Citrus Sinensis ID: 032592

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------
MILRVVGLFILACISSPCRSLSNGSVEKEKTLAMIKPDGLSGNYTDEIKKVILESGFSILRERVVRLDEDGAKTFYAEHSSRSFFSSLIKYMTSGPVLAMVLEKENAITDWRALIGPTDAKKAKISHPHRLYVLPFG
cHHHHHHHHHHHcccccccccccccccccEEEEEEcccccccccHHHHHHHHHHccccEEHHHcccccHHHHHHHHHHHcccccHHHHHHHHHcccEEEEEEccccHHHHHHHHccccccccccccccccccccccc
ccEHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEcHHHHHHccHHHHHHHHHHHccEEEEEEEEcccHHHHHHHcHHHcccccHHHHHHHcccccEEEEEEEcccHHHHHHHHHccccHHHcccccEcccEEEEEc
MILRVVGLFILACisspcrslsngsvekektlamikpdglsgnytDEIKKVILESGFSILRERVVRLDEDgaktfyaehssRSFFSSLIKYMTSGPVLAMVLEKENAITDWraligptdakkakishphrlyvlpfg
MILRVVGLFILacisspcrslsngsvekektlamikpdglsgnyTDEIKKVILESGFSILRERVVRLDEDGAKtfyaehssrsfFSSLIKYMTSGPVLAMVLEKENAITDWRALIgptdakkakishphrlyvlpfg
MILRVVGLFILACISSPCRSLSNGSVEKEKTLAMIKPDGLSGNYTDEIKKVILESGFSILRERVVRLDEDGAKTFYAEHSSRSFFSSLIKYMTSGPVLAMVLEKENAITDWRALIGPTDAKKAKISHPHRLYVLPFG
*ILRVVGLFILACISSPCRSL**********LAMIKPDGLSGNYTDEIKKVILESGFSILRERVVRLDEDGAKTFYAEHSSRSFFSSLIKYMTSGPVLAMVLEKENAITDWRALIGPTDAKKAKISHPHRLYVL***
*ILRVVGLFILACI****************TLAMIKPDGLSGNYTDEIKKVILESGFSILRERVVRLDEDGAKTFYAEHSSRSFFSSLIKYMTSGPVLAMVLEKENAITDWRALIGPTDAKKAKISHPHRLYVLPFG
MILRVVGLFILACISSPCRSLSNGSVEKEKTLAMIKPDGLSGNYTDEIKKVILESGFSILRERVVRLDEDGAKTFYAEHSSRSFFSSLIKYMTSGPVLAMVLEKENAITDWRALIGPTDAKKAKISHPHRLYVLPFG
MILRVVGLFILACISSPCRSLSNGSVEKEKTLAMIKPDGLSGNYTDEIKKVILESGFSILRERVVRLDEDGAKTFYAEHSSRSFFSSLIKYMTSGPVLAMVLEKENAITDWRALIGPTDAKKAKISHPHRLYVLPFG
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MILRVVGLFILACISSPCRSLSNGSVEKEKTLAMIKPDGLSGNYTDEIKKVILESGFSILRERVVRLDEDGAKTFYAEHSSRSFFSSLIKYMTSGPVLAMVLEKENAITDWRALIGPTDAKKAKISHPHRLYVLPFG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query137 2.2.26 [Sep-21-2011]
A6VMK7141 Nucleoside diphosphate ki yes no 0.693 0.673 0.463 2e-20
Q65UT5141 Nucleoside diphosphate ki yes no 0.700 0.680 0.468 4e-20
Q89MS3140 Nucleoside diphosphate ki yes no 0.795 0.778 0.403 5e-20
C6E0H6137 Nucleoside diphosphate ki yes no 0.700 0.700 0.468 7e-20
B6JGK9140 Nucleoside diphosphate ki yes no 0.795 0.778 0.385 1e-19
B0USF1141 Nucleoside diphosphate ki yes no 0.700 0.680 0.416 1e-19
B5E9D0137 Nucleoside diphosphate ki yes no 0.700 0.700 0.458 2e-19
Q0I2G6141 Nucleoside diphosphate ki yes no 0.700 0.680 0.416 2e-19
B8IH88140 Nucleoside diphosphate ki yes no 0.795 0.778 0.394 3e-19
P90666 837 Thioredoxin domain-contai N/A no 0.919 0.150 0.415 5e-19
>sp|A6VMK7|NDK_ACTSZ Nucleoside diphosphate kinase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=ndk PE=3 SV=1 Back     alignment and function desciption
 Score = 97.4 bits (241), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 66/95 (69%)

Query: 29  EKTLAMIKPDGLSGNYTDEIKKVILESGFSILRERVVRLDEDGAKTFYAEHSSRSFFSSL 88
           E+TL++IKPD +  N   +I     E+GF I+  +++RL++  A+ FYAEH  + FF  L
Sbjct: 4   ERTLSIIKPDAVERNLVGKILSRFEENGFQIVAMKMLRLNQAQAEGFYAEHQGKPFFDGL 63

Query: 89  IKYMTSGPVLAMVLEKENAITDWRALIGPTDAKKA 123
           ++YMTS PV+  VLEK+NA+ D+R LIG TD ++A
Sbjct: 64  VEYMTSAPVVVSVLEKDNAVKDYRTLIGATDPQQA 98
Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate.
Actinobacillus succinogenes (strain ATCC 55618 / 130Z) (taxid: 339671)
EC: 2EC: .EC: 7EC: .EC: 4EC: .EC: 6
>sp|Q65UT5|NDK_MANSM Nucleoside diphosphate kinase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=ndk PE=3 SV=1 Back     alignment and function description
>sp|Q89MS3|NDK_BRAJA Nucleoside diphosphate kinase OS=Bradyrhizobium japonicum (strain USDA 110) GN=ndk PE=3 SV=1 Back     alignment and function description
>sp|C6E0H6|NDK_GEOSM Nucleoside diphosphate kinase OS=Geobacter sp. (strain M21) GN=ndk PE=3 SV=1 Back     alignment and function description
>sp|B6JGK9|NDK_OLICO Nucleoside diphosphate kinase OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=ndk PE=3 SV=1 Back     alignment and function description
>sp|B0USF1|NDK_HAES2 Nucleoside diphosphate kinase OS=Haemophilus somnus (strain 2336) GN=ndk PE=3 SV=1 Back     alignment and function description
>sp|B5E9D0|NDK_GEOBB Nucleoside diphosphate kinase OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=ndk PE=3 SV=1 Back     alignment and function description
>sp|Q0I2G6|NDK_HAES1 Nucleoside diphosphate kinase OS=Haemophilus somnus (strain 129Pt) GN=ndk PE=3 SV=1 Back     alignment and function description
>sp|B8IH88|NDK_METNO Nucleoside diphosphate kinase OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=ndk PE=3 SV=1 Back     alignment and function description
>sp|P90666|TXND3_HELCR Thioredoxin domain-containing protein 3 homolog OS=Heliocidaris crassispina GN=NME8 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query137
359482468183 PREDICTED: nucleoside diphosphate kinase 0.846 0.633 0.767 6e-46
147834204197 hypothetical protein VITISV_043696 [Viti 0.839 0.583 0.765 1e-45
351724575197 uncharacterized protein LOC100500470 pre 0.905 0.629 0.677 4e-44
388499222178 unknown [Lotus japonicus] 0.927 0.713 0.661 5e-42
224073626174 predicted protein [Populus trichocarpa] 0.897 0.706 0.685 6e-42
356522408158 PREDICTED: LOW QUALITY PROTEIN: nucleosi 0.824 0.715 0.716 3e-41
297850138181 nucleoside diphosphate kinase family pro 0.846 0.640 0.637 9e-41
255583956187 nucleoside diphosphate kinase, putative 0.737 0.540 0.782 4e-40
42562123181 nucleoside diphosphate kinase-like prote 0.861 0.651 0.635 6e-40
297742982143 unnamed protein product [Vitis vinifera] 0.737 0.706 0.772 6e-40
>gi|359482468|ref|XP_002272468.2| PREDICTED: nucleoside diphosphate kinase-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  188 bits (478), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 89/116 (76%), Positives = 98/116 (84%)

Query: 19  RSLSNGSVEKEKTLAMIKPDGLSGNYTDEIKKVILESGFSILRERVVRLDEDGAKTFYAE 78
           RS S+GS EKEKT AMIKPDGLSGNYTDEIK  ILESGF ILRE  VRLDED A  FYAE
Sbjct: 26  RSSSSGSAEKEKTFAMIKPDGLSGNYTDEIKNAILESGFIILREMTVRLDEDTAGKFYAE 85

Query: 79  HSSRSFFSSLIKYMTSGPVLAMVLEKENAITDWRALIGPTDAKKAKISHPHRLYVL 134
           HSSRSFF +L+KYMTSGPVL MVLEK NA+ DWRALIGPTDA+KAK++HPH +  +
Sbjct: 86  HSSRSFFPALVKYMTSGPVLVMVLEKVNAVADWRALIGPTDAQKAKVTHPHSIRAM 141

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|147834204|emb|CAN77593.1| hypothetical protein VITISV_043696 [Vitis vinifera] Back     alignment and taxonomy information
>gi|351724575|ref|NP_001238598.1| uncharacterized protein LOC100500470 precursor [Glycine max] gi|255630403|gb|ACU15558.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|388499222|gb|AFK37677.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|224073626|ref|XP_002304122.1| predicted protein [Populus trichocarpa] gi|222841554|gb|EEE79101.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356522408|ref|XP_003529838.1| PREDICTED: LOW QUALITY PROTEIN: nucleoside diphosphate kinase-like [Glycine max] Back     alignment and taxonomy information
>gi|297850138|ref|XP_002892950.1| nucleoside diphosphate kinase family protein [Arabidopsis lyrata subsp. lyrata] gi|297338792|gb|EFH69209.1| nucleoside diphosphate kinase family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|255583956|ref|XP_002532725.1| nucleoside diphosphate kinase, putative [Ricinus communis] gi|223527533|gb|EEF29656.1| nucleoside diphosphate kinase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|42562123|ref|NP_173184.2| nucleoside diphosphate kinase-like protein [Arabidopsis thaliana] gi|332191462|gb|AEE29583.1| nucleoside diphosphate kinase-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297742982|emb|CBI35849.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query137
TAIR|locus:2018832181 AT1G17410 [Arabidopsis thalian 0.956 0.723 0.606 3.3e-40
ZFIN|ZDB-GENE-040718-221217 nme5 "non-metastatic cells 5, 0.715 0.451 0.45 3.5e-20
UNIPROTKB|E1C8A0210 NME5 "Uncharacterized protein" 0.737 0.480 0.427 9.2e-20
UNIPROTKB|E1BDQ6209 NME5 "Uncharacterized protein" 0.737 0.483 0.436 8.3e-19
UNIPROTKB|E2RLI0211 BRD8 "Uncharacterized protein" 0.737 0.478 0.436 8.3e-19
UNIPROTKB|I3LN92212 NME5 "Uncharacterized protein" 0.737 0.476 0.436 2.2e-18
MGI|MGI:1922783211 Nme5 "NME/NM23 family member 5 0.737 0.478 0.427 2.2e-18
UNIPROTKB|P56597212 NME5 "Nucleoside diphosphate k 0.737 0.476 0.436 2.8e-18
RGD|1583004113 LOC688903 "similar to Nucleosi 0.722 0.876 0.441 2.8e-18
UNIPROTKB|F1LVA7258 Nme7 "Nucleoside diphosphate k 0.802 0.426 0.421 5.8e-18
TAIR|locus:2018832 AT1G17410 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 428 (155.7 bits), Expect = 3.3e-40, P = 3.3e-40
 Identities = 80/132 (60%), Positives = 106/132 (80%)

