Citrus Sinensis ID: 032726

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-----
MAPKSFLLACLLAFTLQFFFSPPVSSSASLLSTSKESSSMKDLIKLGEGCVSHPEDVSVVVRKGALYTATNDGWVKYFILHNETLVNWKHIDSQSLLGLTTTKEGDVVICDSKKVRQHTNSQALIIVCVCVYSEK
ccccHHHHHHHHHHHHHHHccccccccccccccccccccccccEEEcccccccccEEEEEccccEEEEEcccccEEEEEcccccEEEEEcccccccccEEEcccccEEEEEccccEEEEccccEEEEEEEEEccc
cccHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHccccccccccEEEEccccEEEEEccccHHHHHEcccccccccEEcccccEEEEEEcccccEEEEEccHcEEcccccEEEEEEEEEcccc
MAPKSFLLACLLAFTLqfffsppvsssasllstskessSMKDLIKlgegcvshpedvsvVVRKGALYTATNDGWVKYFILHNETlvnwkhidsqsllgltttkegdvvicdskkvrqhtnsQALIIVCVCVYSEK
MAPKSFLLACLLAFTLQFFFSPPVSSSASLLSTSKESSSMKDLIKLGEGCVSHPEDVSVVVRKGALYTATNDGWVKYFILHNETLVNWKHIDSQSLLGLTTTKEGDVVICDskkvrqhtnsqaliIVCVCVYSEK
MAPKSFLLACLLAFTLQFFFsppvsssasllstskesssMKDLIKLGEGCVSHPEDVSVVVRKGALYTATNDGWVKYFILHNETLVNWKHIDSQSLLGLTTTKEGDVVICDSKKVRQHTNSQALIIVCVCVYSEK
*****FLLACLLAFTLQFFFS*********************LIKLGEGCVSHPEDVSVVVRKGALYTATNDGWVKYFILHNETLVNWKHIDSQSLLGLTTTKEGDVVICDSKKVRQHTNSQALIIVCVCVY***
***KSFLLACLLAFTLQFFFSPPVSSSASLLSTS***SSMKDLIKLGEGCVSHPEDVSVVVRKGALYTATNDGWVKYFILHNETLVNWKHIDSQSLLGLTTTKEGDVVICDSKKVRQHTNSQALIIVCVCV****
MAPKSFLLACLLAFTLQFFFSPP*****************KDLIKLGEGCVSHPEDVSVVVRKGALYTATNDGWVKYFILHNETLVNWKHIDSQSLLGLTTTKEGDVVICDSKKVRQHTNSQALIIVCVCVYSEK
*APKSFLLACLLAFTLQFFFSPPVSSSASLLSTSKESSSMKDLIKLGEGCVSHPEDVSVVVRKGALYTATNDGWVKYFILHNETLVNWKHIDSQSLLGLTTTKEGDVVICDSKKVRQHTNSQALIIVCVCVYS**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAPKSFLLACLLAFTLQFFFSPPVSSSASLLSTSKESSSMKDLIKLGEGCVSHPEDVSVVVRKGALYTATNDGWVKYFILHNETLVNWKHIDSQSLLGLTTTKEGDVVICDSKKVRQHTNSQALIIVCVCVYSEK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query135
357450077 352 Adipocyte plasma membrane-associated pro 0.785 0.301 0.495 5e-21
388507342 352 unknown [Medicago truncatula] 0.785 0.301 0.495 5e-21
388492006 352 unknown [Medicago truncatula] 0.785 0.301 0.486 8e-21
224068478145 predicted protein [Populus trichocarpa] 0.881 0.820 0.449 1e-20
357450079 372 Adipocyte plasma membrane-associated pro 0.8 0.290 0.474 1e-18
388499476 372 unknown [Medicago truncatula] 0.8 0.290 0.474 1e-18
357450071 360 Adipocyte plasma membrane-associated pro 0.8 0.3 0.482 3e-18
356530439 358 PREDICTED: adipocyte plasma membrane-ass 0.703 0.265 0.464 5e-17
255634837211 unknown [Glycine max] 0.703 0.450 0.464 5e-17
388511010 369 unknown [Lotus japonicus] 0.792 0.289 0.424 4e-16
>gi|357450077|ref|XP_003595315.1| Adipocyte plasma membrane-associated protein [Medicago truncatula] gi|355484363|gb|AES65566.1| Adipocyte plasma membrane-associated protein [Medicago truncatula] Back     alignment and taxonomy information
 Score =  105 bits (263), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 55/111 (49%), Positives = 77/111 (69%), Gaps = 5/111 (4%)

Query: 5   SFLLACLLAFTLQ-FFFSP--PVSSSASLLSTSKESSSMKDLIKLGEGCVSHPEDVSVVV 61
           S +LA L+A T+Q F+FSP  PVS       +S +++ ++ +IKLGEG +  PEDV  V 
Sbjct: 6   SLVLAALVALTVQVFYFSPIDPVSLEIPFSVSSTKNNQLQSVIKLGEGFLKQPEDV-CVD 64

Query: 62  RKGALYTATNDGWVKYFILHNETLVNWKHIDSQSLLGLTTTKEGDVVICDS 112
           + G LYTAT DGW+K  +  NE   NWKHIDS SLLG+TT+K+G +++CD+
Sbjct: 65  KDGVLYTATRDGWIKRMV-RNENWENWKHIDSSSLLGITTSKDGGLIVCDT 114

