~~~nAa~~AaqIl~~~d~~l~~kl~~~r~~  143 (156)
T TIGR01162        85 PSKALSGLDSLLSIVQMPSGVPVATVAIGNAGNAALLAAQILGIKDPELAEKLKEYREN  143 (156)
T ss_pred             CccCCCCHHHHHHHhcCCCCCeeEEEEcCChhHHHHHHHHHHcCCCHHHHHHHHHHHHH
Confidence            988899999 9999999999999999999999999999999999999999999999974

Phosphoribosylaminoimidazole carboxylase is a fusion protein in plants and fungi, but consists of two non-interacting proteins in bacteria, PurK and PurE. This model represents PurK, an N5-CAIR mutase.
>COG0041 PurE Phosphoribosylcarboxyaminoimidazole (NCAIR) mutase [Nucleotide transport and metabolism] Back     alignment and domain information
>PF00731 AIRC: AIR carboxylase; InterPro: IPR000031 Phosphoribosylaminoimidazole carboxylase is a fusion protein in plants and fungi, but consists of two non-interacting proteins in bacteria, PurK and PurE Back     alignment and domain information
>PLN02948 phosphoribosylaminoimidazole carboxylase Back     alignment and domain information
>COG1691 NCAIR mutase (PurE)-related proteins [General function prediction only] Back     alignment and domain information
>KOG2835 consensus Phosphoribosylamidoimidazole-succinocarboxamide synthase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd08550 GlyDH-like Glycerol_dehydrogenase-like Back     alignment and domain information
>cd08170 GlyDH Glycerol dehydrogenases (GlyDH) catalyzes oxidation of glycerol to dihydroxyacetone in glycerol dissmilation Back     alignment and domain information
>PRK00843 egsA NAD(P)-dependent glycerol-1-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>PRK09423 gldA glycerol dehydrogenase; Provisional Back     alignment and domain information
>cd08175 G1PDH Glycerol-1-phosphate dehydrogenase (G1PDH) catalyzes the reversible reduction of dihydroxyacetone phosphate (DHAP) to glycerol-1-phosphate (G1P) in an NADH-dependent manner Back     alignment and domain information
>TIGR01357 aroB 3-dehydroquinate synthase Back     alignment and domain information
>cd08171 GlyDH-like2 Glycerol dehydrogenase-like Back     alignment and domain information
>cd07766 DHQ_Fe-ADH Dehydroquinate synthase-like (DHQ-like) and iron-containing alcohol dehydrogenases (Fe-ADH) Back     alignment and domain information
>cd08195 DHQS Dehydroquinate synthase (DHQS) catalyzes the conversion of DAHP to DHQ in shikimate pathway for aromatic compounds synthesis Back     alignment and domain information
>cd08551 Fe-ADH iron-containing alcohol dehydrogenases (Fe-ADH)-like Back     alignment and domain information
>cd08173 Gro1PDH Sn-glycerol-1-phosphate dehydrogenase (Gro1PDH) catalyzes the reversible conversion between dihydroxyacetone phosphate and glycerol-1-phosphate using either NADH or NADPH as a coenzyme Back     alignment and domain information
>cd08194 Fe-ADH6 Iron-containing alcohol dehydrogenases-like Back     alignment and domain information
>PRK15454 ethanol dehydrogenase EutG; Provisional Back     alignment and domain information
>cd08183 Fe-ADH2 Iron-containing alcohol dehydrogenases-like Back     alignment and domain information
>cd08193 HVD 5-hydroxyvalerate dehydrogenase (HVD) catalyzes the oxidation of 5-hydroxyvalerate to 5-oxovalerate with NAD+ as cofactor Back     alignment and domain information
>cd08192 Fe-ADH7 Iron-containing alcohol dehydrogenases-like, involved in the linear alkylbenzenesulfonate (LAS) degradation pathway Back     alignment and domain information
>cd08197 DOIS 2-deoxy-scyllo-inosose synthase (DOIS) catalyzes carbocycle formation from D-glucose-6-phosphate to 2-deoxy-scyllo-inosose through a multistep reaction in the biosynthesis of aminoglycoside antibiotics Back     alignment and domain information
>cd08549 G1PDH_related Glycerol-1-phosphate_dehydrogenase and related proteins Back     alignment and domain information
>PF06506 PrpR_N: Propionate catabolism activator; InterPro: IPR010524 Two-component signal transduction systems enable bacteria to sense, respond, and adapt to a wide range of environments, stressors, and growth conditions [] Back     alignment and domain information
>PRK00002 aroB 3-dehydroquinate synthase; Reviewed Back     alignment and domain information
>cd08182 HEPD Hydroxyethylphosphoate dehydrogenase (HEPD) catalyzes the reduction of phosphonoacetaldehyde (PnAA) to hydroxyethylphosphoate (HEP) Back     alignment and domain information
>cd08199 EEVS 2-epi-5-epi-valiolone synthase (EEVS) Back     alignment and domain information
>cd08185 Fe-ADH1 Iron-containing alcohol dehydrogenases-like Back     alignment and domain information
>PRK15424 propionate catabolism operon regulatory protein PrpR; Provisional Back     alignment and domain information
>cd08186 Fe-ADH8 Iron-containing alcohol dehydrogenase Back     alignment and domain information
>cd08189 Fe-ADH5 Iron-containing alcohol dehydrogenases-like Back     alignment and domain information
>cd08174 G1PDH-like Glycerol-1-phosphate dehydrogenase-like Back     alignment and domain information
>TIGR02638 lactal_redase lactaldehyde reductase Back     alignment and domain information
>cd08176 LPO Lactadehyde:propanediol oxidoreductase (LPO) catalyzes the interconversion between L-lactaldehyde and L-1,2-propanediol in Escherichia coli and other enterobacteria Back     alignment and domain information
>PF00465 Fe-ADH: Iron-containing alcohol dehydrogenase ; InterPro: IPR001670 Alcohol dehydrogenase (1 Back     alignment and domain information
>cd08187 BDH Butanol dehydrogenase catalyzes the conversion of butyraldehyde to butanol with the cofactor NAD(P)H being oxidized in the process Back     alignment and domain information
>cd08178 AAD_C C-terminal alcohol dehydrogenase domain of the acetaldehyde dehydrogenase-alcohol dehydrogenase bifunctional two-domain protein (AAD) Back     alignment and domain information
>COG2515 Acd 1-aminocyclopropane-1-carboxylate deaminase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14021 bifunctional shikimate kinase/3-dehydroquinate synthase; Provisional Back     alignment and domain information
>cd08181 PPD-like 1,3-propanediol dehydrogenase-like (PPD) Back     alignment and domain information
>cd08172 GlyDH-like1 Glycerol dehydrogenases-like Back     alignment and domain information
>cd08179 NADPH_BDH NADPH-dependent butanol dehydrogenase involved in the butanol and ethanol formation pathway in bacteria Back     alignment and domain information
>PRK10624 L-1,2-propanediol oxidoreductase; Provisional Back     alignment and domain information
>cd08188 Fe-ADH4 Iron-containing alcohol dehydrogenases-like Back     alignment and domain information
>PRK09860 putative alcohol dehydrogenase; Provisional Back     alignment and domain information
>PLN02834 3-dehydroquinate synthase Back     alignment and domain information
>cd08190 HOT Hydroxyacid-oxoacid transhydrogenase (HOT) involved in gamma-hydroxybutyrate metabolism Back     alignment and domain information
>cd08177 MAR Maleylacetate reductase is involved in many aromatic compounds degradation pathways of aerobic microbes Back     alignment and domain information
>PRK06203 aroB 3-dehydroquinate synthase; Reviewed Back     alignment and domain information
>cd08180 PDD 1,3-propanediol dehydrogenase (PPD) catalyzes the reduction of 3-hydroxypropionaldehyde (3-HPA) to 1,3-propanediol in glycerol metabolism Back     alignment and domain information
>cd08191 HHD 6-hydroxyhexanoate dehydrogenase (HHD) catalyzes the oxidation of 6-hydroxyhexanoate to 6-oxohexanoate Back     alignment and domain information
>COG3199 Predicted inorganic polyphosphate/ATP-NAD kinase [General function prediction only] Back     alignment and domain information
>cd08169 DHQ-like Dehydroquinate synthase-like which includes dehydroquinate synthase, 2-deoxy-scyllo-inosose synthase, and 2-epi-5-epi-valiolone synthase Back     alignment and domain information
>PF04392 ABC_sub_bind: ABC transporter substrate binding protein; InterPro: IPR007487 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>COG2984 ABC-type uncharacterized transport system, periplasmic component [General function prediction only] Back     alignment and domain information
>TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR Back     alignment and domain information
>cd08198 DHQS-like2 Dehydroquinate synthase (DHQS)-like Back     alignment and domain information
>PRK13055 putative lipid kinase; Reviewed Back     alignment and domain information
>TIGR00147 lipid kinase, YegS/Rv2252/BmrU family Back     alignment and domain information
>PRK11914 diacylglycerol kinase; Reviewed Back     alignment and domain information
>COG0695 GrxC Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd08196 DHQS-like1 Dehydroquinate synthase (DHQS)-like Back     alignment and domain information
>PRK10586 putative oxidoreductase; Provisional Back     alignment and domain information
>COG0371 GldA Glycerol dehydrogenase and related enzymes [Energy production and conversion] Back     alignment and domain information
>KOG2835 consensus Phosphoribosylamidoimidazole-succinocarboxamide synthase [Nucleotide transport and metabolism] Back     alignment and domain information