Query:     4 RVVGLFILACIS-SPCRSLSNGSVEKEKTLAMIKPDGLSGNYTDEIKKVILESGFSILRE 62
             +++ L +LA +S SP R L  G+  +E+TLAMIKPDG+SGNYT+EIK +++E+GF+I++E
Sbjct:     7 QILFLLLLASVSLSPVRCLGYGASSEERTLAMIKPDGVSGNYTEEIKTIVVEAGFNIVKE 66

Query:    63 RVVRLDEDGAKTFYAEHSSRSFFSSLIKYMTSGPVLAMVLEKENAITDWRALIGPTDAKK 122
              + +LD++ A  FY EHSSRSFF  L+ YMTSGPVL MVLEK NA++DWR LIGPTDA+K
Sbjct:    67 MLTQLDKETASAFYEEHSSRSFFPHLVTYMTSGPVLVMVLEKRNAVSDWRDLIGPTDAEK 126

Query:   123 AKISHPHRLYVL 134
             AKISHPH +  L
Sbjct:   127 AKISHPHSIRAL 138
GO:0004550 "nucleoside diphosphate kinase activity" evidence=IEA;ISS
GO:0005524 "ATP binding" evidence=IEA;ISS
GO:0005737 "cytoplasm" evidence=ISM
GO:0006165 "nucleoside diphosphate phosphorylation" evidence=IEA
GO:0006183 "GTP biosynthetic process" evidence=IEA
GO:0006228 "UTP biosynthetic process" evidence=IEA
GO:0006241 "CTP biosynthetic process" evidence=IEA
GO:0009507 "chloroplast" evidence=ISM
ZFIN|ZDB-GENE-040718-221 nme5 "non-metastatic cells 5, protein expressed in (nucleoside-diphosphate kinase)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E1C8A0 NME5 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1BDQ6 NME5 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RLI0 BRD8 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|I3LN92 NME5 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1922783 Nme5 "NME/NM23 family member 5" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|P56597 NME5 "Nucleoside diphosphate kinase homolog 5" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1583004 LOC688903 "similar to Nucleoside diphosphate kinase homolog 5 (NDK-H 5) (NDP kinase homolog 5) (nm23-M5)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1LVA7 Nme7 "Nucleoside diphosphate kinase 7" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.7.4LOW CONFIDENCE prediction!
4th Layer2.7.4.6LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
estExt_Genewise1_v1.C_LG_III1530
nucleoside diphosphate kinase family protein (EC-2.7.4.6) (174 aa)
(Populus trichocarpa)
Predicted Functional Partners:
gw1.I.2892.1
thymidylate kinase (EC-2.7.4.9) (210 aa)
     •• 0.936
estExt_fgenesh4_pg.C_LG_II2596
SubName- Full=Putative uncharacterized protein; (171 aa)
     •  0.911
estExt_Genewise1_v1.C_880196
ribonucleoside-diphosphate reductase (EC-1.17.4.1) (329 aa)
     •  0.910
fgenesh4_pg.C_LG_I002334
ribonucleoside-diphosphate reductase (EC-1.17.4.1) (329 aa)
     •  0.910
estExt_Genewise1_v1.C_70080002
hypothetical protein (156 aa)
     •• 0.910
estExt_fgenesh4_pg.C_700026
hypothetical protein (250 aa)
     •• 0.909
gw1.VIII.327.1
ribonucleoside-diphosphate reductase (EC-1.17.4.1) (342 aa)
     •  0.909
estExt_Genewise1_v1.C_LG_XIV2383
CTP synthase (EC-6.3.4.2) (562 aa)
     •• 0.906
gw1.X.1387.1
CTP synthase (EC-6.3.4.2) (589 aa)
     •• 0.906
estExt_Genewise1_v1.C_LG_III0729
CTP synthase (EC-6.3.4.2) (596 aa)
     •• 0.905

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query137
PLN02931177 PLN02931, PLN02931, nucleoside diphosphate kinase 2e-76
cd04418132 cd04418, NDPk5, Nucleoside diphosphate kinase homo 1e-46
smart00562135 smart00562, NDK, Enzymes that catalyze nonsubstrat 5e-44
pfam00334135 pfam00334, NDK, Nucleoside diphosphate kinase 8e-41
PRK00668134 PRK00668, ndk, mulitfunctional nucleoside diphosph 2e-38
cd04413130 cd04413, NDPk_I, Nucleoside diphosphate kinase Gro 8e-38
cd00595133 cd00595, NDPk, Nucleoside diphosphate kinases (NDP 4e-37
cd04416132 cd04416, NDPk_TX, NDP kinase domain of thioredoxin 1e-34
COG0105135 COG0105, Ndk, Nucleoside diphosphate kinase [Nucle 5e-33
cd04414135 cd04414, NDPk6, Nucleoside diphosphate kinase 6 (N 3e-31
cd04415131 cd04415, NDPk7A, Nucleoside diphosphate kinase 7 d 2e-29
PRK14542137 PRK14542, PRK14542, nucleoside diphosphate kinase; 2e-26
PRK14545139 PRK14545, PRK14545, nucleoside diphosphate kinase; 5e-26
PRK14541140 PRK14541, PRK14541, nucleoside diphosphate kinase; 3e-23
PRK14540134 PRK14540, PRK14540, nucleoside diphosphate kinase; 2e-20
PTZ00093149 PTZ00093, PTZ00093, nucleoside diphosphate kinase, 5e-19
cd04412134 cd04412, NDPk7B, Nucleoside diphosphate kinase 7 d 4e-16
PLN02619238 PLN02619, PLN02619, nucleoside-diphosphate kinase 3e-14
PRK14544183 PRK14544, PRK14544, nucleoside diphosphate kinase; 2e-11
PRK14543169 PRK14543, PRK14543, nucleoside diphosphate kinase; 2e-08
>gnl|CDD|215503 PLN02931, PLN02931, nucleoside diphosphate kinase family protein Back     alignment and domain information 
 Score =  224 bits (572), Expect = 2e-76
 Identities = 89/122 (72%), Positives = 104/122 (85%)

Query: 8   LFILACISSPCRSLSNGSVEKEKTLAMIKPDGLSGNYTDEIKKVILESGFSILRERVVRL 67
           LF+L   S P R  S+G+ E+E+TLAMIKPDGLSGNYT+ IK+VILESGFSI++E   +L
Sbjct: 9   LFLLLLASFPIRCSSSGASEEERTLAMIKPDGLSGNYTERIKEVILESGFSIVKEMTTQL 68

Query: 68  DEDGAKTFYAEHSSRSFFSSLIKYMTSGPVLAMVLEKENAITDWRALIGPTDAKKAKISH 127
           DED A  FYAEHSSRSFF SL+KYMTSGPVL MVLEKENA++DWR LIGPTDA+KAKISH
Sbjct: 69  DEDRASLFYAEHSSRSFFPSLVKYMTSGPVLVMVLEKENAVSDWRTLIGPTDARKAKISH 128