Source: Medicago truncatula

Species: Medicago truncatula

Genus: Medicago

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|388507342|gb|AFK41737.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|388492006|gb|AFK34069.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|224068478|ref|XP_002326130.1| predicted protein [Populus trichocarpa] gi|222833323|gb|EEE71800.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357450079|ref|XP_003595316.1| Adipocyte plasma membrane-associated protein [Medicago truncatula] gi|355484364|gb|AES65567.1| Adipocyte plasma membrane-associated protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|388499476|gb|AFK37804.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|357450071|ref|XP_003595312.1| Adipocyte plasma membrane-associated protein [Medicago truncatula] gi|355484360|gb|AES65563.1| Adipocyte plasma membrane-associated protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|356530439|ref|XP_003533788.1| PREDICTED: adipocyte plasma membrane-associated protein-like [Glycine max] Back     alignment and taxonomy information
>gi|255634837|gb|ACU17778.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|388511010|gb|AFK43571.1| unknown [Lotus japonicus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query135
TAIR|locus:2081830 370 SSL4 "strictosidine synthase-l 0.503 0.183 0.301 7.9e-05
TAIR|locus:2081845 371 YLS2 "YELLOW-LEAF-SPECIFIC GEN 0.503 0.183 0.301 0.00036
TAIR|locus:2081830 SSL4 "strictosidine synthase-like 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 102 (41.0 bits), Expect = 7.9e-05, P = 7.9e-05
 Identities = 22/73 (30%), Positives = 41/73 (56%)

Query:    46 LGEGCVSHPEDVSVVVRKGALYTATNDGWVKYFILH---NETLV-NWKHIDSQSLLGLTT 101
             +G G +++PED++       +YT   DGWVK   +H   N+++V +W +   + L G+  
Sbjct:    62 IGVGLLNNPEDIAYHKDSNLIYTGCVDGWVKRVSVHDSANDSIVEDWVNTGGRPL-GIAF 120

Query:   102 TKEGDVVICDSKK 114
                G+V++ D+ K
Sbjct:   121 GLHGEVIVADANK 133
GO:0009058 "biosynthetic process" evidence=IEA
GO:0009507 "chloroplast" evidence=ISM
GO:0009821 "alkaloid biosynthetic process" evidence=ISS
GO:0016844 "strictosidine synthase activity" evidence=IEA;ISS;TAS
GO:0009902 "chloroplast relocation" evidence=RCA
GO:0009965 "leaf morphogenesis" evidence=RCA
GO:0010155 "regulation of proton transport" evidence=RCA
GO:0030154 "cell differentiation" evidence=RCA
GO:0045893 "positive regulation of transcription, DNA-dependent" evidence=RCA
GO:0046777 "protein autophosphorylation" evidence=RCA
TAIR|locus:2081845 YLS2 "YELLOW-LEAF-SPECIFIC GENE 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 135
KOG1520 376 consensus Predicted alkaloid synthase/Surface muci 99.77
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 98.1
PF08450 246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 98.07
TIGR02604 367 Piru_Ver_Nterm putative membrane-bound dehydrogena 98.0
COG3386 307 Gluconolactonase [Carbohydrate transport and metab 97.52
TIGR02604 367 Piru_Ver_Nterm putative membrane-bound dehydrogena 97.38
COG4257 353 Vgb Streptogramin lyase [Defense mechanisms] 97.34
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 97.3
COG3386307 Gluconolactonase [Carbohydrate transport and metab 97.27
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 97.23
PF0308889 Str_synth: Strictosidine synthase; InterPro: IPR01 96.76
COG3391 381 Uncharacterized conserved protein [Function unknow 96.68
PF0143628 NHL: NHL repeat; InterPro: IPR001258 The NHL repea 96.44
TIGR03300 377 assembly_YfgL outer membrane assembly lipoprotein 95.9
TIGR03606 454 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH 95.66
PF05787524 DUF839: Bacterial protein of unknown function (DUF 95.33
PF02239 369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 95.17
KOG1520 376 consensus Predicted alkaloid synthase/Surface muci 95.09
PF14517229 Tachylectin: Tachylectin; PDB: 1TL2_A. 94.91
PRK11028 330 6-phosphogluconolactonase; Provisional 94.89
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 94.86
PF07995 331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 94.7
PRK11028330 6-phosphogluconolactonase; Provisional 94.32
COG4257 353 Vgb Streptogramin lyase [Defense mechanisms] 94.21
PF13360 238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 94.16
PF07995331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 93.94
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 93.85
COG3391 381 Uncharacterized conserved protein [Function unknow 93.69
TIGR03866 300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 93.55
COG3211616 PhoX Predicted phosphatase [General function predi 93.44
TIGR03606 454 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH 93.32
KOG4659 1899 consensus Uncharacterized conserved protein (Rhs f 92.76
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 92.67
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 91.96
PF0173186 Arylesterase: Arylesterase; InterPro: IPR002640 Th 91.35
PF13449 326 Phytase-like: Esterase-like activity of phytase 90.55
COG2133399 Glucose/sorbosone dehydrogenases [Carbohydrate tra 90.44
PF10282 345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 90.24
TIGR0227642 beta_rpt_yvtn 40-residue YVTN family beta-propelle 89.87
PF14517229 Tachylectin: Tachylectin; PDB: 1TL2_A. 89.84
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 89.76
cd00200 289 WD40 WD40 domain, found in a number of eukaryotic 89.1
smart0056433 PQQ beta-propeller repeat. Beta-propeller repeat o 89.05
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 88.46
PF0143628 NHL: NHL repeat; InterPro: IPR001258 The NHL repea 88.45
TIGR03032335 conserved hypothetical protein TIGR03032. This pro 88.14
COG1520 370 FOG: WD40-like repeat [Function unknown] 87.44
TIGR03300 377 assembly_YfgL outer membrane assembly lipoprotein 87.03
KOG0266 456 consensus WD40 repeat-containing protein [General 86.84
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 85.65
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 85.58
KOG0318 603 consensus WD40 repeat stress protein/actin interac 84.92
PRK11138 394 outer membrane biogenesis protein BamB; Provisiona 84.2
KOG0296 399 consensus Angio-associated migratory cell protein 83.25
PF1357040 PQQ_3: PQQ-like domain; PDB: 3HXJ_B 3Q54_A. 83.09
PF02333381 Phytase: Phytase; InterPro: IPR003431 Phytase (3.1 82.16
PF0673938 SBBP: Beta-propeller repeat; InterPro: IPR010620 T 82.11
COG2706 346 3-carboxymuconate cyclase [Carbohydrate transport 81.1
PTZ00421 493 coronin; Provisional 81.07
COG2133 399 Glucose/sorbosone dehydrogenases [Carbohydrate tra 80.87
>KOG1520 consensus Predicted alkaloid synthase/Surface mucin Hemomucin [General function prediction only] Back     alignment and domain information 
Probab=99.77  E-value=2.8e-18  Score=147.06  Aligned_cols=93  Identities=17%  Similarity=0.187  Sum_probs=65.8