>PF13685 Fe-ADH_2: Iron-containing alcohol dehydrogenase; PDB: 3CE9_C Back     alignment and domain information
>cd01575 PBP1_GntR Ligand-binding domain of DNA transcription repressor GntR specific for gluconate, a member of the LacI-GalR family of bacterial transcription regulators Back     alignment and domain information
>COG1454 EutG Alcohol dehydrogenase, class IV [Energy production and conversion] Back     alignment and domain information
>TIGR03702 lip_kinase_YegS lipid kinase YegS Back     alignment and domain information
>PRK15138 aldehyde reductase; Provisional Back     alignment and domain information
>PRK13337 putative lipid kinase; Reviewed Back     alignment and domain information
>TIGR02189 GlrX-like_plant Glutaredoxin-like family Back     alignment and domain information
>cd06275 PBP1_PurR Ligand-binding domain of purine repressor, PurR, which functions as the master regulatory protein of de novo purine nucleotide biosynthesis in Escherichia coli Back     alignment and domain information
>TIGR02180 GRX_euk Glutaredoxin Back     alignment and domain information
>cd08184 Fe-ADH3 Iron-containing alcohol dehydrogenases-like Back     alignment and domain information
>cd01988 Na_H_Antiporter_C The C-terminal domain of a subfamily of Na+ /H+ antiporter existed in bacteria and archea Back     alignment and domain information
>cd06280 PBP1_LacI_like_4 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors Back     alignment and domain information
>cd01539 PBP1_GGBP Periplasmic glucose/galactose-binding protein (GGBP) involved in chemotaxis towards, and active transport of, glucose and galactose in various bacterial species Back     alignment and domain information
>PRK13805 bifunctional acetaldehyde-CoA/alcohol dehydrogenase; Provisional Back     alignment and domain information
>cd03419 GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX human class 1 and 2 (h_1_2)-like subfamily; composed of proteins similar to human GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>TIGR02417 fruct_sucro_rep D-fructose-responsive transcription factor Back     alignment and domain information
>PRK00861 putative lipid kinase; Reviewed Back     alignment and domain information
>PF10096 DUF2334: Uncharacterized protein conserved in bacteria (DUF2334); InterPro: IPR018763 This group of proteins has no known function Back     alignment and domain information
>PRK10481 hypothetical protein; Provisional Back     alignment and domain information
>cd01391 Periplasmic_Binding_Protein_Type_1 Type 1 periplasmic binding fold superfamily Back     alignment and domain information
>cd01537 PBP1_Repressors_Sugar_Binding_like Ligand-binding domain of the LacI-GalR family of transcription regulators and the sugar-binding domain of ABC-type transport systems Back     alignment and domain information
>PF00532 Peripla_BP_1: Periplasmic binding proteins and sugar binding domain of LacI family; InterPro: IPR001761 This family includes the periplasmic binding proteins, and the LacI family transcriptional regulators Back     alignment and domain information
>cd06298 PBP1_CcpA_like Ligand-binding domain of the catabolite control protein A (CcpA), which functions as the major transcriptional regulator of carbon catabolite repression/regulation Back     alignment and domain information
>PRK13054 lipid kinase; Reviewed Back     alignment and domain information
>cd06310 PBP1_ABC_sugar_binding_like_2 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>TIGR03405 Phn_Fe-ADH phosphonate metabolism-associated iron-containing alcohol dehydrogenase Back     alignment and domain information
>cd06267 PBP1_LacI_sugar_binding_like Ligand binding domain of the LacI tanscriptional regulator family belonging to the type I periplasmic-binding fold protein superfamily Back     alignment and domain information
>PF00462 Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors Back     alignment and domain information
>cd06321 PBP1_ABC_sugar_binding_like_11 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>cd03418 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX bacterial class 1 and 3 (b_1_3)-like subfamily; composed of bacterial GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>KOG3857 consensus Alcohol dehydrogenase, class IV [Energy production and conversion] Back     alignment and domain information
>cd06283 PBP1_RegR_EndR_KdgR_like Ligand-binding domain of DNA transcription repressor RegR and other putative regulators such as KdgR and EndR Back     alignment and domain information
>cd06296 PBP1_CatR_like Ligand-binding domain of a LacI-like transcriptional regulator, CatR which is involved in catechol degradation Back     alignment and domain information
>cd06273 PBP1_GntR_like_1 This group includes the ligand-binding domain of putative DNA transcription repressors which are highly similar to that of the repressor specific for gluconate (GntR), a member of the LacI-GalR family of bacterial transcription regulators Back     alignment and domain information
>PRK13059 putative lipid kinase; Reviewed Back     alignment and domain information
>cd06323 PBP1_ribose_binding Periplasmic sugar-binding domain of the thermophilic Thermoanaerobacter tengcongensis ribose binding protein (ttRBP) and its mesophilic homologs Back     alignment and domain information
>PRK13951 bifunctional shikimate kinase/3-dehydroquinate synthase; Provisional Back     alignment and domain information
>cd06300 PBP1_ABC_sugar_binding_like_1 Periplasmic sugar-binding component of uncharacterized ABC-type transport systems that are members of the pentose/hexose sugar-binding protein family of the type I periplasmic binding protein superfamily Back     alignment and domain information
>cd06290 PBP1_LacI_like_9 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors Back     alignment and domain information
>PF01761 DHQ_synthase: 3-dehydroquinate synthase; PDB: 3OKF_A 1NVA_B 1NUA_A 1NVE_D 1NVB_B 1SG6_A 1NR5_A 1NRX_B 1NVD_A 1NVF_C Back     alignment and domain information
>cd06318 PBP1_ABC_sugar_binding_like_9 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>PRK11175 universal stress protein UspE; Provisional Back     alignment and domain information
>cd06311 PBP1_ABC_sugar_binding_like_3 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>cd01542 PBP1_TreR_like Ligand-binding domain of DNA transcription repressor specific for trehalose (TreR) which is a member of the LacI-GalR family of bacterial transcription regulators Back     alignment and domain information
>PF13407 Peripla_BP_4: Periplasmic binding protein domain; PDB: 3BRS_B 3GBP_A 3GA5_A 1GCG_A 1GCA_A 3H75_A 3D02_A 3L49_B 3EJW_B 3T95_A Back     alignment and domain information
>TIGR02190 GlrX-dom Glutaredoxin-family domain Back     alignment and domain information
>COG1597 LCB5 Sphingosine kinase and enzymes related to eukaryotic diacylglycerol kinase [Lipid metabolism / General function prediction only] Back     alignment and domain information
>cd06292 PBP1_LacI_like_10 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors Back     alignment and domain information
>cd06274 PBP1_FruR Ligand binding domain of DNA transcription repressor specific for fructose (FruR) and its close homologs Back     alignment and domain information
>PRK13057 putative lipid kinase; Reviewed Back     alignment and domain information
>cd05564 PTS_IIB_chitobiose_lichenan PTS_IIB_chitobiose_lichenan: subunit IIB of enzyme II (EII) of the N,N-diacetylchitobiose-specific and lichenan-specific phosphoenolpyruvate:carbohydrate phosphotransferase system (PTS) Back     alignment and domain information
>TIGR02634 xylF D-xylose ABC transporter, substrate-binding protein Back     alignment and domain information
>cd06320 PBP1_allose_binding Periplasmic allose-binding domain of bacterial transport systems that function as a primary receptor of active transport and chemotaxis Back     alignment and domain information
>PRK12361 hypothetical protein; Provisional Back     alignment and domain information
>cd03027 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Egl-10, and Pleckstrin (DEP) subfamily; composed of uncharacterized proteins containing a GRX domain and additional domains DEP and DUF547, both of which have unknown functions Back     alignment and domain information
>PRK10653 D-ribose transporter subunit RbsB; Provisional Back     alignment and domain information
>cd03029 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hybrid subfamily; composed of hybrid proteins containing peroxiredoxin (PRX) and GRX domains, which is found in some pathogenic bacteria and cyanobacteria Back     alignment and domain information
>PRK10014 DNA-binding transcriptional repressor MalI; Provisional Back     alignment and domain information
>TIGR02181 GRX_bact Glutaredoxin, GrxC family Back     alignment and domain information
>cd01538 PBP1_ABC_xylose_binding Periplasmic xylose-binding component of the ABC-type transport systems that belong to a family of pentose/hexose sugar-binding proteins of the type I periplasmic binding protein (PBP1) superfamily Back     alignment and domain information