Query: 128 PH 129
           P+
Sbjct: 129 PN 130

Length = 177
>gnl|CDD|239880 cd04418, NDPk5, Nucleoside diphosphate kinase homolog 5 (NDP kinase homolog 5, NDPk5, NM23-H5; Inhibitor of p53-induced apoptosis-beta, IPIA-beta): In human, mRNA for NDPk5 is almost exclusively found in testis, especially in the flagella of spermatids and spermatozoa, in association with axoneme microtubules, and may play a role in spermatogenesis by increasing the ability of late-stage spermatids to eliminate reactive oxygen species Back     alignment and domain information
>gnl|CDD|197791 smart00562, NDK, Enzymes that catalyze nonsubstrate specific conversions of nucleoside diphosphates to nucleoside triphosphates Back     alignment and domain information
>gnl|CDD|201162 pfam00334, NDK, Nucleoside diphosphate kinase Back     alignment and domain information
>gnl|CDD|179085 PRK00668, ndk, mulitfunctional nucleoside diphosphate kinase/apyrimidinic endonuclease/3'-; Validated Back     alignment and domain information
>gnl|CDD|239876 cd04413, NDPk_I, Nucleoside diphosphate kinase Group I (NDPk_I)-like: NDP kinase domains are present in a large family of structurally and functionally conserved proteins from bacteria to humans that generally catalyze the transfer of gamma-phosphates of a nucleoside triphosphate (NTP) donor onto a nucleoside diphosphate (NDP) acceptor through a phosphohistidine intermediate Back     alignment and domain information
>gnl|CDD|238335 cd00595, NDPk, Nucleoside diphosphate kinases (NDP kinases, NDPks): NDP kinases, responsible for the synthesis of nucleoside triphosphates (NTPs), are involved in numerous regulatory processes associated with proliferation, development, and differentiation Back     alignment and domain information
>gnl|CDD|239879 cd04416, NDPk_TX, NDP kinase domain of thioredoxin domain-containing proteins (TXNDC3 and TXNDC6): Txl-2 (TXNDC6) and Sptrx-2 (TXNDC3) are fusion proteins of Group II N-terminal thioredoxin domains followed by one or three NDP kinase domains, respectively Back     alignment and domain information
>gnl|CDD|223183 COG0105, Ndk, Nucleoside diphosphate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|239877 cd04414, NDPk6, Nucleoside diphosphate kinase 6 (NDP kinase 6, NDPk6, NM23-H6; NME6; Inhibitor of p53-induced apoptosis-alpha, IPIA-alpha): The nm23-H6 gene encoding NDPk6 is expressed mainly in mitochondria, but also found at a lower level in most tissues Back     alignment and domain information
>gnl|CDD|239878 cd04415, NDPk7A, Nucleoside diphosphate kinase 7 domain A (NDPk7A): The nm23-H7 class of nucleoside diphosphate kinase (NDPk7) consists of an N-terminal DM10 domain and two functional catalytic NDPk modules, NDPk7A and NDPk7B Back     alignment and domain information
>gnl|CDD|173008 PRK14542, PRK14542, nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>gnl|CDD|184734 PRK14545, PRK14545, nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>gnl|CDD|173007 PRK14541, PRK14541, nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>gnl|CDD|184733 PRK14540, PRK14540, nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>gnl|CDD|173387 PTZ00093, PTZ00093, nucleoside diphosphate kinase, cytosolic; Provisional Back     alignment and domain information
>gnl|CDD|239875 cd04412, NDPk7B, Nucleoside diphosphate kinase 7 domain B (NDPk7B): The nm23-H7 class of nucleoside diphosphate kinase (NDPk7) consists of an N-terminal DM10 domain and two functional catalytic NDPk modules, NDPk7A and NDPk7B Back     alignment and domain information
>gnl|CDD|178228 PLN02619, PLN02619, nucleoside-diphosphate kinase Back     alignment and domain information
>gnl|CDD|173010 PRK14544, PRK14544, nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>gnl|CDD|237749 PRK14543, PRK14543, nucleoside diphosphate kinase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 137
PLN02931177 nucleoside diphosphate kinase family protein 100.0
PRK14542137 nucleoside diphosphate kinase; Provisional 100.0
cd04415131 NDPk7A Nucleoside diphosphate kinase 7 domain A (N 100.0
COG0105135 Ndk Nucleoside diphosphate kinase [Nucleotide tran 100.0
PRK14541140 nucleoside diphosphate kinase; Provisional 100.0
cd04412134 NDPk7B Nucleoside diphosphate kinase 7 domain B (N 100.0
PRK14545139 nucleoside diphosphate kinase; Provisional 100.0
cd04418132 NDPk5 Nucleoside diphosphate kinase homolog 5 (NDP 100.0
PTZ00093149 nucleoside diphosphate kinase, cytosolic; Provisio 100.0
PRK14540134 nucleoside diphosphate kinase; Provisional 100.0
cd00595133 NDPk Nucleoside diphosphate kinases (NDP kinases, 100.0
cd04414135 NDPk6 Nucleoside diphosphate kinase 6 (NDP kinase 100.0
cd04416132 NDPk_TX NDP kinase domain of thioredoxin domain-co 100.0
PRK00668134 ndk mulitfunctional nucleoside diphosphate kinase/ 100.0
cd04413130 NDPk_I Nucleoside diphosphate kinase Group I (NDPk 100.0
PRK14543169 nucleoside diphosphate kinase; Provisional 100.0
PLN02619238 nucleoside-diphosphate kinase 100.0
PF00334135 NDK: Nucleoside diphosphate kinase; InterPro: IPR0 100.0
smart00562135 NDK These are enzymes that catalyze nonsubstrate s 100.0
PRK14544183 nucleoside diphosphate kinase; Provisional 99.98
KOG0888156 consensus Nucleoside diphosphate kinase [Nucleotid 99.97
>PLN02931 nucleoside diphosphate kinase family protein Back     alignment and domain information 
Probab=100.00  E-value=3.5e-37  Score=232.14  Aligned_cols=127  Identities=70%  Similarity=1.081  Sum_probs=118.3

Q ss_pred             HHHHHHHhcCCcCCCCCcccceEEEEEEcCCccCCCchHHHHHHHHHcCCeEEEEEEeecCHHHHHhHHHHhcCCCcHHH
Q 032592            8 LFILACISSPCRSLSNGSVEKEKTLAMIKPDGLSGNYTDEIKKVILESGFSILRERVVRLDEDGAKTFYAEHSSRSFFSS   87 (137)
Q Consensus         8 ~~~~~~~~~~~~~~~~~~~~~e~tlvlIKPda~~~~~~g~II~~i~~~Gf~I~~~k~~~ls~~~a~~~y~~~~~~~~~~~   87 (137)
                      +|++-.++-.-++.+...+..|+||+|||||++.++++|+|+++|+++||+|+++||++|++++|++||.+|++++||++
T Consensus         9 ~~~~~~~~~~~~~~~~~~~~~erTlalIKPdav~~~~~G~Il~~I~~~Gf~I~~~K~~~Lt~e~a~~fY~~h~gk~ff~~   88 (177)
T PLN02931          9 LFLLLLASFPIRCSSSGASEEERTLAMIKPDGLSGNYTERIKEVILESGFSIVKEMTTQLDEDRASLFYAEHSSRSFFPS   88 (177)
T ss_pred             HHHHHHcccccccCCCCCCcceeEEEEECchhhhcccHHHHHHHHHHCCCEEEeeeeecCCHHHHHHHHHHhCCCccHHH
Confidence            46666666566666677788899999999999988889999999999999999999999999999999999999999999


Q ss_pred             HHHHhhcCCEEEEEEeeccHHHHHHHHhCCCChhhhhhcCCCCccCC
Q 032592           88 LIKYMTSGPVLAMVLEKENAITDWRALIGPTDAKKAKISHPHRLYVL  134 (137)
Q Consensus        88 lv~~~~sGpvv~l~l~g~naV~~~r~l~Gp~dp~~A~~~~p~slRa~  134 (137)
                      ++++|+|||+++|+|.|+|||++||+++||+||.+|+...|+|||+.
T Consensus        89 Lv~~mtSGP~vam~L~g~naV~~~R~liGptdp~~A~~~~P~sIRa~  135 (177)
T PLN02931         89 LVKYMTSGPVLVMVLEKENAVSDWRTLIGPTDARKAKISHPNSIRAM  135 (177)
T ss_pred             HHHHHHhCCeEEEEEecCCHHHHHHHHhCCCChhhhccCCCCCchHH
Confidence            99999999999999999999999999999999999999999999984