Q ss_pred             CCcccccceEeccCCcCCCceeeeeeCCCcEEEEecCcEEEEEEcCCC----c-----eeEEeeecCCCCCceeECCCC-
Q 032726           36 ESSSMKDLIKLGEGCVSHPEDVSVVVRKGALYTATNDGWVKYFILHNE----T-----LVNWKHIDSQSLLGLTTTKEG-  105 (135)
Q Consensus        36 ~N~~L~~~e~l~~g~~~GPEdi~avd~~G~lYTg~~dG~I~ri~~~~~----~-----~~~~~~t~GRPpLGl~fd~~G-  105 (135)
                      +|+.+..+|.+..+...+||.+.+.|.+--+|||..+|||.+....+.    .     ...-++.|||| |||+|+++| 
T Consensus        49 ~~~~~~g~E~~~fd~~~~gp~~~v~dg~il~~~g~~~Gwv~~~~~~~s~~~~~~~~~~~~~~e~~CGRP-LGl~f~~~gg  127 (376)
T KOG1520|consen   49 PNNHLTGPESLLFDPQGGGPYTGVVDGRILKYTGNDDGWVKFADTKDSTNRSQCCDPGSFETEPLCGRP-LGIRFDKKGG  127 (376)
T ss_pred             cccccCChhhheecccCCCceEEEECCceEEEeccCceEEEEEeccccccccccCCCcceecccccCCc-ceEEeccCCC
Confidence            566677777776665554444413332223888888888888754111    1     22346899999 999999776 


Q ss_pred             CEEEEeCCCceEEeCCCCeEEEEE
Q 032726          106 DVVICDSKKVRQHTNSQALIIVCV  129 (135)
Q Consensus       106 ~LiVaDa~~GLl~V~~~G~v~vl~  129 (135)
                      +|||||||+||++|+++|....+.
T Consensus       128 dL~VaDAYlGL~~V~p~g~~a~~l  151 (376)
T KOG1520|consen  128 DLYVADAYLGLLKVGPEGGLAELL  151 (376)
T ss_pred             eEEEEecceeeEEECCCCCcceec
Confidence            999999999999999987765543