>cd06284 PBP1_LacI_like_6 Ligand-binding domain of an uncharacterized transcription regulator from Actinobacillus succinogenes and its close homologs from other bacteria Back     alignment and domain information
>PRK10727 DNA-binding transcriptional regulator GalR; Provisional Back     alignment and domain information
>TIGR02717 AcCoA-syn-alpha acetyl coenzyme A synthetase (ADP forming), alpha domain Back     alignment and domain information
>PRK11175 universal stress protein UspE; Provisional Back     alignment and domain information
>cd06313 PBP1_ABC_sugar_binding_like_5 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>PRK10423 transcriptional repressor RbsR; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query138
1o4v_A183 Crystal Structure Of The Catalytic Subunit Of A Pho 2e-24
3lp6_A174 Crystal Structure Of Rv3275c-E60a From Mycobacteriu 3e-19
4b4k_A181 Crystal Structure Of Bacillus Anthracis Pure Length 2e-16
1xmp_A170 Crystal Structure Of Pure (Ba0288) From Bacillus An 2e-16
3opq_A163 Phosphoribosylaminoimidazole Carboxylase With Fruct 8e-15
3oow_A166 Octameric Structure Of The Phosphoribosylaminoimida 8e-15
4grd_A173 Crystal Structure Of Phosphoribosylaminoimidazole C 1e-11
2ywx_A157 Crystal Structure Of Phosphoribosylaminoimidazole C 2e-11
2fw1_A183 Structure Of Pure (n5-carboxyaminoimidazole Ribonuc 5e-10
1u11_A182 Pure (N5-Carboxyaminoimidazole Ribonucleotide Mutas 5e-10
3ors_A163 Crystal Structure Of N5-Carboxyaminoimidazole Ribon 1e-09
2fwa_A183 Structure Of Pure (n5-carboxyaminoimidazole Ribonuc 4e-09
2fw6_A183 Structure Of Pure (N5-Carboxyaminoimidazole Ribonuc 4e-09
2nsh_A169 E. Coli Pure H45q Mutant Complexed With Nitro-Air L 5e-09
2nsl_A169 E. Coli Pure H45n Mutant Complexed With Cair Length 5e-09
2fwb_A183 Structure Of Pure (N5-Carboxyaminoimidazole Ribonuc 5e-09
2fw9_A183 Structure Of Pure (n5-carboxyaminoimidazole Ribonuc 5e-09
2fwi_A183 Structure Of Pure (n5-carboxyaminoimidazole Ribonuc 8e-09
2h31_A425 Crystal Structure Of Human Paics, A Bifunctional Ca 3e-08
3kuu_A174 Structure Of The Pure Phosphoribosylaminoimidazole 8e-08
1d7a_A161 Crystal Structure Of E. Coli Pure-Mononucleotide Co 1e-07
1qcz_A169 Crystal Structure Of E. Coli Pure, An Unusual Mutas 1e-07
2ate_A169 Structure Of The Complex Of Pure With Nitroair Leng 1e-07
3rgg_A159 Crystal Structure Of Treponema Denticola Pure Bound 2e-07
3rg8_A159 Crystal Structure Of Treponema Denticola Pure Lengt 2e-07
2fw8_A183 Structure Of Pure (N5-Carboxyaminoimidazole Ribonuc 2e-06
3trh_A169 Structure Of A Phosphoribosylaminoimidazole Carboxy 1e-05
>pdb|1O4V|A Chain A, Crystal Structure Of The Catalytic Subunit Of A Phosphoribosylaminoimidazole Mutase (Tm0446) From Thermotoga Maritima At 1.77 A Resolution Length = 183 Back     alignment and structure 
Iteration: 1

 Score =  107 bits (267), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 59/138 (42%), Positives = 85/138 (61%), Gaps = 1/138 (0%)
Query: 1   MESDLDLPVMNDAARTLSDFGVPYEIKILPPHQNCKEALSYALSAKERGIKIIIVGDGVE 60
           M SD DLPVM  AA  L +FG+ YEI I+  H+       YA +A+ERGI++II G G  
Sbjct: 20  MGSDSDLPVMKQAAEILEEFGIDYEITIVSAHRTPDRMFEYAKNAEERGIEVIIAGAGGA 79
Query: 61  AHLSGVAAANSQILVIRVPLLSEDWSEDDVINSI-RMPSHVQVASVPRNNAKNAALYAVK 119
           AHL G+ A+ + + VI VP+ +   +  D + SI +MP  V VA+V  NNAKNA + A  
Sbjct: 80  AHLPGMVASITHLPVIGVPVKTSTLNGLDSLFSIVQMPGGVPVATVAINNAKNAGILAAS 139
Query: 120 VLGIADEDLLERIRKYVE 137
           +LGI   ++  ++++Y E
Sbjct: 140 ILGIKYPEIARKVKEYKE 157
>pdb|3LP6|A Chain A, Crystal Structure Of Rv3275c-E60a From Mycobacterium Tubercu 1.7a Resolution Length = 174 Back     alignment and structure
>pdb|4B4K|A Chain A, Crystal Structure Of Bacillus Anthracis Pure Length = 181 Back     alignment and structure
>pdb|1XMP|A Chain A, Crystal Structure Of Pure (Ba0288) From Bacillus Anthracis At 1.8 Resolution Length = 170 Back     alignment and structure
>pdb|3OPQ|A Chain A, Phosphoribosylaminoimidazole Carboxylase With Fructose-6-Phosphate Bound To The Central Channel Of The Octameric Protein Structure. Length = 163 Back     alignment and structure
>pdb|3OOW|A Chain A, Octameric Structure Of The Phosphoribosylaminoimidazole Carboxylase Catalytic Subunit From Francisella Tularensis Subsp. Tularensis Schu S4. Length = 166 Back     alignment and structure
>pdb|4GRD|A Chain A, Crystal Structure Of Phosphoribosylaminoimidazole Carboxylase Catalytic Subunit From Burkholderia Cenocepacia J2315 Length = 173 Back     alignment and structure
>pdb|2YWX|A Chain A, Crystal Structure Of Phosphoribosylaminoimidazole Carboxylase Catalytic Subunit From Methanocaldococcus Jannaschii Length = 157 Back     alignment and structure
>pdb|2FW1|A Chain A, Structure Of Pure (n5-carboxyaminoimidazole Ribonucleotide Mutase) From The Acidophilic Bacterium Acetobacter Aceti, At Ph 8.5 Length = 183 Back     alignment and structure
>pdb|1U11|A Chain A, Pure (N5-Carboxyaminoimidazole Ribonucleotide Mutase) From The Acidophile Acetobacter Aceti Length = 182 Back     alignment and structure
>pdb|3ORS|A Chain A, Crystal Structure Of N5-Carboxyaminoimidazole Ribonucleotide Mutase From Staphylococcus Aureus Length = 163 Back     alignment and structure
>pdb|2FWA|A Chain A, Structure Of Pure (n5-carboxyaminoimidazole Ribonucleotide Mutase) H89n From The Acidophilic Bacterium Acetobacter Aceti, At Ph 7 Length = 183 Back     alignment and structure
>pdb|2FW6|A Chain A, Structure Of Pure (N5-Carboxyaminoimidazole Ribonucleotide Mutase) Mutant H59n From The Acidophilic Bacterium Acetobacter Aceti, At Ph 5.4 Length = 183 Back     alignment and structure
>pdb|2NSH|A Chain A, E. Coli Pure H45q Mutant Complexed With Nitro-Air Length = 169 Back     alignment and structure
>pdb|2NSL|A Chain A, E. Coli Pure H45n Mutant Complexed With Cair Length = 169 Back     alignment and structure
>pdb|2FWB|A Chain A, Structure Of Pure (N5-Carboxyaminoimidazole Ribonucleotide Mutase) H89f From The Acidophilic Bacterium Acetobacter Aceti, At Ph 8 Length = 183 Back     alignment and structure
>pdb|2FW9|A Chain A, Structure Of Pure (n5-carboxyaminoimidazole Ribonucleotide Mutase) H59f From The Acidophilic Bacterium Acetobacter Aceti, At Ph 8 Length = 183 Back     alignment and structure
>pdb|2FWI|A Chain A, Structure Of Pure (n5-carboxyaminoimidazole Ribonucleotide Mutase) H59d, From The Acidophilic Bacterium Acetobacter Aceti, Complexed With 5-aminoimidazole Ribonucleotide (air) Length = 183 Back     alignment and structure
>pdb|2H31|A Chain A, Crystal Structure Of Human Paics, A Bifunctional Carboxylase And Synthetase In Purine Biosynthesis Length = 425 Back     alignment and structure
>pdb|3KUU|A Chain A, Structure Of The Pure Phosphoribosylaminoimidazole Carboxylase Catalytic Subunit From Yersinia Pestis Length = 174 Back     alignment and structure
>pdb|1D7A|A Chain A, Crystal Structure Of E. Coli Pure-Mononucleotide Complex. Length = 161 Back     alignment and structure
>pdb|1QCZ|A Chain A, Crystal Structure Of E. Coli Pure, An Unusual Mutase That Catalyzes The Conversion Of N5-carboxyaminoimidazole Ribonucleotide (n5-cair) To 4-carboxyaminoimidazole Ribonucleotide (cair) In The Purine Biosynthetic Pathway Length = 169 Back     alignment and structure
>pdb|2ATE|A Chain A, Structure Of The Complex Of Pure With Nitroair Length = 169 Back     alignment and structure
>pdb|3RGG|A Chain A, Crystal Structure Of Treponema Denticola Pure Bound To Air Length = 159 Back     alignment and structure
>pdb|3RG8|A Chain A, Crystal Structure Of Treponema Denticola Pure Length = 159 Back     alignment and structure
>pdb|2FW8|A Chain A, Structure Of Pure (N5-Carboxyaminoimidazole Ribonucleotide Mutase) H89g From The Acidophilic Bacterium Acetobacter Aceti, At Ph 8 Length = 183 Back     alignment and structure
>pdb|3TRH|A Chain A, Structure Of A Phosphoribosylaminoimidazole Carboxylase Catalytic Subunit (Pure) From Coxiella Burnetii Length = 169 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query138
1o4v_A183 Phosphoribosylaminoimidazole mutase PURE; structur 7e-40
3lp6_A174 Phosphoribosylaminoimidazole carboxylase catalyti; 3e-39
3rg8_A159 Phosphoribosylaminoimidazole carboxylase, PURE PR; 1e-37
3trh_A169 Phosphoribosylaminoimidazole carboxylase carboxylt 5e-35
3ors_A163 N5-carboxyaminoimidazole ribonucleotide mutase; is 1e-34
2ywx_A157 Phosphoribosylaminoimidazole carboxylase catalyti; 2e-34
1xmp_A170 PURE, phosphoribosylaminoimidazole carboxylase; pu 5e-34
4b4k_A181 N5-carboxyaminoimidazole ribonucleotide mutase; is 6e-34
3oow_A166 Phosphoribosylaminoimidazole carboxylase,catalyic; 2e-33
1u11_A182 PURE (N5-carboxyaminoimidazole ribonucleotide MUT; 6e-33
2h31_A425 Multifunctional protein ADE2; alpha-beta-alpha, li 7e-33
3kuu_A174 Phosphoribosylaminoimidazole carboxylase catalyti 1e-32
>1o4v_A Phosphoribosylaminoimidazole mutase PURE; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; 1.77A {Thermotoga maritima} SCOP: c.23.8.1 Length = 183 Back     alignment and structure
 Score =  130 bits (330), Expect = 7e-40
 Identities = 59/139 (42%), Positives = 85/139 (61%), Gaps = 1/139 (0%)

Query: 1   MESDLDLPVMNDAARTLSDFGVPYEIKILPPHQNCKEALSYALSAKERGIKIIIVGDGVE 60
           M SD DLPVM  AA  L +FG+ YEI I+  H+       YA +A+ERGI++II G G  
Sbjct: 20  MGSDSDLPVMKQAAEILEEFGIDYEITIVSAHRTPDRMFEYAKNAEERGIEVIIAGAGGA 79

Query: 61  AHLSGVAAANSQILVIRVPLLSEDWSEDDVINSI-RMPSHVQVASVPRNNAKNAALYAVK 119
           AHL G+ A+ + + VI VP+ +   +  D + SI +MP  V VA+V  NNAKNA + A  
Sbjct: 80  AHLPGMVASITHLPVIGVPVKTSTLNGLDSLFSIVQMPGGVPVATVAINNAKNAGILAAS 139

Query: 120 VLGIADEDLLERIRKYVEE 138
           +LGI   ++  ++++Y E 
Sbjct: 140 ILGIKYPEIARKVKEYKER 158
>3lp6_A Phosphoribosylaminoimidazole carboxylase catalyti; alpha and beta protein, structural genomics, PSI-2, protein initiative; 1.70A {Mycobacterium tuberculosis} Length = 174 Back     alignment and structure
>3rg8_A Phosphoribosylaminoimidazole carboxylase, PURE PR; purine biosynthesis, lyase; 1.74A {Treponema denticola} PDB: 3rgg_A* Length = 159 Back     alignment and structure
>3trh_A Phosphoribosylaminoimidazole carboxylase carboxyltransferase subunit; purines, pyrimidines, nucleosides, nucleotides, lyase; 2.20A {Coxiella burnetii} Length = 169 Back     alignment and structure
>3ors_A N5-carboxyaminoimidazole ribonucleotide mutase; isomerase, isomerase,biosynthetic protein; 1.45A {Staphylococcus aureus subsp} Length = 163 Back     alignment and structure
>2ywx_A Phosphoribosylaminoimidazole carboxylase catalyti; rossmann fold, structural genomics, NPPSFA; 2.31A {Methanocaldococcus jannaschii} Length = 157 Back     alignment and structure
>1xmp_A PURE, phosphoribosylaminoimidazole carboxylase; purine biosynthesis, spine, lyase; 1.80A {Bacillus anthracis} SCOP: c.23.8.1 Length = 170 Back     alignment and structure
>4b4k_A N5-carboxyaminoimidazole ribonucleotide mutase; isomerase; 2.50A {Bacillus anthracis} Length = 181 Back     alignment and structure
>3oow_A Phosphoribosylaminoimidazole carboxylase,catalyic; structural genomics, center for structural genomics of infec diseases, csgid; HET: MSE; 1.75A {Francisella tularensis subsp} PDB: 3opq_A* Length = 166 Back     alignment and structure
>1u11_A PURE (N5-carboxyaminoimidazole ribonucleotide MUT; acidophIle, protein stability, lyase; HET: CIT; 1.55A {Acetobacter aceti} SCOP: c.23.8.1 PDB: 2fwj_A* 2fw1_A* 2fwb_A 2fwa_A 2fw9_A 2fw7_A 2fw6_A 2fwp_A* 2fwi_A* 2fw8_A Length = 182 Back     alignment and structure
>2h31_A Multifunctional protein ADE2; alpha-beta-alpha, ligase, lyase; 2.80A {Homo sapiens} Length = 425 Back     alignment and structure
>3kuu_A Phosphoribosylaminoimidazole carboxylase catalyti PURE; 3-layer (ABA) sandwich, rossmann fold, csgid, lyase, structu genomics; 1.41A {Yersinia pestis} PDB: 1d7a_A* 1qcz_A 2ate_A* 2nsl_A* 2nsh_A* 2nsj_A* Length = 174 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query138
3ors_A163 N5-carboxyaminoimidazole ribonucleotide mutase; is 100.0
3trh_A169 Phosphoribosylaminoimidazole carboxylase carboxylt 100.0
3lp6_A174 Phosphoribosylaminoimidazole carboxylase catalyti; 100.0
1xmp_A170 PURE, phosphoribosylaminoimidazole carboxylase; pu 100.0
3kuu_A174 Phosphoribosylaminoimidazole carboxylase catalyti 100.0
3oow_A166 Phosphoribosylaminoimidazole carboxylase,catalyic; 100.0
1o4v_A183 Phosphoribosylaminoimidazole mutase PURE; structur 100.0
1u11_A182 PURE (N5-carboxyaminoimidazole ribonucleotide MUT; 100.0
4b4k_A181 N5-carboxyaminoimidazole ribonucleotide mutase; is 100.0
3rg8_A159 Phosphoribosylaminoimidazole carboxylase, PURE PR; 100.0
4grd_A173 N5-CAIR mutase, phosphoribosylaminoimidazole carbo 100.0
2ywx_A157 Phosphoribosylaminoimidazole carboxylase catalyti; 100.0
2h31_A425 Multifunctional protein ADE2; alpha-beta-alpha, li 100.0
2q5c_A196 NTRC family transcriptional regulator; structural 96.94
2pju_A225 Propionate catabolism operon regulatory protein; s 96.7
3uhj_A 387 Probable glycerol dehydrogenase; structural genomi 96.6
1jq5_A 370 Glycerol dehydrogenase; oxidoreductase, NAD, glyce 96.48
3ox4_A 383 Alcohol dehydrogenase 2; iron, NAD, oxidoreductase 96.42
1o2d_A 371 Alcohol dehydrogenase, iron-containing; TM0920, st 95.98
3ce9_A 354 Glycerol dehydrogenase; NP_348253.1, 3-dehydroquin 95.98
1rrm_A 386 Lactaldehyde reductase; structural genomics, dehyd 95.74
3hl0_A 353 Maleylacetate reductase; structur genomics, PSI-2, 95.74
1sg6_A 393 Pentafunctional AROM polypeptide; shikimate pathwa 95.73
3bfj_A 387 1,3-propanediol oxidoreductase; opportunistic path 95.69
1ta9_A 450 Glycerol dehydrogenase; oxidoredu; 1.90A {Schizosa 95.67
1vlj_A 407 NADH-dependent butanol dehydrogenase; TM0820, stru 95.67
3jzd_A 358 Iron-containing alcohol dehydrogenase; YP_298327.1 95.32
3okf_A 390 3-dehydroquinate synthase; structural genomics, ce 95.09
1mjh_A162 Protein (ATP-binding domain of protein MJ0577); hy 94.28
3qbe_A 368 3-dehydroquinate synthase; shikimate pathway, myco 94.12
3iv7_A 364 Alcohol dehydrogenase IV; NP_602249.1, iron-contai 93.96
1xah_A 354 Sadhqs, 3-dehydroquinate synthase; shikimate pathw 93.73
1tq8_A163 Hypothetical protein RV1636; MTCY01B2.28, structur 93.63
3m9w_A 313 D-xylose-binding periplasmic protein; xylose bindi 93.5
3lft_A 295 Uncharacterized protein; ABC, ATPase, cassette, L- 93.37
1oj7_A 408 Hypothetical oxidoreductase YQHD; structural genom 93.28
3egc_A 291 Putative ribose operon repressor; structural genom 93.26
3s99_A 356 Basic membrane lipoprotein; ssgcid, structural gen 92.93
2gru_A 368 2-deoxy-scyllo-inosose synthase; aminoglycoside, 2 92.92
3kke_A 303 LACI family transcriptional regulator; structural 92.69
2dum_A170 Hypothetical protein PH0823; conserved hypothetica 92.65
3k4h_A 292 Putative transcriptional regulator; structural gen 92.39
2qh8_A 302 Uncharacterized protein; conserved domain protein, 92.37
3idf_A138 USP-like protein; universal, stress, PSI, MCSG, st 92.23
3h5o_A 339 Transcriptional regulator GNTR; transcription regu 92.08
3dlo_A155 Universal stress protein; unknown function, struct 92.05
3rf7_A 375 Iron-containing alcohol dehydrogenase; structural 92.02
3s3t_A146 Nucleotide-binding protein, universal stress PROT 91.86
2iks_A 293 DNA-binding transcriptional dual regulator; escher 91.8
2qv7_A 337 Diacylglycerol kinase DGKB; alpha-beta domain 1, b 91.78
3lkv_A 302 Uncharacterized conserved domain protein; ATPase b 91.76
3loq_A294 Universal stress protein; structural genomics, PSI 91.56
3l49_A 291 ABC sugar (ribose) transporter, periplasmic substr 91.54
2gm3_A175 Unknown protein; AT3G01520, putative ethylene-resp 91.52
3bbl_A 287 Regulatory protein of LACI family; protein structu 91.29
1ujn_A 348 Dehydroquinate synthase; riken structu genomics/pr 91.24
3hcw_A 295 Maltose operon transcriptional repressor; RNA-bind 91.17
3huu_A 305 Transcription regulator like protein; PSI-II, NYSG 91.04
2rgy_A 290 Transcriptional regulator, LACI family; 11011J, NY 91.0
1kq3_A 376 Glycerol dehydrogenase; structural genomics, joint 90.96
3k9c_A 289 Transcriptional regulator, LACI family protein; PS 90.93
3dbi_A 338 Sugar-binding transcriptional regulator, LACI FAM; 90.9
3o74_A 272 Fructose transport system repressor FRUR; dual tra 90.75
3gv0_A 288 Transcriptional regulator, LACI family; transcript 90.69
2h3h_A 313 Sugar ABC transporter, periplasmic sugar-binding p 90.53
3miz_A 301 Putative transcriptional regulator protein, LACI f 90.41
3msz_A89 Glutaredoxin 1; alpha-beta sandwich, center for st 90.37
3rot_A 297 ABC sugar transporter, periplasmic sugar binding; 90.06
3fg9_A156 Protein of universal stress protein USPA family; A 89.99
2qu7_A 288 Putative transcriptional regulator; structural gen 89.91
3qk7_A 294 Transcriptional regulators; structural genomics, N 89.71
3h8q_A114 Thioredoxin reductase 3; oxidoreductase, structura 89.66
1dbq_A 289 Purine repressor; transcription regulation, DNA-bi 89.5
1qpz_A 340 PURA, protein (purine nucleotide synthesis repress 89.44
3c3k_A 285 Alanine racemase; structural genomics, protein str 89.42
3brq_A 296 HTH-type transcriptional regulator ASCG; transcrip 89.4
3g1w_A 305 Sugar ABC transporter; sugar-binding protein, baci 89.26
3d8u_A 275 PURR transcriptional regulator; APC91343.1, vibrio 89.03
3ksm_A 276 ABC-type sugar transport system, periplasmic COMP; 89.01
3clh_A 343 3-dehydroquinate synthase; shikimate pathway, arom 88.84
2o20_A 332 Catabolite control protein A; CCPA, transcriptiona 88.55
3tb6_A 298 Arabinose metabolism transcriptional repressor; tr 88.33
3o1i_D 304 Periplasmic protein TORT; ligand free, two compone 88.16
3e3m_A 355 Transcriptional regulator, LACI family; structural 88.11
2z08_A137 Universal stress protein family; uncharacterized c 87.73
3bil_A 348 Probable LACI-family transcriptional regulator; st 87.62
1tjy_A 316 Sugar transport protein; protein-ligand complex, s 87.39
1aba_A87 Glutaredoxin; electron transport; HET: MES; 1.45A 87.15
3tnj_A150 Universal stress protein (USP); structural genomic 86.7
3clk_A 290 Transcription regulator; 11017J, PSI-II, NYSGXRC, 86.57
2fqx_A 318 Membrane lipoprotein TMPC; ABC transport system, l 86.48
2fn9_A 290 Ribose ABC transporter, periplasmic ribose-bindin; 86.13
3jvd_A 333 Transcriptional regulators; structural genomics, P 86.01
2fep_A 289 Catabolite control protein A; CCPA, transcriptiona 85.94
3jy6_A 276 Transcriptional regulator, LACI family; NYSGXRC, P 85.8
3s40_A 304 Diacylglycerol kinase; structural genomics, the ce 85.76
3hgm_A147 Universal stress protein TEAD; rossman fold, signa 85.55
2rjo_A 332 Twin-arginine translocation pathway signal protei; 85.36
3mt0_A 290 Uncharacterized protein PA1789; structural genomic 85.34
3ctp_A 330 Periplasmic binding protein/LACI transcriptional; 85.24
2dri_A 271 D-ribose-binding protein; sugar transport; HET: RI 85.18
3olq_A 319 Universal stress protein E; structural genomics, P 84.56
3gbv_A 304 Putative LACI-family transcriptional regulator; NY 84.53
3brs_A 289 Periplasmic binding protein/LACI transcriptional; 84.34
2fvy_A 309 D-galactose-binding periplasmic protein; periplasm 83.65
3kjx_A 344 Transcriptional regulator, LACI family; LACL famil 83.44
1q77_A138 Hypothetical protein AQ_178; structural genomics, 83.37
3hs3_A 277 Ribose operon repressor; PSI-II, NYSGXRC, periplas 83.16
1jx6_A 342 LUXP protein; protein-ligand complex, signaling pr 82.77
1gud_A 288 ALBP, D-allose-binding periplasmic protein; peripl 82.58
1jmv_A141 USPA, universal stress protein A; chaperone; 1.85A 81.65
2x7x_A 325 Sensor protein; transferase, sensor histidine kina 81.3
2vk2_A 306 YTFQ, ABC transporter periplasmic-binding protein 81.05
3ab8_A268 Putative uncharacterized protein TTHA0350; tandem- 81.04
2bon_A 332 Lipid kinase; DAG kinase, transferase; 1.90A {Esch 80.96
3fdx_A143 Putative filament protein / universal stress PROT; 80.89
8abp_A 306 L-arabinose-binding protein; binding proteins; HET 80.89
2l2q_A109 PTS system, cellobiose-specific IIB component (CE; 80.54
3l6u_A 293 ABC-type sugar transport system periplasmic compo; 80.2
>3ors_A N5-carboxyaminoimidazole ribonucleotide mutase; isomerase, isomerase,biosynthetic protein; 1.45A {Staphylococcus aureus subsp} Back     alignment and structure
Probab=100.00  E-value=2.5e-62  Score=377.44  Aligned_cols=138  Identities=33%  Similarity=0.583  Sum_probs=136.0

Q ss_pred             CCCcCCHHHHHHHHHHHHHhCCCeEEEEEccCCCchHHHHHHHHhhhcCCeEEEEecCcCCchhHHhhhccCCcEEEecC
Q 032570            1 MESDLDLPVMNDAARTLSDFGVPYEIKILPPHQNCKEALSYALSAKERGIKIIIVGDGVEAHLSGVAAANSQILVIRVPL   80 (138)
Q Consensus         1 mGS~SD~~~~~~~~~~L~~~gi~~~~~V~SaHR~p~~~~~~~~~~~~~~~~viIa~AG~~a~L~gvva~~t~~PVIgvP~   80 (138)
                      |||+||+++|+|+.++|++||++||++|+|+||+|+++.+|++++++++++|||++||+++|||||+|++|++||||||+
T Consensus        10 mgs~SD~~v~~~a~~~l~~~gi~~ev~V~SaHR~p~~~~~~~~~a~~~g~~ViIa~AG~aa~LpgvvA~~t~~PVIgVP~   89 (163)
T 3ors_A           10 MGSSSDWKIMQESCNMLDYFEIPYEKQVVSAHRTPKMMVQFASEARERGINIIIAGAGGAAHLPGMVASLTTLPVIGVPI   89 (163)
T ss_dssp             ESCGGGHHHHHHHHHHHHHTTCCEEEEECCTTTSHHHHHHHHHHTTTTTCCEEEEEEESSCCHHHHHHHHCSSCEEEEEE
T ss_pred             ECcHHHHHHHHHHHHHHHHcCCCEEEEEECCcCCHHHHHHHHHHHHhCCCcEEEEECCchhhhHHHHHhccCCCEEEeeC
Confidence            89999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCCchh-hhhhhcCCCCCeeeEEecC--CchhHHHHHHHHHccCCHHHHHHHHHHHhC
Q 032570           81 LSEDWSEDD-VINSIRMPSHVQVASVPRN--NAKNAALYAVKVLGIADEDLLERIRKYVEE  138 (138)
Q Consensus        81 ~~~~~~G~d-LlS~lqmP~GvpvatV~I~--~~~nAA~~AaqIl~~~~~~l~~kl~~~~~~  138 (138)
                      ++++|+|+| ||||+|||+|+||+||+||  |++|||++|+|||+++|++||+||++||++
T Consensus        90 ~~~~l~G~dsLlS~vqmp~GvPVatV~I~~a~~~nAa~lAa~Il~~~d~~l~~kl~~~r~~  150 (163)
T 3ors_A           90 ETKSLKGIDSLLSIVQMPGGIPVATTAIGAAGAKNAGILAARMLSIQNPSLVEKLNQYESS  150 (163)
T ss_dssp             CCTTTTTHHHHHHHHTCCTTSCCEECCSTHHHHHHHHHHHHHHHHTTCTHHHHHHHHHHHH
T ss_pred             CCCCCCCHHHHHHHhhCCCCCceEEEEcCCcccHHHHHHHHHHHhCCCHHHHHHHHHHHHH
Confidence            999999999 9999999999999999999  999999999999999999999999999973
>3trh_A Phosphoribosylaminoimidazole carboxylase carboxyltransferase subunit; purines, pyrimidines, nucleosides, nucleotides, lyase; 2.20A {Coxiella burnetii} Back     alignment and structure
>3lp6_A Phosphoribosylaminoimidazole carboxylase catalyti; alpha and beta protein, structural genomics, PSI-2, protein initiative; 1.70A {Mycobacterium tuberculosis} SCOP: c.23.8.0 Back     alignment and structure
>1xmp_A PURE, phosphoribosylaminoimidazole carboxylase; purine biosynthesis, spine, lyase; 1.80A {Bacillus anthracis} SCOP: c.23.8.1 Back     alignment and structure
>3kuu_A Phosphoribosylaminoimidazole carboxylase catalyti PURE; 3-layer (ABA) sandwich, rossmann fold, csgid, lyase, structu genomics; 1.41A {Yersinia pestis} SCOP: c.23.8.1 PDB: 1d7a_A* 1qcz_A 2ate_A* 2nsl_A* 2nsh_A* 2nsj_A* Back     alignment and structure
>3oow_A Phosphoribosylaminoimidazole carboxylase,catalyic; structural genomics, center for structural genomics of infec diseases, csgid; HET: MSE; 1.75A {Francisella tularensis subsp} SCOP: c.23.8.1 PDB: 3opq_A* Back     alignment and structure
>1o4v_A Phosphoribosylaminoimidazole mutase PURE; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; 1.77A {Thermotoga maritima} SCOP: c.23.8.1 Back     alignment and structure
>1u11_A PURE (N5-carboxyaminoimidazole ribonucleotide MUT; acidophIle, protein stability, lyase; HET: CIT; 1.55A {Acetobacter aceti} SCOP: c.23.8.1 PDB: 2fwj_A* 2fw1_A* 2fwb_A 2fwa_A 2fw9_A 2fw7_A 2fw6_A 2fwp_A* 2fwi_A* 2fw8_A Back     alignment and structure
>4b4k_A N5-carboxyaminoimidazole ribonucleotide mutase; isomerase; 2.50A {Bacillus anthracis} Back     alignment and structure
>3rg8_A Phosphoribosylaminoimidazole carboxylase, PURE PR; purine biosynthesis, lyase; 1.74A {Treponema denticola} SCOP: c.23.8.0 PDB: 3rgg_A* Back     alignment and structure
>4grd_A N5-CAIR mutase, phosphoribosylaminoimidazole carboxylase catalyti; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures; 1.85A {Burkholderia cenocepacia} Back     alignment and structure
>2ywx_A Phosphoribosylaminoimidazole carboxylase catalyti; rossmann fold, structural genomics, NPPSFA; 2.31A {Methanocaldococcus jannaschii} Back     alignment and structure
>2h31_A Multifunctional protein ADE2; alpha-beta-alpha, ligase, lyase; 2.80A {Homo sapiens} Back     alignment and structure
>2q5c_A NTRC family transcriptional regulator; structural genomics, protein structure initiative; HET: SO4 GOL; 1.49A {Clostridium acetobutylicum atcc 824} Back     alignment and structure
>2pju_A Propionate catabolism operon regulatory protein; structural genomics, PRPR, transcriptional regulation, PSI- 2, protein structure initiative; 2.10A {Escherichia coli} SCOP: c.92.3.1 Back     alignment and structure
>3uhj_A Probable glycerol dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.34A {Sinorhizobium meliloti} Back     alignment and structure
>1jq5_A Glycerol dehydrogenase; oxidoreductase, NAD, glycerol metabolism; HET: NAD; 1.70A {Geobacillus stearothermophilus} SCOP: e.22.1.2 PDB: 1jpu_A* 1jqa_A* Back     alignment and structure
>3ox4_A Alcohol dehydrogenase 2; iron, NAD, oxidoreductase; HET: NAD; 2.00A {Zymomonas mobilis} PDB: 3owo_A* Back     alignment and structure
>1o2d_A Alcohol dehydrogenase, iron-containing; TM0920, structural genomics, JCSG, PSI, protein structure initiative; HET: MSE NAP TRS; 1.30A {Thermotoga maritima} SCOP: e.22.1.2 PDB: 1vhd_A* Back     alignment and structure
>3ce9_A Glycerol dehydrogenase; NP_348253.1, 3-dehydroquinate syntha structural genomics, joint center for structural genomics; HET: MSE; 2.37A {Clostridium acetobutylicum atcc 824} Back     alignment and structure
>1rrm_A Lactaldehyde reductase; structural genomics, dehydrogenase, PSI, protein structure initiative; HET: APR; 1.60A {Escherichia coli} SCOP: e.22.1.2 PDB: 2bi4_A* 2bl4_A* Back     alignment and structure
>3hl0_A Maleylacetate reductase; structur genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; HET: MSE NAD EPE; 1.60A {Agrobacterium tumefaciens str} Back     alignment and structure
>1sg6_A Pentafunctional AROM polypeptide; shikimate pathway, aromatic amino acid biosynthesis, DHQS, O form J, domain movement, cyclase, lyase; HET: NAD; 1.70A {Emericella nidulans} SCOP: e.22.1.1 PDB: 1nr5_A* 1nrx_A* 1nua_A 1nva_A* 1nvb_A* 1nvd_A* 1nve_A* 1nvf_A* 1dqs_A* Back     alignment and structure
>3bfj_A 1,3-propanediol oxidoreductase; opportunistic pathogens, decamer, structural genomics,struct proteomics in europe, spine; 2.70A {Klebsiella pneumoniae} Back     alignment and structure
>1ta9_A Glycerol dehydrogenase; oxidoredu; 1.90A {Schizosaccharomyces pombe} Back     alignment and structure
>1vlj_A NADH-dependent butanol dehydrogenase; TM0820, structural G JCSG, protein structure initiative, PSI, joint center for S genomics; HET: NAP; 1.78A {Thermotoga maritima} SCOP: e.22.1.2 Back     alignment and structure
>3jzd_A Iron-containing alcohol dehydrogenase; YP_298327.1, putative alcohol dehedrogenase, structural GENO joint center for structural genomics; HET: MSE NAD PG4 P6G PGE; 2.10A {Ralstonia eutropha} Back     alignment and structure
>3okf_A 3-dehydroquinate synthase; structural genomics, center for structural genomics of infec diseases, csgid, NAD, lyase; HET: NAD; 2.50A {Vibrio cholerae o1 biovar eltor} Back     alignment and structure
>1mjh_A Protein (ATP-binding domain of protein MJ0577); hypothetical protein, structural genomics, functional assignment; HET: ATP; 1.70A {Methanocaldococcus jannaschii} SCOP: c.26.2.4 Back     alignment and structure
>3qbe_A 3-dehydroquinate synthase; shikimate pathway, mycobacte tuberculosis, nicotinamide adenine dinucleotide (NAD)-depen enzyme; 2.07A {Mycobacterium tuberculosis} PDB: 3qbd_A Back     alignment and structure
>3iv7_A Alcohol dehydrogenase IV; NP_602249.1, iron-containing alcohol dehydrogenase, structur genomics, joint center for structural genomics; HET: MSE; 2.07A {Corynebacterium glutamicum} Back     alignment and structure
>1xah_A Sadhqs, 3-dehydroquinate synthase; shikimate pathway, aromatic amino acid biosynthesis, open form, form B, domain movement, cyclase; HET: NAD; 2.20A {Staphylococcus aureus} PDB: 1xag_A* 1xai_A* 1xaj_A* 1xal_A* Back     alignment and structure
>1tq8_A Hypothetical protein RV1636; MTCY01B2.28, structural target, NYSGXRC, PSI, protein structure initiative; 2.40A {Mycobacterium tuberculosis} SCOP: c.26.2.4 Back     alignment and structure
>3m9w_A D-xylose-binding periplasmic protein; xylose binding protein, conformational changes, SUGA protein; 2.15A {Escherichia coli} PDB: 3m9x_A* 3ma0_A* Back     alignment and structure
>3lft_A Uncharacterized protein; ABC, ATPase, cassette, L-Trp, PSI, MCSG, structural genomics center for structural genomics; HET: MSE TRP; 1.35A {Streptococcus pneumoniae} Back     alignment and structure
>1oj7_A Hypothetical oxidoreductase YQHD; structural genomics; HET: NZQ; 2.0A {Escherichia coli} SCOP: e.22.1.2 Back     alignment and structure
>3egc_A Putative ribose operon repressor; structural genomics, unknown function, DNA-binding, transcri transcription regulation, PSI-2; 2.35A {Burkholderia thailandensis} Back     alignment and structure
>3s99_A Basic membrane lipoprotein; ssgcid, structural genomics, SEA structural genomics center for infectious disease, adenine; HET: ADE; 2.05A {Brucella melitensis biovar abortus} Back     alignment and structure
>2gru_A 2-deoxy-scyllo-inosose synthase; aminoglycoside, 2-deoxystreptamine, dehydroquinate synthase, lyase; HET: NAD EXO CAK; 2.15A {Bacillus circulans} PDB: 2d2x_A* Back     alignment and structure
>3kke_A LACI family transcriptional regulator; structural genomics, DNA-binding, transcription regulation, PSI-2; 2.20A {Mycobacterium smegmatis str} Back     alignment and structure
>2dum_A Hypothetical protein PH0823; conserved hypothetical protein, putative universal protein A structural genomics, NPPSFA; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>3k4h_A Putative transcriptional regulator; structural genomics, protein structure INI NEW YORK structural genomix research consortium; HET: MAL; 2.80A {Bacillus cytotoxicus nvh 391-98} Back     alignment and structure
>3idf_A USP-like protein; universal, stress, PSI, MCSG, structural genomics, midwest center for structural genomics structure initiative; 2.00A {Wolinella succinogenes} Back     alignment and structure
>3h5o_A Transcriptional regulator GNTR; transcription regulator, GNTR,chromobacterium violaceum, PSI, SGX, DNA-binding; 2.30A {Chromobacterium violaceum} Back     alignment and structure
>3dlo_A Universal stress protein; unknown function, structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics; HET: MSE; 1.97A {Archaeoglobus fulgidus} PDB: 3qtb_A* Back     alignment and structure
>3rf7_A Iron-containing alcohol dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: NAD EPE; 2.12A {Shewanella denitrificans} Back     alignment and structure
>3s3t_A Nucleotide-binding protein, universal stress PROT family; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: ATP; 1.90A {Lactobacillus plantarum} SCOP: c.26.2.0 Back     alignment and structure
>2iks_A DNA-binding transcriptional dual regulator; escherichia coli structural genomics, PSI-2, protein structure initiative; 1.85A {Escherichia coli} Back     alignment and structure
>2qv7_A Diacylglycerol kinase DGKB; alpha-beta domain 1, beta sandwich domain 2, protein-ADP COM transferase; HET: ADP; 2.30A {Staphylococcus aureus} SCOP: e.52.1.2 PDB: 2qvl_A Back     alignment and structure
>3lkv_A Uncharacterized conserved domain protein; ATPase binding cassette, PSI, MCSG, structural genomics, Pro structure initiative; HET: PHE; 2.20A {Vibrio cholerae} Back     alignment and structure
>3loq_A Universal stress protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: AMP; 2.32A {Archaeoglobus fulgidus} Back     alignment and structure
>3l49_A ABC sugar (ribose) transporter, periplasmic substrate-binding subunit; sugar binding/transporter, structural genomics, PSI; HET: UNL; 2.30A {Rhodobacter sphaeroides} Back     alignment and structure
>2gm3_A Unknown protein; AT3G01520, putative ethylene-responsive protein, USP domain, nucleotide binding domain, AMP; HET: MSE AMP; 2.46A {Arabidopsis thaliana} SCOP: c.26.2.4 Back     alignment and structure
>3bbl_A Regulatory protein of LACI family; protein structure initiative II, PSI-II, NYSGXRC, transcript regulator, periplasmic binding protein; 2.35A {Chloroflexus aggregans} Back     alignment and structure
>1ujn_A Dehydroquinate synthase; riken structu genomics/proteomics initiative, RSGI, structural genomics,; 1.80A {Thermus thermophilus} SCOP: e.22.1.1 Back     alignment and structure
>3hcw_A Maltose operon transcriptional repressor; RNA-binding, PSI-2, NYSGXRC, STRU genomics, protein structure initiative; 2.20A {Staphylococcus aureus subsp} Back     alignment and structure
>3huu_A Transcription regulator like protein; PSI-II, NYSGXRC, LAC I, STR genomics, protein structure initiative; 1.95A {Staphylococcus haemolyticus} Back     alignment and structure
>2rgy_A Transcriptional regulator, LACI family; 11011J, NYSGXRC, transctiptional regulator, SUG binding protein, structural genomics, PSI-2; 2.05A {Burkholderia phymatum} Back     alignment and structure
>1kq3_A Glycerol dehydrogenase; structural genomics, joint center FO structural genomics, JCSG, protein structure initiative, PS oxidoreductase; 1.50A {Thermotoga maritima} SCOP: e.22.1.2 Back     alignment and structure
>3k9c_A Transcriptional regulator, LACI family protein; PSI-II, 11026W, structural genomics, PR structure initiative; 2.14A {Rhodococcus jostii} Back     alignment and structure
>3dbi_A Sugar-binding transcriptional regulator, LACI FAM; structural genomics, sugar-binding transcriptional regulator structure initiative, PSI-2; HET: MSE; 2.45A {Escherichia coli K12} Back     alignment and structure
>3o74_A Fructose transport system repressor FRUR; dual transcriptional regulator, DNA, transcription; 2.00A {Pseudomonas putida} PDB: 3o75_A* Back     alignment and structure
>3gv0_A Transcriptional regulator, LACI family; transcription regulator, PSI-II, structural genomics structure initiative; 2.35A {Agrobacterium tumefaciens str} Back     alignment and structure
>2h3h_A Sugar ABC transporter, periplasmic sugar-binding protein; glucose binding protein, periplasmic binding protein, GBP; HET: BGC; 1.70A {Thermotoga maritima} PDB: 2qvc_A* 3c6q_B* Back     alignment and structure
>3miz_A Putative transcriptional regulator protein, LACI family; LACL family, protein structure initiative II (PSI II), NYSGXRC, structural genomics; 1.91A {Rhizobium etli} Back     alignment and structure
>3msz_A Glutaredoxin 1; alpha-beta sandwich, center for structural genomics of infec diseases, csgid, oxidoreductase; HET: GSH; 2.05A {Francisella tularensis subsp} PDB: 3lgc_A* Back     alignment and structure
>3rot_A ABC sugar transporter, periplasmic sugar binding; nysgrc, PSI-biology, structural genomics; 1.91A {Legionella pneumophila subsp} Back     alignment and structure
>3fg9_A Protein of universal stress protein USPA family; APC60691, nucleotide- binding, lactobacillus plantarum WCFS1, structural genomics PSI-2; 1.47A {Lactobacillus plantarum} Back     alignment and structure
>2qu7_A Putative transcriptional regulator; structural genomics, PSI-2, protein structure initiative; 2.30A {Staphylococcus saprophyticus subsp} Back     alignment and structure
>3qk7_A Transcriptional regulators; structural genomics, NEW YORK structural genomix research CO NYSGXRC, PSI-2, protein structur initiative; 2.70A {Yersinia pestis} Back     alignment and structure
>3h8q_A Thioredoxin reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC, developmental protein, differentiation; 2.21A {Homo sapiens} SCOP: c.47.1.0 Back     alignment and structure
>1dbq_A Purine repressor; transcription regulation, DNA-binding regulatory protein; 2.20A {Escherichia coli} SCOP: c.93.1.1 PDB: 1jhz_A Back     alignment and structure
>1qpz_A PURA, protein (purine nucleotide synthesis repressor); transcription regulation, DNA-binding, purine biosynthesis; HET: DNA HPA; 2.50A {Escherichia coli} SCOP: a.35.1.5 c.93.1.1 PDB: 1bdi_A* 1qp0_A* 1qp4_A* 1pnr_A* 1wet_A* 1zay_A* 1vpw_A* 2pue_A* 2puf_A* 2pug_A* 1bdh_A* 1qp7_A* 1qqa_A* 1qqb_A* 2puc_A* 2pua_A* 2pub_A* 2pud_A* 1jfs_A* 1jh9_A* ... Back     alignment and structure
>3c3k_A Alanine racemase; structural genomics, protein structure initiative, NEW YORK research center for structural genomics, nysgxrc; 1.99A {Actinobacillus succinogenes} Back     alignment and structure
>3brq_A HTH-type transcriptional regulator ASCG; transcriptional repressor structure escherichia coli, struct genomics, PSI-2; HET: FRU; 2.00A {Escherichia coli} Back     alignment and structure
>3g1w_A Sugar ABC transporter; sugar-binding protein, bacillus halod target 11229F, transport protein, structural genomics; 2.02A {Bacillus halodurans c-125} Back     alignment and structure
>3d8u_A PURR transcriptional regulator; APC91343.1, vibrio parahaem RIMD 2210633, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.88A {Vibrio parahaemolyticus} Back     alignment and structure
>3ksm_A ABC-type sugar transport system, periplasmic COMP; periplasmic component, PSI- 11023L, structural genomics, protein structure initiative; HET: BDR; 1.90A {Hahella chejuensis} Back     alignment and structure
>3clh_A 3-dehydroquinate synthase; shikimate pathway, aromatic amino acid biosynthesis, DHQS, amino-acid biosynthesis, cytoplasm, lyase, NAD; HET: NAD; 2.40A {Helicobacter pylori} Back     alignment and structure
>2o20_A Catabolite control protein A; CCPA, transcriptional regulator, helix-turn-helix, transcrip; 1.90A {Lactococcus lactis} Back     alignment and structure
>3tb6_A Arabinose metabolism transcriptional repressor; transcription regulation, arabinose binding, DNA binding Pro; HET: ARB; 2.21A {Bacillus subtilis} Back     alignment and structure
>3o1i_D Periplasmic protein TORT; ligand free, two component sensor, periplasmic binding prote signaling protein; HET: PE4; 2.80A {Vibrio parahaemolyticus} PDB: 3o1h_B* 3o1j_C Back     alignment and structure
>3e3m_A Transcriptional regulator, LACI family; structural genomics, DNA-binding, plasmid, transcription regulation, PSI-2; 1.60A {Silicibacter pomeroyi} Back     alignment and structure
>2z08_A Universal stress protein family; uncharacterized conserved protein, structural genomics, unknown function, NPPSFA; HET: ATP; 1.55A {Thermus thermophilus} SCOP: c.26.2.4 PDB: 1wjg_A* 2z09_A* 2z3v_A Back     alignment and structure
>3bil_A Probable LACI-family transcriptional regulator; structural genomics, unknown function, PSI-2, protein structure initiative; 2.50A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1tjy_A Sugar transport protein; protein-ligand complex, signaling protein; HET: PAV; 1.30A {Salmonella typhimurium} SCOP: c.93.1.1 PDB: 1tm2_A 3t95_A* 3ejw_A* Back     alignment and structure
>1aba_A Glutaredoxin; electron transport; HET: MES; 1.45A {Enterobacteria phage T4} SCOP: c.47.1.1 PDB: 1aaz_A 1de1_A 1de2_A Back     alignment and structure
>3tnj_A Universal stress protein (USP); structural genomics, PSI-biology, midwest center for structu genomics, MCSG, chaperone; HET: AMP; 2.00A {Nitrosomonas europaea} PDB: 2pfs_A* Back     alignment and structure
>3clk_A Transcription regulator; 11017J, PSI-II, NYSGXRC, dimer, structural genomics, protein structure initiative; 2.08A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>2fqx_A Membrane lipoprotein TMPC; ABC transport system, ligand-binding protein, guanosine, TP0319, transport protein; HET: GMP; 1.70A {Treponema pallidum} PDB: 2fqw_A* 2fqy_A* Back     alignment and structure
>2fn9_A Ribose ABC transporter, periplasmic ribose-bindin; RBP, ribose binding protein, periplasmic binding protein, thermophilic proteins; 1.40A {Thermotoga maritima} PDB: 2fn8_A* Back     alignment and structure
>3jvd_A Transcriptional regulators; structural genomics, PSI-2, sugar binding protein, transcrip regulation, protein structure initiative; 2.30A {Corynebacterium glutamicum} Back     alignment and structure
>2fep_A Catabolite control protein A; CCPA, transcriptional regulator; HET: SEP; 2.45A {Bacillus subtilis} PDB: 2nzu_G* 1sxh_A 1sxi_A 1sxg_A* 2nzv_G* 2oen_G* Back     alignment and structure
>3jy6_A Transcriptional regulator, LACI family; NYSGXRC, PSI-II, protein S initiative, structural genomics; 1.97A {Lactobacillus brevis} Back     alignment and structure
>3s40_A Diacylglycerol kinase; structural genomics, the center for structural genomics of infectious diseases, csgid, transfer; 2.10A {Bacillus anthracis} PDB: 3t5p_A Back     alignment and structure
>3hgm_A Universal stress protein TEAD; rossman fold, signaling protein; HET: ATP; 1.90A {Halomonas elongata} SCOP: c.26.2.0 Back     alignment and structure
>2rjo_A Twin-arginine translocation pathway signal protei; PSI-2, NYSGXRC, twin arginine translocation pathway signal P structural genomics; HET: GAL; 2.05A {Burkholderia phytofirmans} Back     alignment and structure
>3mt0_A Uncharacterized protein PA1789; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 1.58A {Pseudomonas aeruginosa} Back     alignment and structure
>3ctp_A Periplasmic binding protein/LACI transcriptional; structural genomics, protein structure initiative; HET: XLF; 1.41A {Alkaliphilus metalliredigens} Back     alignment and structure
>2dri_A D-ribose-binding protein; sugar transport; HET: RIP; 1.60A {Escherichia coli} SCOP: c.93.1.1 PDB: 1urp_A* 1ba2_A 1dbp_A* 1drj_A* 1drk_A* 2gx6_A* Back     alignment and structure
>3olq_A Universal stress protein E; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: UNL; 1.82A {Proteus mirabilis} Back     alignment and structure
>3gbv_A Putative LACI-family transcriptional regulator; NYSGXRC, PSI-II, 11231J, structur genomics, protein structure initiative; 2.20A {Bacteroides fragilis} Back     alignment and structure
>3brs_A Periplasmic binding protein/LACI transcriptional; structural genomics, protein structure initiative; 2.00A {Clostridium phytofermentans} Back     alignment and structure
>2fvy_A D-galactose-binding periplasmic protein; periplasmic binding protien, hinge, chemotaxis, transport,; HET: BGC; 0.92A {Escherichia coli} SCOP: c.93.1.1 PDB: 1glg_A* 2fw0_A* 2gbp_A* 2qw1_A* 2hph_A* 2ipn_A* 2ipm_A* 2ipl_A* 1gca_A* 1gcg_A 3ga5_A* 3gbp_A* Back     alignment and structure
>3kjx_A Transcriptional regulator, LACI family; LACL family, protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.33A {Silicibacter pomeroyi} Back     alignment and structure
>1q77_A Hypothetical protein AQ_178; structural genomics, universal stress protein, PSI, protein structure initiative; 2.70A {Aquifex aeolicus} SCOP: c.26.2.4 Back     alignment and structure
>3hs3_A Ribose operon repressor; PSI-II, NYSGXRC, periplasmic binding protein, structural genomics, protein structure initiative; 1.60A {Lactobacillus acidophilus} Back     alignment and structure
>1jx6_A LUXP protein; protein-ligand complex, signaling protein; HET: AI2; 1.50A {Vibrio harveyi} SCOP: c.93.1.1 PDB: 1zhh_A* 2hj9_A* Back     alignment and structure
>1gud_A ALBP, D-allose-binding periplasmic protein; periplasmic binding protein, X-RAY crystallography, hinge bending, conformational change; 1.7A {Escherichia coli} SCOP: c.93.1.1 PDB: 1gub_A 1rpj_A* Back     alignment and structure
>1jmv_A USPA, universal stress protein A; chaperone; 1.85A {Haemophilus influenzae} SCOP: c.26.2.4 Back     alignment and structure
>2x7x_A Sensor protein; transferase, sensor histidine kinase; HET: FRU; 2.64A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2vk2_A YTFQ, ABC transporter periplasmic-binding protein YTFQ; transport protein, galactofuranose; HET: GZL; 1.20A {Escherichia coli} Back     alignment and structure
>3ab8_A Putative uncharacterized protein TTHA0350; tandem-type universal stress protein, unknown function; HET: ATP; 1.70A {Thermus thermophilus} PDB: 3ab7_A* Back     alignment and structure
>2bon_A Lipid kinase; DAG kinase, transferase; 1.90A {Escherichia coli} SCOP: e.52.1.2 PDB: 2jgr_A 2p1r_A Back     alignment and structure
>3fdx_A Putative filament protein / universal stress PROT; structural genomics, APC60640.1, universal protein F, PSI-2; HET: MSE ATP; 1.58A {Klebsiella pneumoniae subsp} PDB: 3fh0_A* Back     alignment and structure
>8abp_A L-arabinose-binding protein; binding proteins; HET: GLA GAL; 1.49A {Escherichia coli} SCOP: c.93.1.1 PDB: 7abp_A* 6abp_A* 1abe_A* 1abf_A* 5abp_A* 1bap_A* 1apb_A* 9abp_A* 2wrz_A Back     alignment and structure
>2l2q_A PTS system, cellobiose-specific IIB component (CE; cellobiose-specific phosphotransferase IIB component, struct genomics; NMR {Borrelia burgdorferi} Back     alignment and structure
>3l6u_A ABC-type sugar transport system periplasmic compo; structural genomics, nysgrc, target 11006S, PSI-2, protein S initiative; 1.90A {Exiguobacterium sibiricum} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 138
d1qcza_163 c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoi 1e-30
d1o4va_169 c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoi 7e-30
d1xmpa_155 c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoi 2e-27
d1u11a_159 c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoi 6e-26
>d1qcza_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Escherichia coli [TaxId: 562]} Length = 163 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Flavodoxin-like
superfamily: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE)
family: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE)