>PRK14542 nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>cd04415 NDPk7A Nucleoside diphosphate kinase 7 domain A (NDPk7A): The nm23-H7 class of nucleoside diphosphate kinase (NDPk7) consists of an N-terminal DM10 domain and two functional catalytic NDPk modules, NDPk7A and NDPk7B Back     alignment and domain information
>COG0105 Ndk Nucleoside diphosphate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK14541 nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>cd04412 NDPk7B Nucleoside diphosphate kinase 7 domain B (NDPk7B): The nm23-H7 class of nucleoside diphosphate kinase (NDPk7) consists of an N-terminal DM10 domain and two functional catalytic NDPk modules, NDPk7A and NDPk7B Back     alignment and domain information
>PRK14545 nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>cd04418 NDPk5 Nucleoside diphosphate kinase homolog 5 (NDP kinase homolog 5, NDPk5, NM23-H5; Inhibitor of p53-induced apoptosis-beta, IPIA-beta): In human, mRNA for NDPk5 is almost exclusively found in testis, especially in the flagella of spermatids and spermatozoa, in association with axoneme microtubules, and may play a role in spermatogenesis by increasing the ability of late-stage spermatids to eliminate reactive oxygen species Back     alignment and domain information
>PTZ00093 nucleoside diphosphate kinase, cytosolic; Provisional Back     alignment and domain information
>PRK14540 nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>cd00595 NDPk Nucleoside diphosphate kinases (NDP kinases, NDPks): NDP kinases, responsible for the synthesis of nucleoside triphosphates (NTPs), are involved in numerous regulatory processes associated with proliferation, development, and differentiation Back     alignment and domain information
>cd04414 NDPk6 Nucleoside diphosphate kinase 6 (NDP kinase 6, NDPk6, NM23-H6; NME6; Inhibitor of p53-induced apoptosis-alpha, IPIA-alpha): The nm23-H6 gene encoding NDPk6 is expressed mainly in mitochondria, but also found at a lower level in most tissues Back     alignment and domain information
>cd04416 NDPk_TX NDP kinase domain of thioredoxin domain-containing proteins (TXNDC3 and TXNDC6): Txl-2 (TXNDC6) and Sptrx-2 (TXNDC3) are fusion proteins of Group II N-terminal thioredoxin domains followed by one or three NDP kinase domains, respectively Back     alignment and domain information
>PRK00668 ndk mulitfunctional nucleoside diphosphate kinase/apyrimidinic endonuclease/3'-; Validated Back     alignment and domain information
>cd04413 NDPk_I Nucleoside diphosphate kinase Group I (NDPk_I)-like: NDP kinase domains are present in a large family of structurally and functionally conserved proteins from bacteria to humans that generally catalyze the transfer of gamma-phosphates of a nucleoside triphosphate (NTP) donor onto a nucleoside diphosphate (NDP) acceptor through a phosphohistidine intermediate Back     alignment and domain information
>PRK14543 nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>PLN02619 nucleoside-diphosphate kinase Back     alignment and domain information
>PF00334 NDK: Nucleoside diphosphate kinase; InterPro: IPR001564 Nucleoside diphosphate kinases (2 Back     alignment and domain information
>smart00562 NDK These are enzymes that catalyze nonsubstrate specific conversions of nucleoside diphosphates to nucleoside triphosphates Back     alignment and domain information
>PRK14544 nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>KOG0888 consensus Nucleoside diphosphate kinase [Nucleotide transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query137
3vgu_A141 E134a Mutant Nucleoside Diphosphate Kinase Derived 4e-19
3vgs_A141 Wild-Type Nucleoside Diphosphate Kinase Derived Fro 4e-19
4dut_A145 The Structure Of Nucleoside Diphosphate Kinase (Ndk 1e-17
3ztq_A142 Hexagonal Crystal Form P61 Of The Aquifex Aeolicus 1e-16
2hur_A142 Escherichia Coli Nucleoside Diphosphate Kinase Leng 2e-15
2az1_A181 Structure Of A Halophilic Nucleoside Diphosphate Ki 4e-15
2az3_A164 Structure Of A Halophilic Nucleoside Diphosphate Ki 5e-15
2nck_R144 Crystal Structure Of Myxococcus Xanthus Nucleoside 5e-15
1wkj_A137 Crystal Structure Of Nucleoside Diphosphate Kinase 7e-15
3pj9_A140 Crystal Structure Of A Nucleoside Diphosphate Kinas 3e-14
2zua_A174 Crystal Structure Of Nucleoside Diphosphate Kinase 7e-14
1ndk_A155 X-Ray Structure Of Nucleoside Diphosphate Kinase Le 1e-13
1lwx_A155 Azt Diphosphate Binding To Nucleoside Diphosphate K 1e-13
1ndp_A155 Adenosine 5'-Diphosphate Binding And The Active Sit 1e-13
1nsp_A155 Mechanism Of Phosphate Transfer By Nucleoside Dipho 1e-13
1hlw_A155 Structure Of The H122a Mutant Of The Nucleoside Dip 1e-13
1b4s_A155 Structure Of Nucleoside Diphosphate Kinase H122g Mu 1e-13
1bhn_A152 Nucleoside Diphosphate Kinase Isoform A From Bovine 1e-13
1be4_A151 Nucleoside Diphosphate Kinase Isoform B From Bovine 1e-13
1nue_A151 X-ray Structure Of Nm23 Human Nucleoside Diphosphat 2e-13
1nsk_R152 The Crystal Structure Of A Human Nucleoside Diphosp 2e-13
1npk_A154 Refined X-Ray Structure Of Dictyostelium Nucleoside 2e-13
3l7u_A172 Crystal Structure Of Human Nm23-H1 Length = 172 2e-13
3q83_A157 Crystal Structure Of Staphylococcus Aureus Nucleosi 2e-13
2hve_A152 S120g Mutant Of Human Nucleoside Diphosphate Kinase 3e-13
1jxv_A152 Crystal Structure Of Human Nucleoside Diphosphate K 3e-13
1leo_A150 P100s Nucleoside Diphosphate Kinase Length = 150 3e-13
2vu5_A148 Crystal Structure Of Pndk From Bacillus Anthracis L 3e-13
1k44_A136 Mycobacterium Tuberculosis Nucleoside Diphosphate K 3e-13
1ncl_A150 Thermal Stability Of Hexameric And Tetrameric Nucle 4e-13
1hhq_A155 Role Of Active Site Resiude Lys16 In Nucleoside Dip 5e-13
1mn7_A155 Ndp Kinase Mutant (H122g;n119s;f64w) In Complex Wit 5e-13
1zs6_A169 Structure Of Human Nucleoside-diphosphate Kinase 3 7e-13
1ucn_A152 X-Ray Structure Of Human Nucleoside Diphosphate Kin 1e-12
3bbc_A151 Crystal Structure Of R88a Mutant Of The Nm23-H2 Tra 1e-12
3r9l_A155 Crystal Structure Of Nucleoside Diphosphate Kinase 1e-12
1ehw_A162 Human Nucleoside Diphosphate Kinase 4 Length = 162 2e-12
1u8w_A149 Crystal Structure Of Arabidopsis Thaliana Nucleosid 2e-12
4f36_A157 Crystal Structure Of Nucleoside Diphosphate Kinase 3e-12
1pae_X155 Nucleoside Diphosphate Kinase Length = 155 3e-12
2cwk_A160 Crystal Structure Of Nucleotide Diphosphate Kinase 4e-12
1w7w_A182 Structure And Mutational Analysis Of A Plant Mitoch 6e-12
1s57_A153 Crystal Structure Of Nucleoside Diphosphate Kinase 9e-12
4fkx_A161 Crystal Structure Of Nucleoside Diphosphate Kinase 2e-11
1ndl_A153 The Awd Nucleotide Diphosphate Kinase From Drosophi 3e-11
1nsq_A153 Mechanism Of Phosphate Transfer By Nucleoside Dipho 3e-11
3b54_A161 Saccharomyces Cerevisiae Nucleoside Diphosphate Kin 6e-11
3ngr_A151 Crystal Structure Of Leishmania Nucleoside Diphosph 1e-10
1xiq_A157 Plasmodium Falciparum Nucleoside Diphosphate Kinase 2e-10
1pku_A150 Crystal Structure Of Nucleoside Diphosphate Kinase 3e-10
1nb2_A150 Crystal Structure Of Nucleoside Diphosphate Kinase 3e-10
3prv_A157 Nucleoside Diphosphate Kinase B From Trypanosoma Cr 4e-09
3js9_A156 Crystal Structure Of Nucleoside Diphosphate Kinase 1e-08
3mpd_A151 Crystal Structure Of Nucleoside Diphosphate Kinase 2e-08
3em1_A146 Crystal Structure Of The Mimivirus Ndk +kpn-N62l Do 2e-08
3ddi_A146 Crystal Structure Of The Mimivirus Ndk +kpn-N62l-R1 2e-08
3fbf_A142 Crystal Structure Of The Mimivirus Ndk N62l Mutant 7e-08
3fbe_A142 Crystal Structure Of The Mimivirus Ndk N62l-R107g D 8e-08
3ejm_A146 Crystal Structure Of The Mimivirus Ndk +kpn Mutant 1e-07
3emt_A146 Crystal Structure Of The Mimivirus Ndk +kpn-R107g D 1e-07
2b8q_A142 X-Ray Structure Of Acanthamoeba Ployphaga Mimivirus 5e-07
2b8p_A157 Crystal Structure Of Acanthamoeba Polyphaga Mimivir 5e-07
3evw_A142 Crystal Structure Of The Mimivirus Ndk R107g Mutant 5e-07
4di6_A190 Crystal Structure Of Nucleoside-Diphosphate Kinase 6e-06
1xqi_A195 Crystal Structure Analysis Of An Ndp Kinase From Py 2e-04
>pdb|3VGU|A Chain A, E134a Mutant Nucleoside Diphosphate Kinase Derived From Halomonas Sp. 593 Length = 141 Back     alignment and structure 
Iteration: 1