>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PF03088 Str_synth: Strictosidine synthase; InterPro: IPR018119 This entry represents a conserved region found in strictosidine synthase (4 Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF01436 NHL: NHL repeat; InterPro: IPR001258 The NHL repeat, named after NCL-1, HT2A and Lin-41, is found largely in a large number of eukaryotic and prokaryotic proteins Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>TIGR03606 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH family Back     alignment and domain information
>PF05787 DUF839: Bacterial protein of unknown function (DUF839); InterPro: IPR008557 This family consists of bacterial proteins of unknown function Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG1520 consensus Predicted alkaloid synthase/Surface mucin Hemomucin [General function prediction only] Back     alignment and domain information
>PF14517 Tachylectin: Tachylectin; PDB: 1TL2_A Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>COG3211 PhoX Predicted phosphatase [General function prediction only] Back     alignment and domain information
>TIGR03606 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH family Back     alignment and domain information
>KOG4659 consensus Uncharacterized conserved protein (Rhs family) [Function unknown] Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>PF01731 Arylesterase: Arylesterase; InterPro: IPR002640 The serum paraoxonases/arylesterases are enzymes that catalyse the hydrolysis of the toxic metabolites of a variety of organophosphorus insecticides Back     alignment and domain information
>PF13449 Phytase-like: Esterase-like activity of phytase Back     alignment and domain information
>COG2133 Glucose/sorbosone dehydrogenases [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>TIGR02276 beta_rpt_yvtn 40-residue YVTN family beta-propeller repeat Back     alignment and domain information
>PF14517 Tachylectin: Tachylectin; PDB: 1TL2_A Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>smart00564 PQQ beta-propeller repeat Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>PF01436 NHL: NHL repeat; InterPro: IPR001258 The NHL repeat, named after NCL-1, HT2A and Lin-41, is found largely in a large number of eukaryotic and prokaryotic proteins Back     alignment and domain information
>TIGR03032 conserved hypothetical protein TIGR03032 Back     alignment and domain information
>COG1520 FOG: WD40-like repeat [Function unknown] Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>PF13570 PQQ_3: PQQ-like domain; PDB: 3HXJ_B 3Q54_A Back     alignment and domain information
>PF02333 Phytase: Phytase; InterPro: IPR003431 Phytase (3 Back     alignment and domain information
>PF06739 SBBP: Beta-propeller repeat; InterPro: IPR010620 This family is related to IPR001680 from INTERPRO and is likely to also form a beta-propeller Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>COG2133 Glucose/sorbosone dehydrogenases [Carbohydrate transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query135
2fp8_A 322 Strictosidine synthase; six bladed beta propeller 3e-05
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Length = 322 Back     alignment and structure
 Score = 40.8 bits (95), Expect = 3e-05
 Identities = 12/89 (13%), Positives = 22/89 (24%), Gaps = 20/89 (22%)

Query: 45  KLGEGCVSHPEDVSVVVRKGALYTATNDGWVKYFILHNETLVNWKHIDSQSL-------- 96
            L E     P   +        YT+  DG V  +   N   V++ +              
Sbjct: 12  ILIEAPSYAPNSFTFDSTNKGFYTSVQDGRVIKYEGPNSGFVDFAYASPYWNKAFCENST 71

Query: 97  -----------LGLT-TTKEGDVVICDSK 113
                        ++   +   + I D  
Sbjct: 72  DAEKRPLCGRTYDISYNLQNNQLYIVDCY 100