domain: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE)
species: Escherichia coli [TaxId: 562]

 Score =  106 bits (265), Expect = 1e-30
 Identities = 43/141 (30%), Positives = 71/141 (50%), Gaps = 3/141 (2%)

Query: 1   MESDLDLPVMNDAARTLSDFGVPYEIKILPPHQNCKEALSYALSAKERGIKIIIVGDGVE 60
           M S  D   M  AA       VP+ ++++  H+   +  S+A SA+E G ++II G G  
Sbjct: 8   MGSKSDWATMQFAAEIFEILNVPHHVEVVSAHRTPDKLFSFAESAEENGYQVIIAGAGGA 67

Query: 61  AHLSGVAAANSQILVIRVPLLSEDWSEDD---VINSIRMPSHVQVASVPRNNAKNAALYA 117
           AHL G+ AA + + V+ VP+ S   S  D    I  +     V   ++ +  A NAAL A
Sbjct: 68  AHLPGMIAAKTLVPVLGVPVQSAALSGVDSLYSIVQMPRGIPVGTLAIGKAGAANAALLA 127

Query: 118 VKVLGIADEDLLERIRKYVEE 138
            ++L   D++L +R+  + + 
Sbjct: 128 AQILATHDKELHQRLNDWRKA 148
>d1o4va_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Thermotoga maritima [TaxId: 2336]} Length = 169 Back     information, alignment and structure
>d1xmpa_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Bacillus anthracis [TaxId: 1392]} Length = 155 Back     information, alignment and structure
>d1u11a_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Acetobacter aceti [TaxId: 435]} Length = 159 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query138
d1xmpa_155 N5-CAIR mutase (phosphoribosylaminoimidazole carbo 100.0
d1o4va_169 N5-CAIR mutase (phosphoribosylaminoimidazole carbo 100.0
d1qcza_163 N5-CAIR mutase (phosphoribosylaminoimidazole carbo 100.0
d1u11a_159 N5-CAIR mutase (phosphoribosylaminoimidazole carbo 100.0
d1jq5a_ 366 Glycerol dehydrogenase {Bacillus stearothermophilu 96.79
d2pjua1186 Propionate catabolism operon regulatory protein Pr 96.13
d1o2da_ 359 Alcohol dehydrogenase TM0920 {Thermotoga maritima 96.03
d2bona1 295 Lipid kinase YegS {Escherichia coli [TaxId: 562]} 95.37
d1vlja_ 398 NADH-dependent butanol dehydrogenase A (TM0820) {T 95.04
d1rrma_ 385 Lactaldehyde reductase FucO {Escherichia coli [Tax 94.72
d2dria_ 271 D-ribose-binding protein {Escherichia coli, strain 93.96
d1mjha_160 "Hypothetical" protein MJ0577 {Archaeon Methanococ 92.72
d1kq3a_ 364 Glycerol dehydrogenase {Thermotoga maritima [TaxId 90.97
d1ujna_ 347 Dehydroquinate synthase, DHQS {Thermus thermophilu 90.61
d2gm3a1171 Putative ethylene-responsive protein AT3g01520/F4P 90.48
d1utaa_77 Cell division protein FtsN {Escherichia coli [TaxI 90.1
d1fova_82 Glutaredoxin (Grx, thioltransferase) {Escherichia 90.09
d1tjya_ 316 AI-2 receptor LsrB {Salmonella typhi [TaxId: 90370 89.35
d1tq8a_147 Hypothetical protein Rv1636 {Mycobacterium tubercu 87.86
d2qv7a1 312 Diacylglycerol kinase DgkB {Staphylococcus aureus 87.47
d1oj7a_ 390 Hypothetical oxidoreductase yqhD {Escherichia coli 85.66
d1guda_ 288 D-allose-binding protein {Escherichia coli [TaxId: 85.46
d1dbqa_ 282 Purine repressor (PurR), C-terminal domain {Escher 85.33
d8abpa_ 305 L-arabinose-binding protein {Escherichia coli [Tax 82.98
d1sg6a_ 389 Dehydroquinate synthase, DHQS {Aspergillus nidulan 82.7
d2nzug1 275 Glucose-resistance amylase regulator CcpA, C-termi 82.24
d1g94a2 354 Bacterial alpha-amylase {Pseudoalteromonas halopla 82.02
d1g7oa275 Glutaredoxin 2 {Escherichia coli [TaxId: 562]} 81.41
d1h75a_76 Glutaredoxin-like NRDH-redoxin {Escherichia coli [ 80.51
d1q77a_138 Hypothetical protein Aq_178 {Aquifex aeolicus [Tax 80.36
d1k0da292 Yeast prion protein ure2p, nitrogen regulation fra 80.29
d1byka_ 255 Trehalose repressor, C-terminal domain {Escherichi 80.16
d1r7ha_74 Glutaredoxin-like NRDH-redoxin {Corynebacterium am 80.02
>d1xmpa_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Bacillus anthracis [TaxId: 1392]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Flavodoxin-like
superfamily: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE)
family: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE)
domain: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE)
species: Bacillus anthracis [TaxId: 1392]

Probab=100.00  E-value=2.7e-59  Score=356.47  Aligned_cols=138  Identities=35%  Similarity=0.554  Sum_probs=135.6

Q ss_pred             CCCcCCHHHHHHHHHHHHHhCCCeEEEEEccCCCchHHHHHHHHhhhcCCeEEEEecCcCCchhHHhhhccCCcEEEecC
Q 032570            1 MESDLDLPVMNDAARTLSDFGVPYEIKILPPHQNCKEALSYALSAKERGIKIIIVGDGVEAHLSGVAAANSQILVIRVPL   80 (138)
Q Consensus         1 mGS~SD~~~~~~~~~~L~~~gi~~~~~V~SaHR~p~~~~~~~~~~~~~~~~viIa~AG~~a~L~gvva~~t~~PVIgvP~   80 (138)
                      |||+||+++++|+.++|++|||+||++|+|+||+|+++.+|++++++++++|||++|||++|||||+|++|++||||||+
T Consensus         8 mGS~SD~~~~~~a~~~L~~~gi~~~~~v~SAHrtp~rl~~~~~~~~~~~~~viIa~AG~aa~Lpgvva~~t~~PVIgVP~   87 (155)
T d1xmpa_           8 MGSTSDWETMKYACDILDELNIPYEKKVVSAHRTPDYMFEYAETARERGLKVIIAGAGGAAHLPGMVAAKTNLPVIGVPV   87 (155)
T ss_dssp             ESSGGGHHHHHHHHHHHHHTTCCEEEEECCTTTSHHHHHHHHHHTTTTTCCEEEEEEESSCCHHHHHHTTCCSCEEEEEE
T ss_pred             ECcHhhHHHHHHHHHHHHHcCCcEEEEEechhcChHHHHHHHHHHHhhcceEEEeecccCCCchhHHHHhccceEEEEEe
Confidence            89999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCCchh-hhhhhcCCCCCeeeEEecC--CchhHHHHHHHHHccCCHHHHHHHHHHHhC
Q 032570           81 LSEDWSEDD-VINSIRMPSHVQVASVPRN--NAKNAALYAVKVLGIADEDLLERIRKYVEE  138 (138)
Q Consensus        81 ~~~~~~G~d-LlS~lqmP~GvpvatV~I~--~~~nAA~~AaqIl~~~~~~l~~kl~~~~~~  138 (138)
                      ++++++|+| |||++|||+|+||+||.||  |++|||++|+|||+++|+++++||++||++
T Consensus        88 ~~~~~~G~d~llS~vqMP~Gipv~tv~v~~~~~~nAa~~A~~Il~~~d~~l~~~l~~~r~~  148 (155)
T d1xmpa_          88 QSKALNGLDSLLSIVQMPGGVPVATVAIGKAGSTNAGLLAAQILGSFHDDIHDALELRREA  148 (155)
T ss_dssp             CCTTTTTHHHHHHHHCCCTTCCCEECCSSHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHH
T ss_pred             ecccCcCcccHHHHHhCccCCCceEEEecCcchHHHHHHHHHHHccCCHHHHHHHHHHHHH
Confidence            999999999 9999999999999999999  889999999999999999999999999974
>d1o4va_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qcza_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u11a_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Acetobacter aceti [TaxId: 435]} Back     information, alignment and structure
>d1jq5a_ e.22.1.2 (A:) Glycerol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2pjua1 c.92.3.1 (A:11-196) Propionate catabolism operon regulatory protein PrpR {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o2da_ e.22.1.2 (A:) Alcohol dehydrogenase TM0920 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2bona1 e.52.1.2 (A:5-299) Lipid kinase YegS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vlja_ e.22.1.2 (A:) NADH-dependent butanol dehydrogenase A (TM0820) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1rrma_ e.22.1.2 (A:) Lactaldehyde reductase FucO {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2dria_ c.93.1.1 (A:) D-ribose-binding protein {Escherichia coli, strain k-12 [TaxId: 562]} Back     information, alignment and structure
>d1mjha_ c.26.2.4 (A:) "Hypothetical" protein MJ0577 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1kq3a_ e.22.1.2 (A:) Glycerol dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ujna_ e.22.1.1 (A:) Dehydroquinate synthase, DHQS {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2gm3a1 c.26.2.4 (A:5-175) Putative ethylene-responsive protein AT3g01520/F4P13_7 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1utaa_ d.58.52.1 (A:) Cell division protein FtsN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fova_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli, Grx3 [TaxId: 562]} Back     information, alignment and structure
>d1tjya_ c.93.1.1 (A:) AI-2 receptor LsrB {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d1tq8a_ c.26.2.4 (A:) Hypothetical protein Rv1636 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2qv7a1 e.52.1.2 (A:1-312) Diacylglycerol kinase DgkB {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1oj7a_ e.22.1.2 (A:) Hypothetical oxidoreductase yqhD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1guda_ c.93.1.1 (A:) D-allose-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dbqa_ c.93.1.1 (A:) Purine repressor (PurR), C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d8abpa_ c.93.1.1 (A:) L-arabinose-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sg6a_ e.22.1.1 (A:) Dehydroquinate synthase, DHQS {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d2nzug1 c.93.1.1 (G:58-332) Glucose-resistance amylase regulator CcpA, C-terminal domain {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1g94a2 c.1.8.1 (A:1-354) Bacterial alpha-amylase {Pseudoalteromonas haloplanktis (Alteromonas haloplanktis) [TaxId: 228]} Back     information, alignment and structure
>d1g7oa2 c.47.1.5 (A:1-75) Glutaredoxin 2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h75a_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q77a_ c.26.2.4 (A:) Hypothetical protein Aq_178 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1k0da2 c.47.1.5 (A:109-200) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1byka_ c.93.1.1 (A:) Trehalose repressor, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r7ha_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Corynebacterium ammoniagenes [TaxId: 1697]} Back     information, alignment and structure