 Score = 89.7 bits (221), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 42/96 (43%), Positives = 65/96 (67%)
Query: 29  EKTLAMIKPDGLSGNYTDEIKKVILESGFSILRERVVRLDEDGAKTFYAEHSSRSFFSSL 88
           E+TL++IKPD ++ N   EI+    ++G  I+  ++++L ++ A+ FYAEH  R FF  L
Sbjct: 4   ERTLSIIKPDAVAKNVIGEIESRFEKAGLKIVAAKMLQLSQEQAEGFYAEHKERPFFGDL 63
Query: 89  IKYMTSGPVLAMVLEKENAITDWRALIGPTDAKKAK 124
           + +MTSGPV+  VLE ENAI   R L+G T+ K+A+
Sbjct: 64  VGFMTSGPVVVQVLEGENAIAANRDLMGATNPKEAE 99
>pdb|3VGS|A Chain A, Wild-Type Nucleoside Diphosphate Kinase Derived From Halomonas Sp. 593 Length = 141 Back     alignment and structure
>pdb|4DUT|A Chain A, The Structure Of Nucleoside Diphosphate Kinase (Ndk) From Burkholderia Thailandensis Length = 145 Back     alignment and structure
>pdb|3ZTQ|A Chain A, Hexagonal Crystal Form P61 Of The Aquifex Aeolicus Nucleoside Diphosphate Kinase Length = 142 Back     alignment and structure
>pdb|2HUR|A Chain A, Escherichia Coli Nucleoside Diphosphate Kinase Length = 142 Back     alignment and structure
>pdb|2AZ1|A Chain A, Structure Of A Halophilic Nucleoside Diphosphate Kinase From Halobacterium Salinarum Length = 181 Back     alignment and structure
>pdb|2AZ3|A Chain A, Structure Of A Halophilic Nucleoside Diphosphate Kinase From Halobacterium Salinarum In Complex With Cdp Length = 164 Back     alignment and structure
>pdb|2NCK|R Chain R, Crystal Structure Of Myxococcus Xanthus Nucleoside Diphosphate Kinase And Its Interaction With A Nucleotide Substrate At 2.0 Angstroms Resolution Length = 144 Back     alignment and structure
>pdb|1WKJ|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase From Thermus Thermophilus Hb8 Length = 137 Back     alignment and structure
>pdb|3PJ9|A Chain A, Crystal Structure Of A Nucleoside Diphosphate Kinase From Campylobacter Jejuni Length = 140 Back     alignment and structure
>pdb|2ZUA|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase From Haloarcula Quadrata Length = 174 Back     alignment and structure
>pdb|1NDK|A Chain A, X-Ray Structure Of Nucleoside Diphosphate Kinase Length = 155 Back     alignment and structure
>pdb|1LWX|A Chain A, Azt Diphosphate Binding To Nucleoside Diphosphate Kinase Length = 155 Back     alignment and structure
>pdb|1NDP|A Chain A, Adenosine 5'-Diphosphate Binding And The Active Site Of Nucleoside Diphosphate Kinase Length = 155 Back     alignment and structure
>pdb|1NSP|A Chain A, Mechanism Of Phosphate Transfer By Nucleoside Diphosphate Kinase: X- Ray Structures Of A Phospho-Histidine Intermediate Of The Enzymes From Drosophila And Dictyostelium Length = 155 Back     alignment and structure
>pdb|1HLW|A Chain A, Structure Of The H122a Mutant Of The Nucleoside Diphosphate Kinase Length = 155 Back     alignment and structure
>pdb|1B4S|A Chain A, Structure Of Nucleoside Diphosphate Kinase H122g Mutant Length = 155 Back     alignment and structure
>pdb|1BHN|A Chain A, Nucleoside Diphosphate Kinase Isoform A From Bovine Retina Length = 152 Back     alignment and structure
>pdb|1BE4|A Chain A, Nucleoside Diphosphate Kinase Isoform B From Bovine Retina Length = 151 Back     alignment and structure
>pdb|1NUE|A Chain A, X-ray Structure Of Nm23 Human Nucleoside Diphosphate Kinase B Complexed With Gdp At 2 Angstroms Resolution Length = 151 Back     alignment and structure
>pdb|1NSK|R Chain R, The Crystal Structure Of A Human Nucleoside Diphosphate Kinase, Nm23-H2 Length = 152 Back     alignment and structure
>pdb|1NPK|A Chain A, Refined X-Ray Structure Of Dictyostelium Nucleoside Diphosphate Kinase At 1,8 Angstroms Resolution Length = 154 Back     alignment and structure
>pdb|3L7U|A Chain A, Crystal Structure Of Human Nm23-H1 Length = 172 Back     alignment and structure
>pdb|3Q83|A Chain A, Crystal Structure Of Staphylococcus Aureus Nucleoside Diphosphate Kinase Length = 157 Back     alignment and structure
>pdb|2HVE|A Chain A, S120g Mutant Of Human Nucleoside Diphosphate Kinase A Complexed With Adp Length = 152 Back     alignment and structure
>pdb|1JXV|A Chain A, Crystal Structure Of Human Nucleoside Diphosphate Kinase A Length = 152 Back     alignment and structure
>pdb|1LEO|A Chain A, P100s Nucleoside Diphosphate Kinase Length = 150 Back     alignment and structure
>pdb|2VU5|A Chain A, Crystal Structure Of Pndk From Bacillus Anthracis Length = 148 Back     alignment and structure
>pdb|1K44|A Chain A, Mycobacterium Tuberculosis Nucleoside Diphosphate Kinase Length = 136 Back     alignment and structure
>pdb|1NCL|A Chain A, Thermal Stability Of Hexameric And Tetrameric Nucleoside, Diphosphate Kinases Length = 150 Back     alignment and structure
>pdb|1HHQ|A Chain A, Role Of Active Site Resiude Lys16 In Nucleoside Diphosphate Kinase Length = 155 Back     alignment and structure
>pdb|1MN7|A Chain A, Ndp Kinase Mutant (H122g;n119s;f64w) In Complex With Abazttp Length = 155 Back     alignment and structure
>pdb|1ZS6|A Chain A, Structure Of Human Nucleoside-diphosphate Kinase 3 Length = 169 Back     alignment and structure
>pdb|1UCN|A Chain A, X-Ray Structure Of Human Nucleoside Diphosphate Kinase A Complexed With Adp At 2 A Resolution Length = 152 Back     alignment and structure
>pdb|3BBC|A Chain A, Crystal Structure Of R88a Mutant Of The Nm23-H2 Transcription Factor Length = 151 Back     alignment and structure
>pdb|3R9L|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase From Giardia Lamblia Featuring A Disordered Dinucleotide Binding Site Length = 155 Back     alignment and structure
>pdb|1EHW|A Chain A, Human Nucleoside Diphosphate Kinase 4 Length = 162 Back     alignment and structure
>pdb|1U8W|A Chain A, Crystal Structure Of Arabidopsis Thaliana Nucleoside Diphosphate Kinase 1 Length = 149 Back     alignment and structure
>pdb|4F36|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase B From Trypanosoma Brucei, Apo Form Length = 157 Back     alignment and structure
>pdb|1PAE|X Chain X, Nucleoside Diphosphate Kinase Length = 155 Back     alignment and structure
>pdb|2CWK|A Chain A, Crystal Structure Of Nucleotide Diphosphate Kinase From Pyrococcus Horikoshii Length = 160 Back     alignment and structure
>pdb|1W7W|A Chain A, Structure And Mutational Analysis Of A Plant Mitochondrial Nucleoside Diphosphate Kinase: Identification Of Residues Involved In Serine Phosphorylation And Oligomerization. Length = 182 Back     alignment and structure
>pdb|1S57|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase 2 From Arabidopsis Length = 153 Back     alignment and structure
>pdb|4FKX|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase B From Trypanosoma Brucei Bound To Cdp Length = 161 Back     alignment and structure
>pdb|1NDL|A Chain A, The Awd Nucleotide Diphosphate Kinase From Drosophila Length = 153 Back     alignment and structure
>pdb|1NSQ|A Chain A, Mechanism Of Phosphate Transfer By Nucleoside Diphosphate Kinase: X- Ray Structures Of A Phospho-Histidine Intermediate Of The Enzymes From Drosophila And Dictyostelium Length = 153 Back     alignment and structure
>pdb|3B54|A Chain A, Saccharomyces Cerevisiae Nucleoside Diphosphate Kinase Length = 161 Back     alignment and structure
>pdb|3NGR|A Chain A, Crystal Structure Of Leishmania Nucleoside Diphosphate Kinase B With Unordered Nucleotide-Binding Loop. Length = 151 Back     alignment and structure
>pdb|1XIQ|A Chain A, Plasmodium Falciparum Nucleoside Diphosphate Kinase B Length = 157 Back     alignment and structure
>pdb|1PKU|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase From Rice Length = 150 Back     alignment and structure
>pdb|1NB2|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase From Bacillus Halodenitrificans Length = 150 Back     alignment and structure
>pdb|3PRV|A Chain A, Nucleoside Diphosphate Kinase B From Trypanosoma Cruzi Length = 157 Back     alignment and structure
>pdb|3JS9|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase Family Protein From Babesia Bovis Length = 156 Back     alignment and structure
>pdb|3MPD|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase From Encephalitozoon Cuniculi, Cubic Form, Apo Length = 151 Back     alignment and structure
>pdb|3EM1|A Chain A, Crystal Structure Of The Mimivirus Ndk +kpn-N62l Double Mutant Complexed With Dtdp Length = 146 Back     alignment and structure
>pdb|3DDI|A Chain A, Crystal Structure Of The Mimivirus Ndk +kpn-N62l-R107g Triple Mutant Complexed With Tdp Length = 146 Back     alignment and structure
>pdb|3FBF|A Chain A, Crystal Structure Of The Mimivirus Ndk N62l Mutant Complexed With Dtdp Length = 142 Back     alignment and structure
>pdb|3FBE|A Chain A, Crystal Structure Of The Mimivirus Ndk N62l-R107g Double Mutant Complexed With Gdp Length = 142 Back     alignment and structure
>pdb|3EJM|A Chain A, Crystal Structure Of The Mimivirus Ndk +kpn Mutant Complexed With Gdp Length = 146 Back     alignment and structure
>pdb|3EMT|A Chain A, Crystal Structure Of The Mimivirus Ndk +kpn-R107g Double Mutant Complexed With Dgdp Length = 146 Back     alignment and structure
>pdb|2B8Q|A Chain A, X-Ray Structure Of Acanthamoeba Ployphaga Mimivirus Nucleoside Diphosphate Kinase Complexed With Tdp Length = 142 Back     alignment and structure
>pdb|2B8P|A Chain A, Crystal Structure Of Acanthamoeba Polyphaga Mimivirus Ndk, The First Viral Nucleoside Diphosphate Kinase Length = 157 Back     alignment and structure
>pdb|3EVW|A Chain A, Crystal Structure Of The Mimivirus Ndk R107g Mutant Complexed With Dtdp Length = 142 Back     alignment and structure
>pdb|4DI6|A Chain A, Crystal Structure Of Nucleoside-Diphosphate Kinase From Borrelia Burgdorferi Length = 190 Back     alignment and structure
>pdb|1XQI|A Chain A, Crystal Structure Analysis Of An Ndp Kinase From Pyrobaculum Aerophilum Length = 195 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query137
3ztp_A142 Nucleoside diphosphate kinase; transferase; HET: G 1e-40
4ek2_A145 Nucleoside diphosphate kinase; seattle structural 5e-40
2hur_A142 NDK, nucleoside diphosphate kinase, NDP kinase; ty 1e-39
1nhk_R144 Nucleoside diphosphate kinase; phosphotransferase; 1e-39
3mpd_A151 Nucleoside diphosphate kinase; ssgcid, NIH, niaid, 1e-38
3r9l_A155 Nucleoside diphosphate kinase; structural genomics 3e-38
2dxe_A160 Nucleoside diphosphate kinase; nucleoside binding, 3e-38
1wkj_A137 Nucleoside diphosphate kinase; thermus thermophilu 3e-38
3fkb_A155 NDP kinase, NDK, nucleoside diphosphate kinase, cy 6e-38
4fkx_A161 NDK B, nucleoside diphosphate kinase; structural g 6e-38
1w7w_A182 Nucleoside diphosphate kinase; NDPK3, transferase; 6e-38
1s57_A153 Nucleoside diphosphate kinase II; transferase; HET 6e-38
1ehw_A162 NDPK H4, nucleoside diphosphate kinase; NM23, mito 8e-38
3q8u_A157 Nucleoside diphosphate kinase; ferridoxin fold, al 9e-38
1nb2_A150 Nucleoside diphosphate kinase; bacillus halodenitr 9e-38
1pku_A150 Nucleoside diphosphate kinase I; RICE, transferase 9e-38
1zs6_A169 Nucleoside diphosphate kinase 3; nucleotide metabo 1e-37
1u8w_A149 Nucleoside diphosphate kinase I; nucleotide diphos 1e-37
2az3_A164 Nucleoside diphosphate kinase; halophilic, transfe 1e-37
2vu5_A148 Nucleoside diphosphate kinase; nucleotide-binding, 1e-37
3bbb_A151 Nucleoside diphosphate kinase B; transcription fac 3e-37
1xiq_A157 Nucleoside diphosphate kinase B; protein structure 3e-37
3b54_A161 NDK, NDP kinase, nucleoside diphosphate kinase; al 3e-37
1k44_A136 Nucleoside diphosphate kinase; nucleoside triphosp 3e-37
3l7u_A172 Nucleoside diphosphate kinase A; ATP-binding, nucl 4e-37
3js9_A156 Nucleoside diphosphate kinase family protein; niai 4e-37
3evo_A146 NDP kinase, NDK, nucleoside diphosphate kinase; ph 1e-36
4dz6_A190 Nucleoside diphosphate kinase; ssgcid, niaid, vana 2e-34
1xqi_A195 Nucleoside diphosphate kinase; alpha/beta sandwich 5e-26
>3ztp_A Nucleoside diphosphate kinase; transferase; HET: GOL; 1.37A {Aquifex aeolicus} PDB: 3zto_A* 3ztq_A 3ztr_A 3zts_A Length = 142 Back     alignment and structure
 Score =  131 bits (332), Expect = 1e-40
 Identities = 39/100 (39%), Positives = 60/100 (60%)

Query: 29  EKTLAMIKPDGLSGNYTDEIKKVILESGFSILRERVVRLDEDGAKTFYAEHSSRSFFSSL 88
           E+TL ++KPD +      +I    ++ GF I   ++ R   + A  FY  H  R FF  L
Sbjct: 4   ERTLIIVKPDAMEKGALGKILDRFIQEGFQIKALKMFRFTPEKAGEFYYVHRERPFFQEL 63