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query135
3sre_A 355 PON1, serum paraoxonase; directed evolution, 6-bla 99.3
2fp8_A 322 Strictosidine synthase; six bladed beta propeller 99.26
1pjx_A 314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 98.84
2p4o_A 306 Hypothetical protein; putative lactonase, structur 98.84
3dr2_A 305 Exported gluconolactonase; gluconolactonase SMP-30 98.72
3e5z_A 296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 98.71
1rwi_B 270 Serine/threonine-protein kinase PKND; beta propell 98.49
3a9g_A 354 Putative uncharacterized protein; PQQ dependent de 98.45
2ism_A 352 Putative oxidoreductase; BL41XU spring-8, bladed b 98.4
3fvz_A 329 Peptidyl-glycine alpha-amidating monooxygenase; be 98.37
2dg1_A 333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 98.35
2z2n_A 299 Virginiamycin B lyase; seven-bladed beta-propeller 98.33
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 98.27
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 98.26
1rwi_B 270 Serine/threonine-protein kinase PKND; beta propell 98.26
2qc5_A 300 Streptogramin B lactonase; beta propeller, lyase; 98.23
2qc5_A 300 Streptogramin B lactonase; beta propeller, lyase; 98.22
4hw6_A 433 Hypothetical protein, IPT/TIG domain protein; puta 98.21
3e5z_A 296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 98.19
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 98.19
2z2n_A 299 Virginiamycin B lyase; seven-bladed beta-propeller 98.18
1q7f_A 286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 98.16
2fp8_A322 Strictosidine synthase; six bladed beta propeller 98.14
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 98.07
1pjx_A 314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 98.02
2qe8_A 343 Uncharacterized protein; structural genomics, join 98.01
3hfq_A 347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 97.99
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 97.98
3tc9_A 430 Hypothetical hydrolase; 6-bladed beta-propeller, i 97.97
2ism_A 352 Putative oxidoreductase; BL41XU spring-8, bladed b 97.94
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 97.92
3a9g_A 354 Putative uncharacterized protein; PQQ dependent de 97.92
3v64_C 349 Agrin; beta propeller, laminin-G, signaling, prote 97.89
1ijq_A 316 LDL receptor, low-density lipoprotein receptor; be 97.88
3g4e_A 297 Regucalcin; six bladed beta-propeller, gluconolcat 97.85
3v65_B386 Low-density lipoprotein receptor-related protein; 97.83
3tc9_A 430 Hypothetical hydrolase; 6-bladed beta-propeller, i 97.83
3das_A 347 Putative oxidoreductase; aldose sugar dehydrogenas 97.78
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 97.77
2dg1_A 333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 97.76
2qe8_A343 Uncharacterized protein; structural genomics, join 97.73
1ijq_A 316 LDL receptor, low-density lipoprotein receptor; be 97.7
3dsm_A 328 Uncharacterized protein bacuni_02894; seven_blated 97.69
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 97.69
3g4e_A 297 Regucalcin; six bladed beta-propeller, gluconolcat 97.68
1tl2_A 236 L10, protein (tachylectin-2); animal lectin, horse 97.67
3sov_A 318 LRP-6, low-density lipoprotein receptor-related pr 97.67
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 97.66
2g8s_A 353 Glucose/sorbosone dehydrogenases; bladed beta-prop 97.66
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 97.63
4hw6_A 433 Hypothetical protein, IPT/TIG domain protein; puta 97.59
1cru_A 454 Protein (soluble quinoprotein glucose dehydrogena; 97.58
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 97.56
3dsm_A 328 Uncharacterized protein bacuni_02894; seven_blated 97.55
1cru_A 454 Protein (soluble quinoprotein glucose dehydrogena; 97.54
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 97.53
3das_A 347 Putative oxidoreductase; aldose sugar dehydrogenas 97.53
2g8s_A 353 Glucose/sorbosone dehydrogenases; bladed beta-prop 97.52
2ghs_A 326 AGR_C_1268P; regucalcin, structural genomics, join 97.48
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 97.48
3v64_C 349 Agrin; beta propeller, laminin-G, signaling, prote 97.48
3s94_A 619 LRP-6, low-density lipoprotein receptor-related pr 97.47
3v65_B 386 Low-density lipoprotein receptor-related protein; 97.46
2p9w_A 334 MAL S 1 allergenic protein; beta propeller; 1.35A 97.37
2p9w_A 334 MAL S 1 allergenic protein; beta propeller; 1.35A 97.35
3vgz_A 353 Uncharacterized protein YNCE; beta-propeller, prot 97.35
2ghs_A 326 AGR_C_1268P; regucalcin, structural genomics, join 97.34
3sov_A 318 LRP-6, low-density lipoprotein receptor-related pr 97.33
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 97.31
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 97.27
3hxj_A 330 Pyrrolo-quinoline quinone; all beta protein. incom 97.24
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 97.21
3vgz_A 353 Uncharacterized protein YNCE; beta-propeller, prot 97.19
4a9v_A592 PHOX; hydrolase, beta-propeller; 1.10A {Pseudomona 97.18
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 97.17
2p4o_A306 Hypothetical protein; putative lactonase, structur 97.13
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 97.02
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 96.98
3u4y_A 331 Uncharacterized protein; structural genomics, PSI- 96.93
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 96.92
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 96.87
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 96.86
1ri6_A 343 Putative isomerase YBHE; 7-bladed propeller, enzym 96.84
1pby_B 337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 96.81
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 96.78
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 96.67
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 96.66
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 96.59
1pby_B 337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 96.59
1jmx_B 349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 96.32
1jof_A 365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 96.18
3kya_A 496 Putative phosphatase; structural genomics, joint c 96.08
3kya_A 496 Putative phosphatase; structural genomics, joint c 96.03
3v9f_A 781 Two-component system sensor histidine kinase/RESP 95.93
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 95.77
3c75_H 426 MADH, methylamine dehydrogenase heavy chain; coppe 95.66
4a2l_A 795 BT_4663, two-component system sensor histidine kin 95.61
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 95.6
1qks_A 567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 95.57
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 95.56
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 95.5
4a9v_A592 PHOX; hydrolase, beta-propeller; 1.10A {Pseudomona 95.34
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 95.34
3zwu_A592 Alkaline phosphatase PHOX; hydrolase, beta-propell 95.33
1mda_H 368 Methylamine dehydrogenase (heavy subunit); electro 95.26
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 95.24
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 95.2
1jof_A 365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 95.19
4a2l_A 795 BT_4663, two-component system sensor histidine kin 95.12
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 95.09
3v9f_A 781 Two-component system sensor histidine kinase/RESP 95.06
3sjl_D 386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 95.06
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 94.84
2iwa_A 266 Glutamine cyclotransferase; pyroglutamate, acyltra 94.79
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 94.76
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 94.34
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 94.3
2mad_H 373 Methylamine dehydrogenase (heavy subunit); oxidore 94.27
1nir_A 543 Nitrite reductase; hemoprotein, denitrification, d 94.26
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 93.79
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 93.72
2iwa_A 266 Glutamine cyclotransferase; pyroglutamate, acyltra 93.72
3q7m_A 376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 93.47
4h5i_A 365 Guanine nucleotide-exchange factor SEC12; copii ve 93.42
3zwl_B 369 Eukaryotic translation initiation factor 3 subuni; 93.38
2pbi_B 354 Guanine nucleotide-binding protein subunit beta 5; 93.24
1got_B 340 GT-beta; complex (GTP-binding/transducer), G prote 93.07
4ery_A 312 WD repeat-containing protein 5; WD40, WIN motif, b 93.03
3qqz_A 255 Putative uncharacterized protein YJIK; MCSG, PSI-2 93.02
3odt_A 313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 92.98
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 92.95
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 92.94
3zwl_B 369 Eukaryotic translation initiation factor 3 subuni; 92.9
2wg3_C 463 Hedgehog-interacting protein; lipoprotein, develop 92.86
3ott_A 758 Two-component system sensor histidine kinase; beta 92.8
2ojh_A 297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 92.76
3iz6_a 380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 92.71
2ymu_A 577 WD-40 repeat protein; unknown function, two domain 92.67
3b7f_A 394 Glycosyl hydrolase, BNR repeat; 7-bladed beta-prop 92.47
3ow8_A 321 WD repeat-containing protein 61; structural genomi 92.46
3b7f_A 394 Glycosyl hydrolase, BNR repeat; 7-bladed beta-prop 92.45
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 92.4
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 92.39
3ow8_A321 WD repeat-containing protein 61; structural genomi 92.37
3mmy_A 368 MRNA export factor; mRNA export, nuclear protein; 92.35
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 92.26
1k8k_C 372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 92.24
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 92.02
3ott_A 758 Two-component system sensor histidine kinase; beta 92.01
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 92.0
2ynn_A 304 Coatomer subunit beta'; protein transport, peptide 91.91
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 91.8
3amr_A 355 3-phytase; beta-propeller, phytate, MYO-inositol h 91.76
2ojh_A 297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 91.73
1r5m_A 425 SIR4-interacting protein SIF2; transcription corep 91.56
4ery_A 312 WD repeat-containing protein 5; WD40, WIN motif, b 91.54
2ymu_A577 WD-40 repeat protein; unknown function, two domain 91.54
1yfq_A 342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 91.51
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 91.43
1sq9_A 397 Antiviral protein SKI8; WD repeat, beta-transducin 91.35
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 91.28
4gqb_B 344 Methylosome protein 50; TIM barrel, beta-propeller 91.26
2xzm_R 343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 91.22
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 91.21
3vl1_A 420 26S proteasome regulatory subunit RPN14; beta-prop 90.91
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 90.86
2aq5_A 402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 90.75
3f3f_A 351 Nucleoporin SEH1; structural protein, protein comp 90.64
1yfq_A 342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 90.61
3ei3_B 383 DNA damage-binding protein 2; UV-damage, DDB, nucl 90.53
3frx_A 319 Guanine nucleotide-binding protein subunit beta- l 90.52
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 90.49
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 90.46
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 90.34
2hz6_A 369 Endoplasmic reticulum to nucleus signalling 1 isof 90.29
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 90.15
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 90.13
3k26_A 366 Polycomb protein EED; WD40, structural genomics, N 90.06
1got_B 340 GT-beta; complex (GTP-binding/transducer), G prote 89.94
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 89.89
3pe7_A 388 Oligogalacturonate lyase; seven-bladed beta-propel 89.89
2be1_A 339 Serine/threonine-protein kinase/endoribonuclease; 89.79
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 89.77
1erj_A 393 Transcriptional repressor TUP1; beta-propeller, tr 89.56
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 89.54
3mmy_A 368 MRNA export factor; mRNA export, nuclear protein; 89.51
2aq5_A 402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 89.43
2hqs_A 415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 89.22
2hqs_A 415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 88.99
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 88.95
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 88.87
4a11_B 408 DNA excision repair protein ERCC-8; DNA binding pr 88.6
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 88.59
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 88.59
1erj_A 393 Transcriptional repressor TUP1; beta-propeller, tr 88.52
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 88.33
4g56_B 357 MGC81050 protein; protein arginine methyltransfera 88.26
3k26_A 366 Polycomb protein EED; WD40, structural genomics, N 88.15
3dw8_B 447 Serine/threonine-protein phosphatase 2A 55 kDa RE 88.13
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 88.12
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 88.07
3i2n_A 357 WD repeat-containing protein 92; WD40 repeats, str 87.93
4aow_A 340 Guanine nucleotide-binding protein subunit beta-2; 87.92
2ece_A462 462AA long hypothetical selenium-binding protein; 87.75
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 87.69
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 87.53
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 87.23
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 87.21
3fm0_A 345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 87.08
2vdu_B 450 TRNA (guanine-N(7)-)-methyltransferase- associated 86.84
1vyh_C 410 Platelet-activating factor acetylhydrolase IB alph 86.46
3dwl_C 377 Actin-related protein 2/3 complex subunit 1; prope 86.39
4g56_B357 MGC81050 protein; protein arginine methyltransfera 86.21
1nir_A 543 Nitrite reductase; hemoprotein, denitrification, d 86.11
2hes_X 330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 85.97
3jrp_A379 Fusion protein of protein transport protein SEC13 85.76
3lrv_A 343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 85.58
2ynn_A 304 Coatomer subunit beta'; protein transport, peptide 85.58
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 85.38
2hes_X 330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 85.26
1k32_A 1045 Tricorn protease; protein degradation, substrate g 84.9
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 84.88
3fm0_A 345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 84.8
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 84.77
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 84.56
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 84.51
2xbg_A 327 YCF48-like protein; photosynthesis, photosystem II 84.44
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 84.37
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 84.23
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 84.0
2pm9_A 416 Protein WEB1, protein transport protein SEC31; bet 83.63
3dm0_A 694 Maltose-binding periplasmic protein fused with RAC 83.61
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 83.38
4a11_B 408 DNA excision repair protein ERCC-8; DNA binding pr 83.32
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 83.17
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 83.17
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 82.85
2vdu_B 450 TRNA (guanine-N(7)-)-methyltransferase- associated 82.78
2ece_A462 462AA long hypothetical selenium-binding protein; 82.76
4e54_B 435 DNA damage-binding protein 2; beta barrel, double 82.75
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 82.65
1qks_A 567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 82.63
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 82.61
1fwx_A 595 Nitrous oxide reductase; beta-propeller domain, cu 82.41
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 82.09
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 82.05
2pm7_B 297 Protein transport protein SEC13, protein transport 81.8
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 80.93
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 80.73
3pe7_A 388 Oligogalacturonate lyase; seven-bladed beta-propel 80.67
2xyi_A430 Probable histone-binding protein CAF1; transcripti 80.58
4aez_A 401 CDC20, WD repeat-containing protein SLP1; cell cyc 80.52
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 80.41
3gre_A 437 Serine/threonine-protein kinase VPS15; seven-blade 80.31
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 80.27
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
Probab=99.30  E-value=8.6e-12  Score=104.35  Aligned_cols=92  Identities=10%  Similarity=0.165  Sum_probs=71.5

Q ss_pred             ccccceEeccCCcCCCceeeeeeCCCcEEEEe-------------cCcEEEEEEcCC--CceeEEeeec-------CCCC
Q 032726           39 SMKDLIKLGEGCVSHPEDVSVVVRKGALYTAT-------------NDGWVKYFILHN--ETLVNWKHID-------SQSL   96 (135)
Q Consensus        39 ~L~~~e~l~~g~~~GPEdi~avd~~G~lYTg~-------------~dG~I~ri~~~~--~~~~~~~~t~-------GRPp   96 (135)
                      .+.+.++|. +...||||+ +++++|.+|+++             ++|+|++++..+  .+.+.++.++       +|| 
T Consensus        38 ~~~~C~~i~-~~~~G~EDi-~~~~~G~~~~s~~~~~pg~~~~~~~~~G~I~~~d~~~~~~~~~~l~~~g~~~~~~~f~P-  114 (355)
T 3sre_A           38 ELPNCNLVK-GIDNGSEDL-EILPNGLAFISSGLKYPGIMSFDPDKSGKILLMDLNEKEPAVSELEIIGNTLDISSFNP-  114 (355)
T ss_dssp             CCSCEEECT-TCCSCCCEE-EECTTSEEEEEECCC-----------CCEEEEEETTSSSCCEEECEEECSSCCGGGCCE-
T ss_pred             CCCCCEEeC-CCCCCccee-EEcCCCeEEEEeccccCCCcccCCCCCCeEEEEecCCCCCceEEEEccCCCCCcCceee-
Confidence            345788874 335799999 699999999998             899999998742  3456666666       599 