Query: 89  IKYMTSGPVLAMVLEKENAITDWRALIGPTDAKKAKISHP 128
           +++M+SGPV+A VLE E+AI   R +IGPTD+++A+   P
Sbjct: 64  VEFMSSGPVVAAVLEGEDAIKRVREIIGPTDSEEARKVAP 103
>4ek2_A Nucleoside diphosphate kinase; seattle structural genomics center for infectious disease, S DAMP, niaid; HET: DA; 2.00A {Burkholderia thailandensis} PDB: 4dut_A* Length = 145 Back     alignment and structure
>2hur_A NDK, nucleoside diphosphate kinase, NDP kinase; type II tetramer, signaling protein,transferase; 1.62A {Escherichia coli} Length = 142 Back     alignment and structure
>1nhk_R Nucleoside diphosphate kinase; phosphotransferase; HET: CMP; 1.90A {Myxococcus xanthus} SCOP: d.58.6.1 PDB: 1nlk_R* 2nck_R 3pj9_A Length = 144 Back     alignment and structure
>3mpd_A Nucleoside diphosphate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, encepha cuniculi, structural genomics; 2.08A {Encephalitozoon cuniculi} Length = 151 Back     alignment and structure
>3r9l_A Nucleoside diphosphate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, giardiasis; 2.65A {Giardia lamblia} Length = 155 Back     alignment and structure
>2dxe_A Nucleoside diphosphate kinase; nucleoside binding, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: d.58.6.1 PDB: 2dxd_A* 2cwk_A* 2dxf_A* 2dy9_A* 2dya_A* Length = 160 Back     alignment and structure
>1wkj_A Nucleoside diphosphate kinase; thermus thermophilus HB8, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.00A {Thermus thermophilus} SCOP: d.58.6.1 PDB: 1wkk_A* 1wkl_A* Length = 137 Back     alignment and structure
>3fkb_A NDP kinase, NDK, nucleoside diphosphate kinase, cytosolic; AN hexamer structure, ATP-binding, magnesium, metal- nucleotide metabolism; HET: TNM TNV; 1.65A {Dictyostelium discoideum} PDB: 1b4s_A* 1mn9_A* 1f3f_A* 1hlw_A 1ndk_A 1pae_X 1f6t_A* 1bux_A* 1b99_A* 1hiy_A* 1kdn_A* 1ndc_A* 1ndp_A* 1nsp_A* 1s5z_A* 2bef_A* 1mn7_A* 1hhq_A 1lwx_A* 1npk_A ... Length = 155 Back     alignment and structure
>4fkx_A NDK B, nucleoside diphosphate kinase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: CDP; 1.70A {Trypanosoma brucei brucei} PDB: 4fky_A* 4f4a_A* 4f36_A* 3prv_A 3ngs_A 3ngr_A 3ngt_A* 3ngu_A* Length = 161 Back     alignment and structure
>1w7w_A Nucleoside diphosphate kinase; NDPK3, transferase; 2.80A {Pisum sativum} SCOP: d.58.6.1 Length = 182 Back     alignment and structure
>1s57_A Nucleoside diphosphate kinase II; transferase; HET: EPE; 1.80A {Arabidopsis thaliana} SCOP: d.58.6.1 PDB: 1s59_A* Length = 153 Back     alignment and structure
>1ehw_A NDPK H4, nucleoside diphosphate kinase; NM23, mitochondrial, killer-O transferase; 2.40A {Homo sapiens} SCOP: d.58.6.1 Length = 162 Back     alignment and structure
>3q8u_A Nucleoside diphosphate kinase; ferridoxin fold, alpha-beta protein family; HET: ADP; 2.22A {Staphylococcus aureus subsp} PDB: 3q83_A* 3q89_A* 3q86_A* 3q8v_A* 3q8y_A* Length = 157 Back     alignment and structure
>1nb2_A Nucleoside diphosphate kinase; bacillus halodenitrifians, transferase; 2.20A {Virgibacillus halodenitrificans} SCOP: d.58.6.1 Length = 150 Back     alignment and structure
>1pku_A Nucleoside diphosphate kinase I; RICE, transferase; 2.50A {Oryza sativa} SCOP: d.58.6.1 Length = 150 Back     alignment and structure
>1zs6_A Nucleoside diphosphate kinase 3; nucleotide metabolism, apoptosis, transferase, struc genomics, structural genomics consortium, SGC; HET: ADP; 2.30A {Homo sapiens} SCOP: d.58.6.1 Length = 169 Back     alignment and structure
>1u8w_A Nucleoside diphosphate kinase I; nucleotide diphosphate, transferase; 2.40A {Arabidopsis thaliana} SCOP: d.58.6.1 Length = 149 Back     alignment and structure
>2az3_A Nucleoside diphosphate kinase; halophilic, transferase; HET: CDP; 2.20A {Halobacterium salinarum} SCOP: d.58.6.1 PDB: 2az1_A 2zua_A Length = 164 Back     alignment and structure
>2vu5_A Nucleoside diphosphate kinase; nucleotide-binding, ATP-binding, metal-binding, phosphoprotein, nucleotide metabolism, cytoplasm, magnesium; 2.0A {Bacillus anthracis} Length = 148 Back     alignment and structure
>3bbb_A Nucleoside diphosphate kinase B; transcription factor, cancer, NM23 GEN, hexamer, activator, oncogene, ATP-binding, cell cycle, DNA-binding; HET: DG DA; 1.30A {Homo sapiens} SCOP: d.58.6.1 PDB: 1nue_A* 3bbf_A* 1nsk_R 3bbc_A 1be4_A* 1bhn_A* 2hvd_A* 1jxv_A* 2hve_A* 1ucn_A* 1nsq_A* 1ndl_A* Length = 151 Back     alignment and structure
>1xiq_A Nucleoside diphosphate kinase B; protein structure initiative, structural genomics, SGPP; 3.05A {Plasmodium falciparum} SCOP: d.58.6.1 Length = 157 Back     alignment and structure
>3b54_A NDK, NDP kinase, nucleoside diphosphate kinase; alpha/beta sandwich, ATP-binding, magnesium, metal-B mitochondrion; 3.10A {Saccharomyces cerevisiae} Length = 161 Back     alignment and structure
>1k44_A Nucleoside diphosphate kinase; nucleoside triphosphate, transferase; 2.60A {Mycobacterium tuberculosis} SCOP: d.58.6.1 Length = 136 Back     alignment and structure
>3l7u_A Nucleoside diphosphate kinase A; ATP-binding, nucleotide-binding, transferase, tumor suppressor; 2.10A {Homo sapiens} Length = 172 Back     alignment and structure
>3js9_A Nucleoside diphosphate kinase family protein; niaid, ssgcid, seattle structural genomics center for infect disease, babesiosis; 2.50A {Babesia bovis} Length = 156 Back     alignment and structure
>3evo_A NDP kinase, NDK, nucleoside diphosphate kinase; phosphotransferase nucleotide binding, ATP-binding, magnesium, metal-binding; HET: TYD; 1.50A {Acanthamoeba polyphaga mimivirus} PDB: 3ejm_A* 3emt_A* 3em1_A* 3fc9_A* 3g2x_A* 3ena_A* 3dkd_A* 3ddi_A* 3etm_A* 3evm_A* 3fcv_A* 3b6b_A* 2b8p_A* 3gp9_A* 2b8q_A* 3ee3_A* 3elh_A* 3eic_A* 3evw_A* 3gpa_A* ... Length = 146 Back     alignment and structure
>4dz6_A Nucleoside diphosphate kinase; ssgcid, niaid, vanada transition state mimic, transition state analog, transferas; HET: ADP; 2.20A {Borrelia burgdorferi} PDB: 4di6_A* Length = 190 Back     alignment and structure
>1xqi_A Nucleoside diphosphate kinase; alpha/beta sandwich, ferredoxin fold, transferase; HET: PGE; 2.50A {Pyrobaculum aerophilum} SCOP: d.58.6.1 Length = 195 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query137
4hr2_A145 Nucleoside diphosphate kinase; ssgcid, seattle str 100.0
3ztp_A142 Nucleoside diphosphate kinase; transferase; HET: G 100.0
3fkb_A155 NDP kinase, NDK, nucleoside diphosphate kinase, cy 100.0
3evo_A146 NDP kinase, NDK, nucleoside diphosphate kinase; ph 100.0
3mpd_A151 Nucleoside diphosphate kinase; ssgcid, NIH, niaid, 100.0
3q8u_A157 Nucleoside diphosphate kinase; ferridoxin fold, al 100.0
4fkx_A161 NDK B, nucleoside diphosphate kinase; structural g 100.0
1wkj_A137 Nucleoside diphosphate kinase; thermus thermophilu 100.0
1k44_A136 Nucleoside diphosphate kinase; nucleoside triphosp 100.0
3l7u_A172 Nucleoside diphosphate kinase A; ATP-binding, nucl 100.0
1ehw_A162 NDPK H4, nucleoside diphosphate kinase; NM23, mito 100.0
1nhk_R144 Nucleoside diphosphate kinase; phosphotransferase; 100.0
2hur_A142 NDK, nucleoside diphosphate kinase, NDP kinase; ty 100.0
1pku_A150 Nucleoside diphosphate kinase I; RICE, transferase 100.0
1s57_A153 Nucleoside diphosphate kinase II; transferase; HET 100.0
2vu5_A148 Nucleoside diphosphate kinase; nucleotide-binding, 100.0
3r9l_A155 Nucleoside diphosphate kinase; structural genomics 100.0
1xiq_A157 Nucleoside diphosphate kinase B; protein structure 100.0
3b54_A161 NDK, NDP kinase, nucleoside diphosphate kinase; al 100.0
1u8w_A149 Nucleoside diphosphate kinase I; nucleotide diphos 100.0
3js9_A156 Nucleoside diphosphate kinase family protein; niai 100.0
2dxe_A160 Nucleoside diphosphate kinase; nucleoside binding, 100.0
3bbb_A151 Nucleoside diphosphate kinase B; transcription fac 100.0
1w7w_A182 Nucleoside diphosphate kinase; NDPK3, transferase; 100.0
2az3_A164 Nucleoside diphosphate kinase; halophilic, transfe 100.0
1zs6_A169 Nucleoside diphosphate kinase 3; nucleotide metabo 100.0
1nb2_A150 Nucleoside diphosphate kinase; bacillus halodenitr 100.0
4dz6_A190 Nucleoside diphosphate kinase; ssgcid, niaid, vana 100.0
1xqi_A195 Nucleoside diphosphate kinase; alpha/beta sandwich 100.0
3bh7_B352 Protein XRP2; protein-protein complex, GTPase acti 99.92
>4hr2_A Nucleoside diphosphate kinase; ssgcid, seattle structural genomics center for infectious DI niaid; HET: ADP; 1.95A {Burkholderia thailandensis} PDB: 4dut_A* 4ek2_A* Back     alignment and structure
Probab=100.00  E-value=3.2e-39  Score=235.49  Aligned_cols=107  Identities=40%  Similarity=0.661  Sum_probs=103.7

Q ss_pred             CcccceEEEEEEcCCccCCCchHHHHHHHHHcCCeEEEEEEeecCHHHHHhHHHHhcCCCcHHHHHHHhhcCCEEEEEEe
Q 032592           24 GSVEKEKTLAMIKPDGLSGNYTDEIKKVILESGFSILRERVVRLDEDGAKTFYAEHSSRSFFSSLIKYMTSGPVLAMVLE  103 (137)
Q Consensus        24 ~~~~~e~tlvlIKPda~~~~~~g~II~~i~~~Gf~I~~~k~~~ls~~~a~~~y~~~~~~~~~~~lv~~~~sGpvv~l~l~  103 (137)
                      ++...|+||+|||||+++++++|+||++|+++||+|+++||+++|+++|++||.+|++++||++|++||+||||++++|+
T Consensus         3 g~m~~ErTl~iIKPDav~~~l~g~Ii~rie~~Gf~I~~~k~~~lt~e~a~~fY~~h~~kpff~~Lv~~mtSGPvva~vle   82 (145)
T 4hr2_A            3 GSMALERTLSIIKPDAVAKNVIGQIYSRFENAGLKIVAARMAHLSRADAEKFYAVHAERPFFKDLVEFMISGPVMIQVLE   82 (145)
T ss_dssp             -CCCEEEEEEEECHHHHHTTCHHHHHHHHHHTTCEEEEEEEECCCHHHHHHHTGGGTTSTTHHHHHHHHTSSCEEEEEEE
T ss_pred             CcchHHHeEEEEChHHhhcCCHHHHHHHHHHCCCEEEEEeeecCCHHHHHHHHHHHhcCchHHHHHHHhcCCCEEEEEEE
Confidence            45678999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eccHHHHHHHHhCCCChhhhhhcCCCCccC
Q 032592          104 KENAITDWRALIGPTDAKKAKISHPHRLYV  133 (137)
Q Consensus       104 g~naV~~~r~l~Gp~dp~~A~~~~p~slRa  133 (137)
                      |+|||+.||+++|||||.+|+   |+||||
T Consensus        83 g~~aV~~~R~l~G~tdp~~A~---pgtIR~  109 (145)
T 4hr2_A           83 GEDAILKNRDLMGATDPKKAE---KGTIRA  109 (145)
T ss_dssp             EETHHHHHHHHHCCSSTTTSC---TTSHHH
T ss_pred             cCCcHhHHhhccCCCCcccCC---CCCcHH
Confidence            999999999999999999998   999997
>3ztp_A Nucleoside diphosphate kinase; transferase; HET: GOL; 1.37A {Aquifex aeolicus} PDB: 3zto_A* 3ztq_A 3ztr_A 3zts_A Back     alignment and structure
>3fkb_A NDP kinase, NDK, nucleoside diphosphate kinase, cytosolic; AN hexamer structure, ATP-binding, magnesium, metal- nucleotide metabolism; HET: TNM TNV; 1.65A {Dictyostelium discoideum} SCOP: d.58.6.1 PDB: 1b4s_A* 1mn9_A* 1f3f_A* 1hlw_A 1ndk_A 1pae_X 1f6t_A* 1bux_A* 1b99_A* 1hiy_A* 1kdn_A* 1ndc_A* 1ndp_A* 1nsp_A* 1s5z_A* 2bef_A* 1mn7_A* 1hhq_A 1lwx_A* 1npk_A ... Back     alignment and structure
>3evo_A NDP kinase, NDK, nucleoside diphosphate kinase; phosphotransferase nucleotide binding, ATP-binding, magnesium, metal-binding; HET: TYD; 1.50A {Acanthamoeba polyphaga mimivirus} SCOP: d.58.6.1 PDB: 3ejm_A* 3emt_A* 3em1_A* 3fc9_A* 3g2x_A* 3ena_A* 3dkd_A* 3ddi_A* 3etm_A* 3evm_A* 3fcv_A* 3b6b_A* 2b8p_A* 3gp9_A* 2b8q_A* 3ee3_A* 3elh_A* 3eic_A* 3evw_A* 3gpa_A* ... Back     alignment and structure
>3mpd_A Nucleoside diphosphate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, encepha cuniculi, structural genomics; 2.08A {Encephalitozoon cuniculi} SCOP: d.58.6.0 Back     alignment and structure
>3q8u_A Nucleoside diphosphate kinase; ferridoxin fold, alpha-beta protein family; HET: ADP; 2.22A {Staphylococcus aureus subsp} PDB: 3q83_A* 3q89_A* 3q86_A* 3q8v_A* 3q8y_A* Back     alignment and structure
>4fkx_A NDK B, nucleoside diphosphate kinase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: CDP; 1.70A {Trypanosoma brucei brucei} PDB: 4fky_A* 4f4a_A* 4f36_A* 3prv_A 3ngs_A 3ngr_A 3ngt_A* 3ngu_A* Back     alignment and structure
>1wkj_A Nucleoside diphosphate kinase; thermus thermophilus HB8, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.00A {Thermus thermophilus} SCOP: d.58.6.1 PDB: 1wkk_A* 1wkl_A* Back     alignment and structure
>1k44_A Nucleoside diphosphate kinase; nucleoside triphosphate, transferase; 2.60A {Mycobacterium tuberculosis} SCOP: d.58.6.1 Back     alignment and structure
>3l7u_A Nucleoside diphosphate kinase A; ATP-binding, nucleotide-binding, transferase, tumor suppressor; 2.10A {Homo sapiens} Back     alignment and structure
>1ehw_A NDPK H4, nucleoside diphosphate kinase; NM23, mitochondrial, killer-O transferase; 2.40A {Homo sapiens} SCOP: d.58.6.1 Back     alignment and structure
>1nhk_R Nucleoside diphosphate kinase; phosphotransferase; HET: CMP; 1.90A {Myxococcus xanthus} SCOP: d.58.6.1 PDB: 1nlk_R* 2nck_R 3pj9_A Back     alignment and structure
>2hur_A NDK, nucleoside diphosphate kinase, NDP kinase; type II tetramer, signaling protein,transferase; 1.62A {Escherichia coli} Back     alignment and structure
>1pku_A Nucleoside diphosphate kinase I; RICE, transferase; 2.50A {Oryza sativa} SCOP: d.58.6.1 Back     alignment and structure
>1s57_A Nucleoside diphosphate kinase II; transferase; HET: EPE; 1.80A {Arabidopsis thaliana} SCOP: d.58.6.1 PDB: 1s59_A* Back     alignment and structure
>2vu5_A Nucleoside diphosphate kinase; nucleotide-binding, ATP-binding, metal-binding, phosphoprotein, nucleotide metabolism, cytoplasm, magnesium; 2.0A {Bacillus anthracis} Back     alignment and structure
>3r9l_A Nucleoside diphosphate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, giardiasis; 2.65A {Giardia lamblia} SCOP: d.58.6.1 Back     alignment and structure
>1xiq_A Nucleoside diphosphate kinase B; protein structure initiative, structural genomics, SGPP; 3.05A {Plasmodium falciparum} SCOP: d.58.6.1 Back     alignment and structure
>3b54_A NDK, NDP kinase, nucleoside diphosphate kinase; alpha/beta sandwich, ATP-binding, magnesium, metal-B mitochondrion; 3.10A {Saccharomyces cerevisiae} Back     alignment and structure
>1u8w_A Nucleoside diphosphate kinase I; nucleotide diphosphate, transferase; 2.40A {Arabidopsis thaliana} SCOP: d.58.6.1 Back     alignment and structure
>3js9_A Nucleoside diphosphate kinase family protein; niaid, ssgcid, seattle structural genomics center for infect disease, babesiosis; 2.50A {Babesia bovis} SCOP: d.58.6.0 Back     alignment and structure
>2dxe_A Nucleoside diphosphate kinase; nucleoside binding, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: d.58.6.1 PDB: 2dxd_A* 2cwk_A* 2dxf_A* 2dy9_A* 2dya_A* Back     alignment and structure
>3bbb_A Nucleoside diphosphate kinase B; transcription factor, cancer, NM23 GEN, hexamer, activator, oncogene, ATP-binding, cell cycle, DNA-binding; HET: DG DA; 1.30A {Homo sapiens} SCOP: d.58.6.1 PDB: 1nue_A* 3bbf_A* 1nsk_R 3bbc_A 1be4_A* 1bhn_A* 2hvd_A* 1jxv_A* 2hve_A* 1ucn_A* 1nsq_A* 1ndl_A* Back     alignment and structure
>1w7w_A Nucleoside diphosphate kinase; NDPK3, transferase; 2.80A {Pisum sativum} SCOP: d.58.6.1 Back     alignment and structure
>2az3_A Nucleoside diphosphate kinase; halophilic, transferase; HET: CDP; 2.20A {Halobacterium salinarum} SCOP: d.58.6.1 PDB: 2az1_A 2zua_A Back     alignment and structure
>1zs6_A Nucleoside diphosphate kinase 3; nucleotide metabolism, apoptosis, transferase, struc genomics, structural genomics consortium, SGC; HET: ADP; 2.30A {Homo sapiens} SCOP: d.58.6.1 Back     alignment and structure
>1nb2_A Nucleoside diphosphate kinase; bacillus halodenitrifians, transferase; 2.20A {Virgibacillus halodenitrificans} SCOP: d.58.6.1 Back     alignment and structure
>4dz6_A Nucleoside diphosphate kinase; ssgcid, niaid, vanada transition state mimic, transition state analog, transferas; HET: ADP; 2.20A {Borrelia burgdorferi} PDB: 4di6_A* Back     alignment and structure
>1xqi_A Nucleoside diphosphate kinase; alpha/beta sandwich, ferredoxin fold, transferase; HET: PGE; 2.50A {Pyrobaculum aerophilum} SCOP: d.58.6.1 Back     alignment and structure
>3bh7_B Protein XRP2; protein-protein complex, GTPase activating protein and GTPase, retinitis pigmentosa, GTP-binding, lipoprotein, myristate; HET: GDP; 1.90A {Homo sapiens} PDB: 3bh6_B* 2bx6_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 137
d1zs6a1152 d.58.6.1 (A:18-169) Nucleoside diphosphate kinase, 7e-29
d3bbba1150 d.58.6.1 (A:2-151) Nucleoside diphosphate kinase, 1e-27
d1xqia1182 d.58.6.1 (A:14-195) Nucleoside diphosphate kinase, 1e-27
d2az3a1152 d.58.6.1 (A:4-155) Nucleoside diphosphate kinase, 4e-27
d1nhkl_143 d.58.6.1 (L:) Nucleoside diphosphate kinase, NDK { 8e-27
d1xiqa_149 d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK { 1e-26
d1hlwa_150 d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK { 2e-26
d1s57a_153 d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK { 7e-26
d1nb2a_149 d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK { 2e-25
d1w7wa_151 d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK { 3e-25
d1ehwa_143 d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK { 5e-25
d2dyaa1153 d.58.6.1 (A:6-158) Nucleoside diphosphate kinase, 6e-25
d1wkja1137 d.58.6.1 (A:1-137) Nucleoside diphosphate kinase, 1e-24
d1k44a_135 d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK { 1e-23
d1u8wa_149 d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK { 6e-22
d2b8qa1128 d.58.6.1 (A:2-129) Nucleoside diphosphate kinase, 3e-18
>d1zs6a1 d.58.6.1 (A:18-169) Nucleoside diphosphate kinase, NDK {Human(Homo sapiens), NDK3 [TaxId: 9606]} Length = 152 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: Nucleoside diphosphate kinase, NDK
family: Nucleoside diphosphate kinase, NDK
domain: Nucleoside diphosphate kinase, NDK
species: Human(Homo sapiens), NDK3 [TaxId: 9606]

 Score =  100 bits (251), Expect = 7e-29
 Identities = 35/98 (35%), Positives = 53/98 (54%)

Query: 27  EKEKTLAMIKPDGLSGNYTDEIKKVILESGFSILRERVVRLDEDGAKTFYAEHSSRSFFS 86
             E+T   +KPDG+      EI +     GF ++  ++V+  E+  +  YAE   R F+ 
Sbjct: 3   AHERTFLAVKPDGVQRRLVGEIVRRFERKGFKLVALKLVQASEELLREHYAELRERPFYG 62

Query: 87  SLIKYMTSGPVLAMVLEKENAITDWRALIGPTDAKKAK 124
            L+KYM SGPV+AMV +  + +   RALIG T+   A 
Sbjct: 63  RLVKYMASGPVVAMVWQGLDVVRTSRALIGATNPADAP 100
>d3bbba1 d.58.6.1 (A:2-151) Nucleoside diphosphate kinase, NDK {Human (Homo sapiens) [TaxId: 9606]} Length = 150 Back     information, alignment and structure
>d1xqia1 d.58.6.1 (A:14-195) Nucleoside diphosphate kinase, NDK {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 182 Back     information, alignment and structure
>d2az3a1 d.58.6.1 (A:4-155) Nucleoside diphosphate kinase, NDK {Archaeon Halobacterium salinarum [TaxId: 2242]} Length = 152 Back     information, alignment and structure
>d1nhkl_ d.58.6.1 (L:) Nucleoside diphosphate kinase, NDK {Myxococcus xanthus [TaxId: 34]} Length = 143 Back     information, alignment and structure
>d1xiqa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Length = 149 Back     information, alignment and structure
>d1hlwa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Dictyostelium discoideum [TaxId: 44689]} Length = 150 Back     information, alignment and structure
>d1s57a_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Thale cress (Arabidopsis thaliana), chloroplast NDK2 [TaxId: 3702]} Length = 153 Back     information, alignment and structure
>d1nb2a_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Bacillus halodenitrificans [TaxId: 1482]} Length = 149 Back     information, alignment and structure
>d1w7wa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Pea (Pisum sativum) [TaxId: 3888]} Length = 151 Back     information, alignment and structure
>d1ehwa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Human (Homo sapiens), NDK4 [TaxId: 9606]} Length = 143 Back     information, alignment and structure
>d2dyaa1 d.58.6.1 (A:6-158) Nucleoside diphosphate kinase, NDK {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 153 Back     information, alignment and structure
>d1wkja1 d.58.6.1 (A:1-137) Nucleoside diphosphate kinase, NDK {Thermus thermophilus [TaxId: 274]} Length = 137 Back     information, alignment and structure
>d1k44a_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Mycobacterium tuberculosis [TaxId: 1773]} Length = 135 Back     information, alignment and structure
>d1u8wa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 149 Back     information, alignment and structure
>d2b8qa1 d.58.6.1 (A:2-129) Nucleoside diphosphate kinase, NDK {Mimivirus [TaxId: 315393]} Length = 128 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query137
d1ehwa_143 Nucleoside diphosphate kinase, NDK {Human (Homo sa 100.0
d1zs6a1152 Nucleoside diphosphate kinase, NDK {Human(Homo sap 100.0
d3bbba1150 Nucleoside diphosphate kinase, NDK {Human (Homo sa 100.0
d1w7wa_151 Nucleoside diphosphate kinase, NDK {Pea (Pisum sat 100.0
d1k44a_135 Nucleoside diphosphate kinase, NDK {Mycobacterium 100.0
d1wkja1137 Nucleoside diphosphate kinase, NDK {Thermus thermo 100.0
d2az3a1152 Nucleoside diphosphate kinase, NDK {Archaeon Halob 100.0
d1nhkl_143 Nucleoside diphosphate kinase, NDK {Myxococcus xan 100.0
d1u8wa_149 Nucleoside diphosphate kinase, NDK {Thale cress (A 100.0
d1hlwa_150 Nucleoside diphosphate kinase, NDK {Dictyostelium 100.0
d1s57a_153 Nucleoside diphosphate kinase, NDK {Thale cress (A 100.0
d1xiqa_149 Nucleoside diphosphate kinase, NDK {Plasmodium fal 100.0
d2dyaa1153 Nucleoside diphosphate kinase, NDK {Archaeon Pyroc 100.0
d1nb2a_149 Nucleoside diphosphate kinase, NDK {Bacillus halod 100.0
d1xqia1182 Nucleoside diphosphate kinase, NDK {Archaeon Pyrob 100.0
d2b8qa1128 Nucleoside diphosphate kinase, NDK {Mimivirus [Tax 99.98
>d1ehwa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Human (Homo sapiens), NDK4 [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: Nucleoside diphosphate kinase, NDK
family: Nucleoside diphosphate kinase, NDK
domain: Nucleoside diphosphate kinase, NDK
species: Human (Homo sapiens), NDK4 [TaxId: 9606]

Probab=100.00  E-value=1.2e-37  Score=225.02  Aligned_cols=105  Identities=31%  Similarity=0.564  Sum_probs=102.2

Q ss_pred             cceEEEEEEcCCccCCCchHHHHHHHHHcCCeEEEEEEeecCHHHHHhHHHHhcCCCcHHHHHHHhhcCCEEEEEEeecc
Q 032592           27 EKEKTLAMIKPDGLSGNYTDEIKKVILESGFSILRERVVRLDEDGAKTFYAEHSSRSFFSSLIKYMTSGPVLAMVLEKEN  106 (137)
Q Consensus        27 ~~e~tlvlIKPda~~~~~~g~II~~i~~~Gf~I~~~k~~~ls~~~a~~~y~~~~~~~~~~~lv~~~~sGpvv~l~l~g~n  106 (137)
                      .+|+||+|||||++.++++|+||++|+++||+|+++|++++|+++|++||.+|++++||++++++|+||||++|+|.|+|
T Consensus         4 ~~E~Tl~iIKPDav~~~~~g~Ii~~i~~~Gf~Iv~~k~~~lt~e~a~~~Y~~~~~k~f~~~lv~~m~sGp~~a~~l~g~n   83 (143)
T d1ehwa_           4 TRERTLVAVKPDGVQRRLVGDVIQRFERRGFTLVGMKMLQAPESVLAEHYQDLRRKPFYPALIRYMSSGPVVAMVWEGYN   83 (143)
T ss_dssp             GGCEEEEEECHHHHHTTCHHHHHHHHHHTTCEEEEEEEECCCHHHHHHHTGGGTTSTTHHHHHHHHTSSCEEEEEEESTT
T ss_pred             ccceEEEEECchhhhcCCHHHHHHHHHHcCCEEeeeeeeecCHHHHHHHHHHHhcchhhhhhhheecCCCEEEEecchhh
Confidence            46999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHhCCCChhhhhhcCCCCccCC
Q 032592          107 AITDWRALIGPTDAKKAKISHPHRLYVL  134 (137)
Q Consensus       107 aV~~~r~l~Gp~dp~~A~~~~p~slRa~  134 (137)
                      ||+.||+++|||||.+|+   |+||||.
T Consensus        84 aV~~~R~l~Gpt~p~~a~---p~siR~~  108 (143)
T d1ehwa_          84 VVRASRAMIGHTDSAEAA---PGTIRGD  108 (143)
T ss_dssp             HHHHHHHHHCCSSGGGSC---TTSHHHH
T ss_pred             HHHHHHHHhcCCCcccCC---CCCcHhh
Confidence            999999999999999997   9999984
>d1zs6a1 d.58.6.1 (A:18-169) Nucleoside diphosphate kinase, NDK {Human(Homo sapiens), NDK3 [TaxId: 9606]} Back     information, alignment and structure
>d3bbba1 d.58.6.1 (A:2-151) Nucleoside diphosphate kinase, NDK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w7wa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1k44a_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1wkja1 d.58.6.1 (A:1-137) Nucleoside diphosphate kinase, NDK {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2az3a1 d.58.6.1 (A:4-155) Nucleoside diphosphate kinase, NDK {Archaeon Halobacterium salinarum [TaxId: 2242]} Back     information, alignment and structure
>d1nhkl_ d.58.6.1 (L:) Nucleoside diphosphate kinase, NDK {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1u8wa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1hlwa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1s57a_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Thale cress (Arabidopsis thaliana), chloroplast NDK2 [TaxId: 3702]} Back     information, alignment and structure
>d1xiqa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d2dyaa1 d.58.6.1 (A:6-158) Nucleoside diphosphate kinase, NDK {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1nb2a_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Bacillus halodenitrificans [TaxId: 1482]} Back     information, alignment and structure
>d1xqia1 d.58.6.1 (A:14-195) Nucleoside diphosphate kinase, NDK {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d2b8qa1 d.58.6.1 (A:2-129) Nucleoside diphosphate kinase, NDK {Mimivirus [TaxId: 315393]} Back     information, alignment and structure