Q ss_pred             CceeECC--CC--CEEEEeCCCc-----eEEeCCCCeEEEEEEEee
Q 032726           97 LGLTTTK--EG--DVVICDSKKV-----RQHTNSQALIIVCVCVYS  133 (135)
Q Consensus        97 LGl~fd~--~G--~LiVaDa~~G-----Ll~V~~~G~v~vl~~~~~  133 (135)
                      +||.+..  +|  +|||||+.++     ++++++++...+++.-+.
T Consensus       115 hGi~~~~d~dg~~~L~Vvnh~~~~s~ielf~~d~~~~~~~~~~~~~  160 (355)
T 3sre_A          115 HGISTFIDDDNTVYLLVVNHPGSSSTVEVFKFQEEEKSLLHLKTIR  160 (355)
T ss_dssp             EEEEEEECTTCCEEEEEEECSTTCCEEEEEEEETTTTEEEEEEEEC
T ss_pred             eeeEEEECCCCcEEEEEEECCCCCCeEEEEEEECCCCEEEEEeccc
Confidence            9999954  45  6999999986     999999887777776543
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>4a9v_A PHOX; hydrolase, beta-propeller; 1.10A {Pseudomonas fluorescens} PDB: 3zwu_A 4a9x_A* Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>4a9v_A PHOX; hydrolase, beta-propeller; 1.10A {Pseudomonas fluorescens} PDB: 3zwu_A 4a9x_A* Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>3zwu_A Alkaline phosphatase PHOX; hydrolase, beta-propeller, iron; 1.39A {Pseudomonas fluorescens} Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>3b7f_A Glycosyl hydrolase, BNR repeat; 7-bladed beta-propeller fold, structural genomics, joint CEN structural genomics, JCSG; 2.20A {Ralstonia eutropha} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>3b7f_A Glycosyl hydrolase, BNR repeat; 7-bladed beta-propeller fold, structural genomics, joint CEN structural genomics, JCSG; 2.20A {Ralstonia eutropha} Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>2be1_A Serine/threonine-protein kinase/endoribonuclease; transcription; 2.98A {Saccharomyces cerevisiae} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query135
d1pjxa_ 314 Diisopropylfluorophosphatase (phosphotriesterase, 99.16
d2p4oa1 302 Hypothetical protein All0351 homologue {Nostoc pun 98.7
d2dg1a1 319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 98.48
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 98.44
d1rwia_ 260 Serine/threonine-protein kinase PknD {Mycobacteriu 98.4
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 98.15
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 98.08
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 98.01
d1v04a_ 340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 97.83
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 97.81
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 97.63
d2ghsa1 295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 97.24
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 97.24
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 97.19
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 97.17
d1ri6a_ 333 Putative isomerase YbhE {Escherichia coli [TaxId: 97.04
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 97.04
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 96.85
d1ijqa1 266 Low density lipoprotein (LDL) receptor {Human (Hom 96.66
d1l0qa2 301 Surface layer protein {Archaeon Methanosarcina maz 96.52
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 96.38
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 96.29
d1crua_ 450 Soluble quinoprotein glucose dehydrogenase {Acinet 96.05
d1nr0a2 299 Actin interacting protein 1 {Nematode (Caenorhabdi 95.83
d1pbyb_ 337 Quinohemoprotein amine dehydrogenase B chain {Para 95.59
d1jmxb_ 346 Quinohemoprotein amine dehydrogenase B chain {Pseu 95.49
d1jmxb_ 346 Quinohemoprotein amine dehydrogenase B chain {Pseu 95.41
d1crua_ 450 Soluble quinoprotein glucose dehydrogenase {Acinet 95.27
d1pbyb_ 337 Quinohemoprotein amine dehydrogenase B chain {Para 95.02
d1tbga_ 340 beta1-subunit of the signal-transducing G protein 94.61
d1hzua2 426 C-terminal (heme d1) domain of cytochrome cd1-nitr 94.5
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 94.21
d1tl2a_235 Tachylectin-2 {Japanese horseshoe crab (Tachypleus 93.93
d1nr0a2 299 Actin interacting protein 1 {Nematode (Caenorhabdi 92.99
d1hzua2 426 C-terminal (heme d1) domain of cytochrome cd1-nitr 92.87
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 92.76
d1k32a3 360 Tricorn protease domain 2 {Archaeon Thermoplasma a 92.57
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 92.32
d1sq9a_ 393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 91.93
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 91.89
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 91.71
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 91.66
d1k8kc_ 371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 91.6
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 91.48
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 91.41
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 91.12
d1tl2a_235 Tachylectin-2 {Japanese horseshoe crab (Tachypleus 91.12
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 90.78
d1tbga_340 beta1-subunit of the signal-transducing G protein 90.4
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 89.56
d1vyhc1 317 Platelet-activating factor acetylhydrolase IB subu 88.99
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 88.81
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 86.51
d1nr0a1 311 Actin interacting protein 1 {Nematode (Caenorhabdi 85.26
d1mdah_ 368 Methylamine dehydrogenase, H-chain {Paracoccus den 85.1
d1p22a2 293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 84.68
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 83.73
d1qnia2 441 Nitrous oxide reductase, N-terminal domain {Pseudo 83.6
d1jofa_ 365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 83.15
d1nexb2 355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 83.03
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 82.44
d1erja_ 388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 82.35
d1erja_ 388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 81.97
d1flga_ 582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 81.27
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: Calcium-dependent phosphotriesterase
family: SGL-like
domain: Diisopropylfluorophosphatase (phosphotriesterase, DFP)
species: Squid (Loligo vulgaris) [TaxId: 6622]

Probab=99.16  E-value=7.3e-11  Score=92.69  Aligned_cols=85  Identities=12%  Similarity=0.116  Sum_probs=68.6

Q ss_pred             cceEeccCCcCCCceeeeeeCCCcEEEEec--------CcEEEEEEcCCCceeEEe-----eecCCCCCceeECCCCC-E
Q 032726           42 DLIKLGEGCVSHPEDVSVVVRKGALYTATN--------DGWVKYFILHNETLVNWK-----HIDSQSLLGLTTTKEGD-V  107 (135)
Q Consensus        42 ~~e~l~~g~~~GPEdi~avd~~G~lYTg~~--------dG~I~ri~~~~~~~~~~~-----~t~GRPpLGl~fd~~G~-L  107 (135)
                      ..+++.++ +.|||.. ++|++|++|....        +|+|+|+++.++..+.+.     ..+|+| .||+||++|+ |
T Consensus         9 ~~~~v~~~-~~g~EGp-a~d~dG~ly~~~~~~~~~~~~~g~I~r~d~~~~~~~~~~~~~~~~~~g~P-~Gl~~~~dg~~l   85 (314)
T d1pjxa_           9 LFTKVTED-IPGAEGP-VFDKNGDFYIVAPEVEVNGKPAGEILRIDLKTGKKTVICKPEVNGYGGIP-AGCQCDRDANQL   85 (314)
T ss_dssp             CCEEEECC-CTTCEEE-EECTTSCEEEEETTCEETTEECCEEEEECTTTCCEEEEECCEETTEECCE-EEEEECSSSSEE
T ss_pred             ceEEeecC-CCCCeEe-EEeCCCCEEEEECccccccccCCEEEEEECCCCcEEEEECCccccCCCcc-eeEEEeCCCCEE
Confidence            34677776 7899999 7999999998654        578999987555444432     356898 9999999986 8


Q ss_pred             EEEeCCCceEEeCCCCeEEEEE
Q 032726          108 VICDSKKVRQHTNSQALIIVCV  129 (135)
Q Consensus       108 iVaDa~~GLl~V~~~G~v~vl~  129 (135)
                      ||+|.+.|+++++++|..+++.
T Consensus        86 ~vad~~~~i~~~~~~g~~~~~~  107 (314)
T d1pjxa_          86 FVADMRLGLLVVQTDGTFEEIA  107 (314)
T ss_dssp             EEEETTTEEEEEETTSCEEECC
T ss_pred             EEEECCCeEEEEeCCCcEEEEE
Confidence            9999999999999998877653
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1tl2a_ b.67.1.1 (A:) Tachylectin-2 {Japanese horseshoe crab (Tachypleus tridentatus) [TaxId: 6853]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1tl2a_ b.67.1.1 (A:) Tachylectin-2 {Japanese horseshoe crab (Tachypleus tridentatus) [TaxId: 6853]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure