Citrus Sinensis ID: 032868
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 131 | ||||||
| 255579783 | 182 | Senescence-associated protein DIN1, puta | 0.839 | 0.604 | 0.657 | 2e-28 | |
| 224133954 | 180 | predicted protein [Populus trichocarpa] | 0.824 | 0.6 | 0.605 | 9e-28 | |
| 359497218 | 177 | PREDICTED: senescence-associated protein | 0.610 | 0.451 | 0.658 | 5e-22 | |
| 351728052 | 186 | uncharacterized protein LOC100305968 [Gl | 0.496 | 0.349 | 0.738 | 1e-19 | |
| 351726216 | 185 | uncharacterized protein LOC100499831 [Gl | 0.496 | 0.351 | 0.738 | 7e-19 | |
| 449434108 | 184 | PREDICTED: rhodanese-like domain-contain | 0.702 | 0.5 | 0.593 | 2e-18 | |
| 388501622 | 179 | unknown [Lotus japonicus] | 0.496 | 0.363 | 0.696 | 4e-18 | |
| 357483967 | 185 | Senescence-associated protein DIN1 [Medi | 0.496 | 0.351 | 0.696 | 9e-18 | |
| 7340289 | 150 | OP1 [Cucumis sativus] | 0.603 | 0.526 | 0.604 | 1e-17 | |
| 357483969 | 108 | Senescence-associated protein DIN1 [Medi | 0.396 | 0.481 | 0.830 | 5e-17 |
| >gi|255579783|ref|XP_002530729.1| Senescence-associated protein DIN1, putative [Ricinus communis] gi|223529693|gb|EEF31635.1| Senescence-associated protein DIN1, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 130 bits (327), Expect = 2e-28, Method: Compositional matrix adjust.
Identities = 75/114 (65%), Positives = 87/114 (76%), Gaps = 4/114 (3%)
Query: 1 MEATSLISLSSFAAGASSLPPVLCPHGNNRRGLLSLT-VDQQRCDNIGFISSKILSFCPK 59
MEA S++S ++F + +SL P CP N R LL L ++ R +IG I+ K +SFCPK
Sbjct: 1 MEAKSIVSSATFTS--TSLCPSFCPSNLNNRKLLLLPLINNPRRLSIG-INQKSVSFCPK 57
Query: 60 ASLRGNLEAVGVPTSVPVRVAHELLQAGHRYLDVRTPEEFSAGHATGAINVPYM 113
A LRGNLEAVGVPTSVPVRVAHELL AGHRYLDVRTPEEFSAGH GAIN+PYM
Sbjct: 58 AGLRGNLEAVGVPTSVPVRVAHELLLAGHRYLDVRTPEEFSAGHVVGAINIPYM 111
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224133954|ref|XP_002327720.1| predicted protein [Populus trichocarpa] gi|222836805|gb|EEE75198.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|359497218|ref|XP_002271073.2| PREDICTED: senescence-associated protein DIN1-like [Vitis vinifera] gi|296088206|emb|CBI35721.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|351728052|ref|NP_001235646.1| uncharacterized protein LOC100305968 [Glycine max] gi|255627141|gb|ACU13915.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|351726216|ref|NP_001236607.1| uncharacterized protein LOC100499831 [Glycine max] gi|255626991|gb|ACU13840.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449434108|ref|XP_004134838.1| PREDICTED: rhodanese-like domain-containing protein 15, chloroplastic-like [Cucumis sativus] gi|449491287|ref|XP_004158850.1| PREDICTED: rhodanese-like domain-containing protein 15, chloroplastic-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|388501622|gb|AFK38877.1| unknown [Lotus japonicus] | Back alignment and taxonomy information |
|---|
| >gi|357483967|ref|XP_003612270.1| Senescence-associated protein DIN1 [Medicago truncatula] gi|217071246|gb|ACJ83983.1| unknown [Medicago truncatula] gi|355513605|gb|AES95228.1| Senescence-associated protein DIN1 [Medicago truncatula] gi|388495624|gb|AFK35878.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|7340289|gb|AAF61174.1|AF245222_1 OP1 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|357483969|ref|XP_003612271.1| Senescence-associated protein DIN1 [Medicago truncatula] gi|355513606|gb|AES95229.1| Senescence-associated protein DIN1 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 131 | ||||||
| TAIR|locus:2128038 | 182 | SEN1 "AT4G35770" [Arabidopsis | 0.389 | 0.280 | 0.773 | 2.9e-16 | |
| UNIPROTKB|B2C7Y6 | 185 | NRIP1 "Chloroplast N receptor- | 0.549 | 0.389 | 0.602 | 6e-16 | |
| TAIR|locus:2156937 | 120 | STR16 "AT5G66040" [Arabidopsis | 0.335 | 0.366 | 0.818 | 1.1e-14 | |
| TAIR|locus:2156882 | 138 | STR18 "AT5G66170" [Arabidopsis | 0.396 | 0.376 | 0.490 | 2.3e-07 | |
| TAIR|locus:505006261 | 169 | AT2G21045 [Arabidopsis thalian | 0.305 | 0.236 | 0.55 | 6.1e-07 | |
| UNIPROTKB|Q8ECN1 | 132 | SO_3105 "Periplasmic rhodanese | 0.267 | 0.265 | 0.542 | 5.5e-06 | |
| TIGR_CMR|SO_3105 | 132 | SO_3105 "phage shock protein E | 0.267 | 0.265 | 0.542 | 5.5e-06 | |
| UNIPROTKB|Q8E992 | 108 | SO_4394 "Cytoplasmic rhodanese | 0.229 | 0.277 | 0.566 | 6.3e-05 | |
| TIGR_CMR|SO_4394 | 108 | SO_4394 "phage shock protein E | 0.229 | 0.277 | 0.566 | 6.3e-05 | |
| TAIR|locus:2827795 | 156 | AT2G17850 "AT2G17850" [Arabido | 0.526 | 0.442 | 0.342 | 6.3e-05 |
| TAIR|locus:2128038 SEN1 "AT4G35770" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 202 (76.2 bits), Expect = 2.9e-16, P = 2.9e-16
Identities = 41/53 (77%), Positives = 45/53 (84%)
Query: 63 RGNL--EAVGVPTSVPVRVAHELLQAGHRYLDVRTPEEFSAGHATGAINVPYM 113
RGN+ EAV +PTSVPVRVA EL QAG+RYLDVRTP+EFS GH T AINVPYM
Sbjct: 59 RGNVAAEAVKIPTSVPVRVARELAQAGYRYLDVRTPDEFSIGHPTRAINVPYM 111
|
|
| UNIPROTKB|B2C7Y6 NRIP1 "Chloroplast N receptor-interacting protein 1" [Nicotiana benthamiana (taxid:4100)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2156937 STR16 "AT5G66040" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2156882 STR18 "AT5G66170" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:505006261 AT2G21045 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8ECN1 SO_3105 "Periplasmic rhodanese domain protein" [Shewanella oneidensis MR-1 (taxid:211586)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|SO_3105 SO_3105 "phage shock protein E" [Shewanella oneidensis MR-1 (taxid:211586)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8E992 SO_4394 "Cytoplasmic rhodanese domain protein" [Shewanella oneidensis MR-1 (taxid:211586)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|SO_4394 SO_4394 "phage shock protein E" [Shewanella oneidensis MR-1 (taxid:211586)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2827795 AT2G17850 "AT2G17850" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 131 | |||
| PLN02160 | 136 | PLN02160, PLN02160, thiosulfate sulfurtransferase | 6e-09 | |
| cd00158 | 89 | cd00158, RHOD, Rhodanese Homology Domain (RHOD); a | 4e-08 | |
| PRK11784 | 345 | PRK11784, PRK11784, tRNA 2-selenouridine synthase; | 2e-07 | |
| smart00450 | 100 | smart00450, RHOD, Rhodanese Homology Domain | 1e-06 | |
| pfam00581 | 106 | pfam00581, Rhodanese, Rhodanese-like domain | 1e-06 | |
| TIGR03167 | 311 | TIGR03167, tRNA_sel_U_synt, tRNA 2-selenouridine s | 2e-06 | |
| cd01520 | 128 | cd01520, RHOD_YbbB, Member of the Rhodanese Homolo | 3e-06 | |
| cd01524 | 90 | cd01524, RHOD_Pyr_redox, Member of the Rhodanese H | 5e-05 | |
| PRK10287 | 104 | PRK10287, PRK10287, thiosulfate:cyanide sulfurtran | 1e-04 | |
| cd01534 | 95 | cd01534, 4RHOD_Repeat_3, Member of the Rhodanese H | 2e-04 | |
| TIGR02981 | 101 | TIGR02981, phageshock_pspE, phage shock operon rho | 5e-04 | |
| cd01519 | 106 | cd01519, RHOD_HSP67B2, Member of the Rhodanese Hom | 0.001 | |
| COG0607 | 110 | COG0607, PspE, Rhodanese-related sulfurtransferase | 0.001 | |
| PRK08762 | 376 | PRK08762, PRK08762, molybdopterin biosynthesis pro | 0.002 | |
| COG2897 | 285 | COG2897, SseA, Rhodanese-related sulfurtransferase | 0.002 | |
| PRK00162 | 108 | PRK00162, glpE, thiosulfate sulfurtransferase; Val | 0.003 | |
| cd01526 | 122 | cd01526, RHOD_ThiF, Member of the Rhodanese Homolo | 0.004 |
| >gnl|CDD|177819 PLN02160, PLN02160, thiosulfate sulfurtransferase | Back alignment and domain information |
|---|
Score = 50.5 bits (120), Expect = 6e-09
Identities = 24/42 (57%), Positives = 29/42 (69%), Gaps = 2/42 (4%)
Query: 74 SVPVRVAHELLQAGHRYLDVRTPEEFSAGHATGA--INVPYM 113
SV V A LLQ+GH+YLDVRT +EF GH A +N+PYM
Sbjct: 16 SVDVSQAKTLLQSGHQYLDVRTQDEFRRGHCEAAKIVNIPYM 57
|
Length = 136 |
| >gnl|CDD|238089 cd00158, RHOD, Rhodanese Homology Domain (RHOD); an alpha beta fold domain found duplicated in the rhodanese protein | Back alignment and domain information |
|---|
| >gnl|CDD|236982 PRK11784, PRK11784, tRNA 2-selenouridine synthase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|197731 smart00450, RHOD, Rhodanese Homology Domain | Back alignment and domain information |
|---|
| >gnl|CDD|216005 pfam00581, Rhodanese, Rhodanese-like domain | Back alignment and domain information |
|---|
| >gnl|CDD|234132 TIGR03167, tRNA_sel_U_synt, tRNA 2-selenouridine synthase | Back alignment and domain information |
|---|
| >gnl|CDD|238778 cd01520, RHOD_YbbB, Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|238782 cd01524, RHOD_Pyr_redox, Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|182356 PRK10287, PRK10287, thiosulfate:cyanide sulfurtransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238792 cd01534, 4RHOD_Repeat_3, Member of the Rhodanese Homology Domain superfamily, repeat 3 | Back alignment and domain information |
|---|
| >gnl|CDD|132026 TIGR02981, phageshock_pspE, phage shock operon rhodanese PspE | Back alignment and domain information |
|---|
| >gnl|CDD|238777 cd01519, RHOD_HSP67B2, Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|223680 COG0607, PspE, Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|236337 PRK08762, PRK08762, molybdopterin biosynthesis protein MoeB; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|225450 COG2897, SseA, Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|178908 PRK00162, glpE, thiosulfate sulfurtransferase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|238784 cd01526, RHOD_ThiF, Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 131 | |||
| PRK07878 | 392 | molybdopterin biosynthesis-like protein MoeZ; Vali | 99.08 | |
| PRK07411 | 390 | hypothetical protein; Validated | 99.06 | |
| KOG1530 | 136 | consensus Rhodanese-related sulfurtransferase [Ino | 99.03 | |
| cd01520 | 128 | RHOD_YbbB Member of the Rhodanese Homology Domain | 99.02 | |
| cd01518 | 101 | RHOD_YceA Member of the Rhodanese Homology Domain | 99.01 | |
| cd01534 | 95 | 4RHOD_Repeat_3 Member of the Rhodanese Homology Do | 98.99 | |
| cd01523 | 100 | RHOD_Lact_B Member of the Rhodanese Homology Domai | 98.99 | |
| cd01527 | 99 | RHOD_YgaP Member of the Rhodanese Homology Domain | 98.97 | |
| cd01533 | 109 | 4RHOD_Repeat_2 Member of the Rhodanese Homology Do | 98.96 | |
| cd01525 | 105 | RHOD_Kc Member of the Rhodanese Homology Domain su | 98.9 | |
| cd01519 | 106 | RHOD_HSP67B2 Member of the Rhodanese Homology Doma | 98.87 | |
| cd01443 | 113 | Cdc25_Acr2p Cdc25 enzymes are members of the Rhoda | 98.84 | |
| cd01526 | 122 | RHOD_ThiF Member of the Rhodanese Homology Domain | 98.83 | |
| cd01524 | 90 | RHOD_Pyr_redox Member of the Rhodanese Homology Do | 98.83 | |
| PRK00162 | 108 | glpE thiosulfate sulfurtransferase; Validated | 98.8 | |
| cd01521 | 110 | RHOD_PspE2 Member of the Rhodanese Homology Domain | 98.8 | |
| cd01530 | 121 | Cdc25 Cdc25 phosphatases are members of the Rhodan | 98.8 | |
| cd01522 | 117 | RHOD_1 Member of the Rhodanese Homology Domain sup | 98.76 | |
| cd01528 | 101 | RHOD_2 Member of the Rhodanese Homology Domain sup | 98.75 | |
| PRK05600 | 370 | thiamine biosynthesis protein ThiF; Validated | 98.74 | |
| KOG2017 | 427 | consensus Molybdopterin synthase sulfurylase [Coen | 98.73 | |
| PF00581 | 113 | Rhodanese: Rhodanese-like domain This Prosite entr | 98.71 | |
| PLN02160 | 136 | thiosulfate sulfurtransferase | 98.71 | |
| cd01531 | 113 | Acr2p Eukaryotic arsenate resistance proteins are | 98.69 | |
| cd01449 | 118 | TST_Repeat_2 Thiosulfate sulfurtransferase (TST), | 98.69 | |
| cd01448 | 122 | TST_Repeat_1 Thiosulfate sulfurtransferase (TST), | 98.69 | |
| cd01447 | 103 | Polysulfide_ST Polysulfide-sulfurtransferase - Rho | 98.69 | |
| PRK11784 | 345 | tRNA 2-selenouridine synthase; Provisional | 98.68 | |
| cd01444 | 96 | GlpE_ST GlpE sulfurtransferase (ST) and homologs a | 98.62 | |
| PRK05320 | 257 | rhodanese superfamily protein; Provisional | 98.58 | |
| TIGR03167 | 311 | tRNA_sel_U_synt tRNA 2-selenouridine synthase. The | 98.52 | |
| PRK01415 | 247 | hypothetical protein; Validated | 98.51 | |
| cd01529 | 96 | 4RHOD_Repeats Member of the Rhodanese Homology Dom | 98.45 | |
| cd01446 | 132 | DSP_MapKP N-terminal regulatory rhodanese domain o | 98.45 | |
| PRK00142 | 314 | putative rhodanese-related sulfurtransferase; Prov | 98.42 | |
| PRK08762 | 376 | molybdopterin biosynthesis protein MoeB; Validated | 98.41 | |
| smart00450 | 100 | RHOD Rhodanese Homology Domain. An alpha beta fold | 98.39 | |
| cd01532 | 92 | 4RHOD_Repeat_1 Member of the Rhodanese Homology Do | 98.37 | |
| cd00158 | 89 | RHOD Rhodanese Homology Domain (RHOD); an alpha be | 98.29 | |
| PLN02723 | 320 | 3-mercaptopyruvate sulfurtransferase | 98.26 | |
| TIGR02981 | 101 | phageshock_pspE phage shock operon rhodanese PspE. | 98.25 | |
| PRK11493 | 281 | sseA 3-mercaptopyruvate sulfurtransferase; Provisi | 98.23 | |
| cd01445 | 138 | TST_Repeats Thiosulfate sulfurtransferases (TST) c | 98.23 | |
| PRK10287 | 104 | thiosulfate:cyanide sulfurtransferase; Provisional | 98.22 | |
| TIGR03865 | 162 | PQQ_CXXCW PQQ-dependent catabolism-associated CXXC | 98.2 | |
| COG0607 | 110 | PspE Rhodanese-related sulfurtransferase [Inorgani | 98.2 | |
| PRK05597 | 355 | molybdopterin biosynthesis protein MoeB; Validated | 98.11 | |
| cd01535 | 145 | 4RHOD_Repeat_4 Member of the Rhodanese Homology Do | 98.1 | |
| PRK09629 | 610 | bifunctional thiosulfate sulfurtransferase/phospha | 98.09 | |
| COG2897 | 285 | SseA Rhodanese-related sulfurtransferase [Inorgani | 98.01 | |
| PRK09629 | 610 | bifunctional thiosulfate sulfurtransferase/phospha | 97.9 | |
| PLN02723 | 320 | 3-mercaptopyruvate sulfurtransferase | 97.89 | |
| PRK11493 | 281 | sseA 3-mercaptopyruvate sulfurtransferase; Provisi | 97.82 | |
| KOG3772 | 325 | consensus M-phase inducer phosphatase [Cell cycle | 97.79 | |
| PRK01269 | 482 | tRNA s(4)U8 sulfurtransferase; Provisional | 97.58 | |
| COG1054 | 308 | Predicted sulfurtransferase [General function pred | 96.9 | |
| COG2897 | 285 | SseA Rhodanese-related sulfurtransferase [Inorgani | 96.29 | |
| COG2603 | 334 | Predicted ATPase [General function prediction only | 96.23 | |
| PRK07688 | 339 | thiamine/molybdopterin biosynthesis ThiF/MoeB-like | 94.84 | |
| KOG1529 | 286 | consensus Mercaptopyruvate sulfurtransferase/thios | 93.63 | |
| COG5105 | 427 | MIH1 Mitotic inducer, protein phosphatase [Cell di | 93.62 | |
| PRK00142 | 314 | putative rhodanese-related sulfurtransferase; Prov | 91.91 |
| >PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated | Back alignment and domain information |
|---|
Probab=99.08 E-value=2e-10 Score=96.60 Aligned_cols=80 Identities=18% Similarity=0.269 Sum_probs=64.0
Q ss_pred eeecccCCCcccccccccccccchhhhccccCcc-cccCCCCccCHHHHHHHHhCC--CEEEeeCChhhhhcCCCCCcee
Q 032868 33 LLSLTVDQQRCDNIGFISSKILSFCPKASLRGNL-EAVGVPTSVPVRVAHELLQAG--HRYLDVRTPEEFSAGHATGAIN 109 (131)
Q Consensus 33 ~l~l~~~P~r~~i~~~~~~~~~~~~~~c~~~~~~-~~~~~~~~Is~~el~~l~~~~--~~LIDVRep~E~~~ghIpgAi~ 109 (131)
.++++++|+|+.+.. +.+|+.+|+..... ........|+++++.++++++ .++||||+++||+.+|||||+|
T Consensus 251 ~~~~~~~~~C~~~~~-----~~~~~~~c~~~~~~~~~~~~~~~Is~~el~~~l~~~~~~~lIDvR~~~ef~~ghIpGAin 325 (392)
T PRK07878 251 TIKIRKDPSTPKITE-----LIDYEAFCGVVSDEAQQAAAGSTITPRELKEWLDSGKKIALIDVREPVEWDIVHIPGAQL 325 (392)
T ss_pred eEeeccCCCCCcccc-----cccchhhcccccccccccCCCCccCHHHHHHHHhCCCCeEEEECCCHHHHhcCCCCCCEE
Confidence 478889999987766 56789999875322 122345689999999998653 6899999999999999999999
Q ss_pred eCCCCCCC
Q 032868 110 VPYMDDKE 117 (131)
Q Consensus 110 IPl~~i~~ 117 (131)
+|+..+..
T Consensus 326 ip~~~l~~ 333 (392)
T PRK07878 326 IPKSEILS 333 (392)
T ss_pred cChHHhcc
Confidence 99987754
|
|
| >PRK07411 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >KOG1530 consensus Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd01520 RHOD_YbbB Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >cd01518 RHOD_YceA Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >cd01534 4RHOD_Repeat_3 Member of the Rhodanese Homology Domain superfamily, repeat 3 | Back alignment and domain information |
|---|
| >cd01523 RHOD_Lact_B Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >cd01527 RHOD_YgaP Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >cd01533 4RHOD_Repeat_2 Member of the Rhodanese Homology Domain superfamily, repeat 2 | Back alignment and domain information |
|---|
| >cd01525 RHOD_Kc Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >cd01519 RHOD_HSP67B2 Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >cd01443 Cdc25_Acr2p Cdc25 enzymes are members of the Rhodanese Homology Domain (RHOD) superfamily | Back alignment and domain information |
|---|
| >cd01526 RHOD_ThiF Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >cd01524 RHOD_Pyr_redox Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >PRK00162 glpE thiosulfate sulfurtransferase; Validated | Back alignment and domain information |
|---|
| >cd01521 RHOD_PspE2 Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >cd01530 Cdc25 Cdc25 phosphatases are members of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >cd01522 RHOD_1 Member of the Rhodanese Homology Domain superfamily, subgroup 1 | Back alignment and domain information |
|---|
| >cd01528 RHOD_2 Member of the Rhodanese Homology Domain superfamily, subgroup 2 | Back alignment and domain information |
|---|
| >PRK05600 thiamine biosynthesis protein ThiF; Validated | Back alignment and domain information |
|---|
| >KOG2017 consensus Molybdopterin synthase sulfurylase [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >PF00581 Rhodanese: Rhodanese-like domain This Prosite entry represents a subset of this family | Back alignment and domain information |
|---|
| >PLN02160 thiosulfate sulfurtransferase | Back alignment and domain information |
|---|
| >cd01531 Acr2p Eukaryotic arsenate resistance proteins are members of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >cd01449 TST_Repeat_2 Thiosulfate sulfurtransferase (TST), C-terminal, catalytic domain | Back alignment and domain information |
|---|
| >cd01448 TST_Repeat_1 Thiosulfate sulfurtransferase (TST), N-terminal, inactive domain | Back alignment and domain information |
|---|
| >cd01447 Polysulfide_ST Polysulfide-sulfurtransferase - Rhodanese Homology Domain | Back alignment and domain information |
|---|
| >PRK11784 tRNA 2-selenouridine synthase; Provisional | Back alignment and domain information |
|---|
| >cd01444 GlpE_ST GlpE sulfurtransferase (ST) and homologs are members of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >PRK05320 rhodanese superfamily protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03167 tRNA_sel_U_synt tRNA 2-selenouridine synthase | Back alignment and domain information |
|---|
| >PRK01415 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >cd01529 4RHOD_Repeats Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >cd01446 DSP_MapKP N-terminal regulatory rhodanese domain of dual specificity phosphatases (DSP), such as Mapk Phosphatase | Back alignment and domain information |
|---|
| >PRK00142 putative rhodanese-related sulfurtransferase; Provisional | Back alignment and domain information |
|---|
| >PRK08762 molybdopterin biosynthesis protein MoeB; Validated | Back alignment and domain information |
|---|
| >smart00450 RHOD Rhodanese Homology Domain | Back alignment and domain information |
|---|
| >cd01532 4RHOD_Repeat_1 Member of the Rhodanese Homology Domain superfamily, repeat 1 | Back alignment and domain information |
|---|
| >cd00158 RHOD Rhodanese Homology Domain (RHOD); an alpha beta fold domain found duplicated in the rhodanese protein | Back alignment and domain information |
|---|
| >PLN02723 3-mercaptopyruvate sulfurtransferase | Back alignment and domain information |
|---|
| >TIGR02981 phageshock_pspE phage shock operon rhodanese PspE | Back alignment and domain information |
|---|
| >PRK11493 sseA 3-mercaptopyruvate sulfurtransferase; Provisional | Back alignment and domain information |
|---|
| >cd01445 TST_Repeats Thiosulfate sulfurtransferases (TST) contain 2 copies of the Rhodanese Homology Domain | Back alignment and domain information |
|---|
| >PRK10287 thiosulfate:cyanide sulfurtransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR03865 PQQ_CXXCW PQQ-dependent catabolism-associated CXXCW motif protein | Back alignment and domain information |
|---|
| >COG0607 PspE Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK05597 molybdopterin biosynthesis protein MoeB; Validated | Back alignment and domain information |
|---|
| >cd01535 4RHOD_Repeat_4 Member of the Rhodanese Homology Domain superfamily, repeat 4 | Back alignment and domain information |
|---|
| >PRK09629 bifunctional thiosulfate sulfurtransferase/phosphatidylserine decarboxylase; Provisional | Back alignment and domain information |
|---|
| >COG2897 SseA Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK09629 bifunctional thiosulfate sulfurtransferase/phosphatidylserine decarboxylase; Provisional | Back alignment and domain information |
|---|
| >PLN02723 3-mercaptopyruvate sulfurtransferase | Back alignment and domain information |
|---|
| >PRK11493 sseA 3-mercaptopyruvate sulfurtransferase; Provisional | Back alignment and domain information |
|---|
| >KOG3772 consensus M-phase inducer phosphatase [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK01269 tRNA s(4)U8 sulfurtransferase; Provisional | Back alignment and domain information |
|---|
| >COG1054 Predicted sulfurtransferase [General function prediction only] | Back alignment and domain information |
|---|
| >COG2897 SseA Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG2603 Predicted ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated | Back alignment and domain information |
|---|
| >KOG1529 consensus Mercaptopyruvate sulfurtransferase/thiosulfate sulfurtransferase [Defense mechanisms] | Back alignment and domain information |
|---|
| >COG5105 MIH1 Mitotic inducer, protein phosphatase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK00142 putative rhodanese-related sulfurtransferase; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 131 | ||||
| 1tq1_A | 129 | Solution Structure Of At5g66040, A Putative Protein | 7e-16 |
| >pdb|1TQ1|A Chain A, Solution Structure Of At5g66040, A Putative Protein From Arabidosis Thaliana Length = 129 | Back alignment and structure |
|
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 131 | |||
| 1tq1_A | 129 | AT5G66040, senescence-associated family protein; C | 8e-19 | |
| 3g5j_A | 134 | Putative ATP/GTP binding protein; N-terminal domai | 7e-11 | |
| 1wv9_A | 94 | Rhodanese homolog TT1651; CDC25, phosphatase, sulf | 3e-09 | |
| 2jtq_A | 85 | Phage shock protein E; solution structure rhodanes | 2e-08 | |
| 2k0z_A | 110 | Uncharacterized protein HP1203; A/B domain, struct | 2e-08 | |
| 3hix_A | 106 | ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q | 7e-08 | |
| 3ilm_A | 141 | ALR3790 protein; rhodanese-like, NSR437H, NESG, st | 9e-08 | |
| 1gmx_A | 108 | GLPE protein; transferase, rhodanese, sulfurtransf | 1e-07 | |
| 3gk5_A | 108 | Uncharacterized rhodanese-related protein TVG08686 | 6e-07 | |
| 3nhv_A | 144 | BH2092 protein; alpha-beta protein, structural gen | 7e-07 | |
| 3d1p_A | 139 | Putative thiosulfate sulfurtransferase YOR285W; at | 7e-07 | |
| 3eme_A | 103 | Rhodanese-like domain protein; alpha-beta-alpha sa | 1e-06 | |
| 3foj_A | 100 | Uncharacterized protein; protein SSP1007, structur | 1e-06 | |
| 3ics_A | 588 | Coenzyme A-disulfide reductase; pyridine nucleotid | 2e-06 | |
| 1yt8_A | 539 | Thiosulfate sulfurtransferase; rhodanase domains, | 3e-06 | |
| 1yt8_A | 539 | Thiosulfate sulfurtransferase; rhodanase domains, | 2e-05 | |
| 1yt8_A | 539 | Thiosulfate sulfurtransferase; rhodanase domains, | 6e-05 | |
| 1yt8_A | 539 | Thiosulfate sulfurtransferase; rhodanase domains, | 3e-04 | |
| 3flh_A | 124 | Uncharacterized protein LP_1913; alpha-beta protei | 7e-06 | |
| 1t3k_A | 152 | Arath CDC25, dual-specificity tyrosine phosphatase | 1e-05 | |
| 1qb0_A | 211 | Protein (M-phase inducer phosphatase 2 (CDC25B)); | 1e-05 | |
| 1c25_A | 161 | CDC25A; hydrolase, cell cycle phosphatase,dual spe | 1e-05 | |
| 2a2k_A | 175 | M-phase inducer phosphatase 2; dual specificity, s | 1e-05 | |
| 3ntd_A | 565 | FAD-dependent pyridine nucleotide-disulphide oxido | 3e-05 | |
| 3i2v_A | 127 | Adenylyltransferase and sulfurtransferase MOCS3; r | 3e-05 | |
| 3tp9_A | 474 | Beta-lactamase and rhodanese domain protein; struc | 4e-05 | |
| 3op3_A | 216 | M-phase inducer phosphatase 3; structural genomics | 2e-04 | |
| 2j6p_A | 152 | SB(V)-AS(V) reductase; arsenate reductase, antimon | 2e-04 | |
| 2fsx_A | 148 | RV0390, COG0607: rhodanese-related sulfurtransfera | 4e-04 | |
| 3f4a_A | 169 | Uncharacterized protein YGR203W; protein phosphata | 5e-04 | |
| 2eg4_A | 230 | Probable thiosulfate sulfurtransferase; structural | 6e-04 | |
| 3r2u_A | 466 | Metallo-beta-lactamase family protein; structural | 8e-04 |
| >1tq1_A AT5G66040, senescence-associated family protein; CESG, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: c.46.1.3 Length = 129 | Back alignment and structure |
|---|
Score = 75.5 bits (186), Expect = 8e-19
Identities = 37/48 (77%), Positives = 40/48 (83%)
Query: 67 EAVGVPTSVPVRVAHELLQAGHRYLDVRTPEEFSAGHATGAINVPYMD 114
E VP+SV V VAH+LL AGHRYLDVRTPEEFS GHA GAINVPYM+
Sbjct: 12 EESRVPSSVSVTVAHDLLLAGHRYLDVRTPEEFSQGHACGAINVPYMN 59
|
| >3g5j_A Putative ATP/GTP binding protein; N-terminal domain of ATP/GTP binding protein, PSI, MCSG, STR genomics, protein structure initiative; HET: PGE; 1.76A {Clostridium difficile} Length = 134 | Back alignment and structure |
|---|
| >1wv9_A Rhodanese homolog TT1651; CDC25, phosphatase, sulfurtransferase, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} Length = 94 | Back alignment and structure |
|---|
| >2jtq_A Phage shock protein E; solution structure rhodanese, stress response, transferase; NMR {Escherichia coli} PDB: 2jtr_A 2jts_A Length = 85 | Back alignment and structure |
|---|
| >2k0z_A Uncharacterized protein HP1203; A/B domain, structural genomics, unknown function, PSI-2, PR structure initiative; NMR {Helicobacter pylori} Length = 110 | Back alignment and structure |
|---|
| >3hix_A ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q8YQN0_anAsp, NSR437I, NESG, structural genomics, PSI-2, protein structure initiative; 1.92A {Anabaena SP} PDB: 3k9r_A Length = 106 | Back alignment and structure |
|---|
| >3ilm_A ALR3790 protein; rhodanese-like, NSR437H, NESG, structural genomics, protein structure initiative, northeast structural genomics consortium; 2.26A {Nostoc SP} PDB: 2kl3_A Length = 141 | Back alignment and structure |
|---|
| >1gmx_A GLPE protein; transferase, rhodanese, sulfurtransferase, glycerol metabolism; 1.1A {Escherichia coli} SCOP: c.46.1.3 PDB: 1gn0_A Length = 108 | Back alignment and structure |
|---|
| >3gk5_A Uncharacterized rhodanese-related protein TVG0868615; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Thermoplasma volcanium GSS1} Length = 108 | Back alignment and structure |
|---|
| >3nhv_A BH2092 protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.50A {Bacillus halodurans} PDB: 3o3w_A Length = 144 | Back alignment and structure |
|---|
| >3d1p_A Putative thiosulfate sulfurtransferase YOR285W; atomic structure, atomic resolution structure, PSI, MCSG; HET: MSE; 0.98A {Saccharomyces cerevisiae} Length = 139 | Back alignment and structure |
|---|
| >3foj_A Uncharacterized protein; protein SSP1007, structural genomics, PSI-2, protein structure initiative; 1.60A {Staphylococcus saprophyticus subsp} Length = 100 | Back alignment and structure |
|---|
| >3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Length = 588 | Back alignment and structure |
|---|
| >1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Length = 539 | Back alignment and structure |
|---|
| >1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Length = 539 | Back alignment and structure |
|---|
| >1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Length = 539 | Back alignment and structure |
|---|
| >1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Length = 539 | Back alignment and structure |
|---|
| >3flh_A Uncharacterized protein LP_1913; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} PDB: 3fnj_A 3i3u_A Length = 124 | Back alignment and structure |
|---|
| >1t3k_A Arath CDC25, dual-specificity tyrosine phosphatase; cell cycle, phosphorylation, plant, hydrolase; NMR {Arabidopsis thaliana} SCOP: c.46.1.1 Length = 152 | Back alignment and structure |
|---|
| >1qb0_A Protein (M-phase inducer phosphatase 2 (CDC25B)); hydrolase, cell cycle phosphatase, dual specificity protein phosphatase; 1.91A {Homo sapiens} SCOP: c.46.1.1 PDB: 1cwr_A 1cws_A 2uzq_A Length = 211 | Back alignment and structure |
|---|
| >1c25_A CDC25A; hydrolase, cell cycle phosphatase,dual specificity protein phosphatase, CDK2; 2.30A {Homo sapiens} SCOP: c.46.1.1 Length = 161 | Back alignment and structure |
|---|
| >2a2k_A M-phase inducer phosphatase 2; dual specificity, substrate trapping, active site mutant, hydrolase; 1.52A {Homo sapiens} PDB: 2ifv_A 1ymd_A 1ym9_A 1ymk_A 1yml_A 1ys0_A 1cwt_A 2ifd_A Length = 175 | Back alignment and structure |
|---|
| >3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Length = 565 | Back alignment and structure |
|---|
| >3i2v_A Adenylyltransferase and sulfurtransferase MOCS3; rhodanese, UBA4, structural genomics, ubiquitin biology, structural genomics consortium, SGC; 1.25A {Homo sapiens} Length = 127 | Back alignment and structure |
|---|
| >3tp9_A Beta-lactamase and rhodanese domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.70A {Alicyclobacillus acidocaldarius subsp} Length = 474 | Back alignment and structure |
|---|
| >3op3_A M-phase inducer phosphatase 3; structural genomics, structural genomics consortium, SGC, Al alpha sandwich, kinase, cytosol, hydrolase; 2.63A {Homo sapiens} Length = 216 | Back alignment and structure |
|---|
| >2j6p_A SB(V)-AS(V) reductase; arsenate reductase, antimonate reductase, CDC25 phosphatase, rhodanese, C-MYC epitope, oxidoreductase; HET: EPE; 2.15A {Leishmania major} Length = 152 | Back alignment and structure |
|---|
| >2fsx_A RV0390, COG0607: rhodanese-related sulfurtransferase; RV0390 BR SAD DATA with FBAR, structural genomics, PSI; 1.80A {Mycobacterium tuberculosis} Length = 148 | Back alignment and structure |
|---|
| >3f4a_A Uncharacterized protein YGR203W; protein phosphatase, rhodanese-like family, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.80A {Saccharomyces cerevisiae} PDB: 3fs5_A* Length = 169 | Back alignment and structure |
|---|
| >2eg4_A Probable thiosulfate sulfurtransferase; structural genomics, NPPSFA, national Pro protein structural and functional analyses; 1.70A {Thermus thermophilus} PDB: 2eg3_A Length = 230 | Back alignment and structure |
|---|
| >3r2u_A Metallo-beta-lactamase family protein; structural genomics, for structural genomics of infectious diseases, csgid, HYDR; 2.10A {Staphylococcus aureus} Length = 466 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 131 | |||
| 3iwh_A | 103 | Rhodanese-like domain protein; alpha-beta-alpha sa | 99.26 | |
| 3foj_A | 100 | Uncharacterized protein; protein SSP1007, structur | 99.14 | |
| 3d1p_A | 139 | Putative thiosulfate sulfurtransferase YOR285W; at | 99.13 | |
| 3eme_A | 103 | Rhodanese-like domain protein; alpha-beta-alpha sa | 99.13 | |
| 1wv9_A | 94 | Rhodanese homolog TT1651; CDC25, phosphatase, sulf | 99.11 | |
| 3i2v_A | 127 | Adenylyltransferase and sulfurtransferase MOCS3; r | 99.06 | |
| 3op3_A | 216 | M-phase inducer phosphatase 3; structural genomics | 99.03 | |
| 1tq1_A | 129 | AT5G66040, senescence-associated family protein; C | 99.01 | |
| 1whb_A | 157 | KIAA0055; deubiqutinating enzyme, UBPY, structural | 99.01 | |
| 3gk5_A | 108 | Uncharacterized rhodanese-related protein TVG08686 | 99.0 | |
| 1gmx_A | 108 | GLPE protein; transferase, rhodanese, sulfurtransf | 99.0 | |
| 3nhv_A | 144 | BH2092 protein; alpha-beta protein, structural gen | 98.98 | |
| 2gwf_A | 157 | Ubiquitin carboxyl-terminal hydrolase 8; protein-p | 98.96 | |
| 2a2k_A | 175 | M-phase inducer phosphatase 2; dual specificity, s | 98.95 | |
| 1c25_A | 161 | CDC25A; hydrolase, cell cycle phosphatase,dual spe | 98.94 | |
| 3g5j_A | 134 | Putative ATP/GTP binding protein; N-terminal domai | 98.94 | |
| 2j6p_A | 152 | SB(V)-AS(V) reductase; arsenate reductase, antimon | 98.93 | |
| 2hhg_A | 139 | Hypothetical protein RPA3614; MCSG, structural gen | 98.92 | |
| 2vsw_A | 153 | Dual specificity protein phosphatase 16; hydrolase | 98.89 | |
| 2ouc_A | 142 | Dual specificity protein phosphatase 10; rhodanese | 98.88 | |
| 3ilm_A | 141 | ALR3790 protein; rhodanese-like, NSR437H, NESG, st | 98.87 | |
| 1qxn_A | 137 | SUD, sulfide dehydrogenase; polysulfide-sulfur tra | 98.87 | |
| 1t3k_A | 152 | Arath CDC25, dual-specificity tyrosine phosphatase | 98.83 | |
| 1hzm_A | 154 | Dual specificity protein phosphatase 6; hydrolase; | 98.82 | |
| 3tg1_B | 158 | Dual specificity protein phosphatase 10; kinase/rh | 98.8 | |
| 3flh_A | 124 | Uncharacterized protein LP_1913; alpha-beta protei | 98.78 | |
| 1qb0_A | 211 | Protein (M-phase inducer phosphatase 2 (CDC25B)); | 98.78 | |
| 3hix_A | 106 | ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q | 98.77 | |
| 3olh_A | 302 | MST, 3-mercaptopyruvate sulfurtransferase; structu | 98.73 | |
| 3f4a_A | 169 | Uncharacterized protein YGR203W; protein phosphata | 98.7 | |
| 2k0z_A | 110 | Uncharacterized protein HP1203; A/B domain, struct | 98.69 | |
| 1e0c_A | 271 | Rhodanese, sulfurtransferase; sulfur metabolism, t | 98.65 | |
| 4f67_A | 265 | UPF0176 protein LPG2838; structural genomics, PSI- | 98.65 | |
| 1rhs_A | 296 | Sulfur-substituted rhodanese; transferase, sulfurt | 98.63 | |
| 1e0c_A | 271 | Rhodanese, sulfurtransferase; sulfur metabolism, t | 98.63 | |
| 2fsx_A | 148 | RV0390, COG0607: rhodanese-related sulfurtransfera | 98.62 | |
| 1uar_A | 285 | Rhodanese; sulfurtransferase, riken structural gen | 98.61 | |
| 1urh_A | 280 | 3-mercaptopyruvate sulfurtransferase; rhodanese; 2 | 98.61 | |
| 3hzu_A | 318 | Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, | 98.58 | |
| 2jtq_A | 85 | Phage shock protein E; solution structure rhodanes | 98.57 | |
| 3ics_A | 588 | Coenzyme A-disulfide reductase; pyridine nucleotid | 98.55 | |
| 1rhs_A | 296 | Sulfur-substituted rhodanese; transferase, sulfurt | 98.52 | |
| 1vee_A | 134 | Proline-rich protein family; hypothetical protein, | 98.48 | |
| 1urh_A | 280 | 3-mercaptopyruvate sulfurtransferase; rhodanese; 2 | 98.46 | |
| 3olh_A | 302 | MST, 3-mercaptopyruvate sulfurtransferase; structu | 98.46 | |
| 3aay_A | 277 | Putative thiosulfate sulfurtransferase; sulfurtran | 98.44 | |
| 3aay_A | 277 | Putative thiosulfate sulfurtransferase; sulfurtran | 98.44 | |
| 1yt8_A | 539 | Thiosulfate sulfurtransferase; rhodanase domains, | 98.39 | |
| 3tp9_A | 474 | Beta-lactamase and rhodanese domain protein; struc | 98.37 | |
| 2eg4_A | 230 | Probable thiosulfate sulfurtransferase; structural | 98.36 | |
| 1okg_A | 373 | Possible 3-mercaptopyruvate sulfurtransferase; rho | 98.35 | |
| 1uar_A | 285 | Rhodanese; sulfurtransferase, riken structural gen | 98.34 | |
| 3ntd_A | 565 | FAD-dependent pyridine nucleotide-disulphide oxido | 98.33 | |
| 3tp9_A | 474 | Beta-lactamase and rhodanese domain protein; struc | 98.3 | |
| 1yt8_A | 539 | Thiosulfate sulfurtransferase; rhodanase domains, | 98.29 | |
| 3hzu_A | 318 | Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, | 98.29 | |
| 2wlr_A | 423 | Putative thiosulfate sulfurtransferase YNJE; rhoda | 98.21 | |
| 2wlr_A | 423 | Putative thiosulfate sulfurtransferase YNJE; rhoda | 98.19 | |
| 2eg4_A | 230 | Probable thiosulfate sulfurtransferase; structural | 98.14 | |
| 1okg_A | 373 | Possible 3-mercaptopyruvate sulfurtransferase; rho | 98.03 | |
| 3r2u_A | 466 | Metallo-beta-lactamase family protein; structural | 97.94 | |
| 3utn_X | 327 | Thiosulfate sulfurtransferase TUM1; rhodanese-like | 97.88 | |
| 3r2u_A | 466 | Metallo-beta-lactamase family protein; structural | 97.61 | |
| 3utn_X | 327 | Thiosulfate sulfurtransferase TUM1; rhodanese-like | 97.07 | |
| 1v8c_A | 168 | MOAD related protein; riken structural genomics/pr | 96.21 | |
| 2f46_A | 156 | Hypothetical protein; structural genomics, joint c | 91.84 |
| >3iwh_A Rhodanese-like domain protein; alpha-beta-alpha sandwich, structural genomics, C structural genomics of infectious diseases, csgid; 2.00A {Staphylococcus aureus subsp} PDB: 3mzz_A | Back alignment and structure |
|---|
Probab=99.26 E-value=2.7e-12 Score=88.24 Aligned_cols=46 Identities=24% Similarity=0.213 Sum_probs=41.2
Q ss_pred CccCHHHHHHHHhC--CCEEEeeCChhhhhcCCCCCceeeCCCCCCCC
Q 032868 73 TSVPVRVAHELLQA--GHRYLDVRTPEEFSAGHATGAINVPYMDDKEP 118 (131)
Q Consensus 73 ~~Is~~el~~l~~~--~~~LIDVRep~E~~~ghIpgAi~IPl~~i~~~ 118 (131)
++|+++|+++++.+ +++|||||++.||+.||||||+|||++++.++
T Consensus 2 k~Is~~el~~~l~~~~~~~liDvR~~~e~~~ghIpgA~~ip~~~l~~~ 49 (103)
T 3iwh_A 2 KSITTDELKNKLLESKPVQIVDVRTDEETAMGYIPNAKLIPMDTIPDN 49 (103)
T ss_dssp CEECHHHHHHGGGSSSCCEEEECSCHHHHTTCBCTTCEECCGGGGGGC
T ss_pred CCcCHHHHHHHHhCCCCeEEEECCChhHHhcCccCCcccCcccchhhh
Confidence 57999999998854 38999999999999999999999999888765
|
| >3foj_A Uncharacterized protein; protein SSP1007, structural genomics, PSI-2, protein structure initiative; 1.60A {Staphylococcus saprophyticus subsp} | Back alignment and structure |
|---|
| >3d1p_A Putative thiosulfate sulfurtransferase YOR285W; atomic structure, atomic resolution structure, PSI, MCSG; HET: MSE; 0.98A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1wv9_A Rhodanese homolog TT1651; CDC25, phosphatase, sulfurtransferase, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3i2v_A Adenylyltransferase and sulfurtransferase MOCS3; rhodanese, UBA4, structural genomics, ubiquitin biology, structural genomics consortium, SGC; 1.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3op3_A M-phase inducer phosphatase 3; structural genomics, structural genomics consortium, SGC, Al alpha sandwich, kinase, cytosol, hydrolase; 2.63A {Homo sapiens} | Back alignment and structure |
|---|
| >1tq1_A AT5G66040, senescence-associated family protein; CESG, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: c.46.1.3 | Back alignment and structure |
|---|
| >1whb_A KIAA0055; deubiqutinating enzyme, UBPY, structural genomics, riken structural genomics/proteomics initiative, RSGI, hydrolase; NMR {Homo sapiens} SCOP: c.46.1.4 | Back alignment and structure |
|---|
| >3gk5_A Uncharacterized rhodanese-related protein TVG0868615; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Thermoplasma volcanium GSS1} | Back alignment and structure |
|---|
| >1gmx_A GLPE protein; transferase, rhodanese, sulfurtransferase, glycerol metabolism; 1.1A {Escherichia coli} SCOP: c.46.1.3 PDB: 1gn0_A | Back alignment and structure |
|---|
| >3nhv_A BH2092 protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.50A {Bacillus halodurans} PDB: 3o3w_A | Back alignment and structure |
|---|
| >2gwf_A Ubiquitin carboxyl-terminal hydrolase 8; protein-protein complex, E3 ligase, protein ubiquitination, hydrolase, protease, UBL conjugation pathway; 2.30A {Homo sapiens} SCOP: c.46.1.4 | Back alignment and structure |
|---|
| >2a2k_A M-phase inducer phosphatase 2; dual specificity, substrate trapping, active site mutant, hydrolase; 1.52A {Homo sapiens} PDB: 2ifv_A 1ymd_A 1ym9_A 1ymk_A 1yml_A 1ys0_A 1cwt_A 2ifd_A | Back alignment and structure |
|---|
| >1c25_A CDC25A; hydrolase, cell cycle phosphatase,dual specificity protein phosphatase, CDK2; 2.30A {Homo sapiens} SCOP: c.46.1.1 | Back alignment and structure |
|---|
| >3g5j_A Putative ATP/GTP binding protein; N-terminal domain of ATP/GTP binding protein, PSI, MCSG, STR genomics, protein structure initiative; HET: PGE; 1.76A {Clostridium difficile} | Back alignment and structure |
|---|
| >2j6p_A SB(V)-AS(V) reductase; arsenate reductase, antimonate reductase, CDC25 phosphatase, rhodanese, C-MYC epitope, oxidoreductase; HET: EPE; 2.15A {Leishmania major} | Back alignment and structure |
|---|
| >2hhg_A Hypothetical protein RPA3614; MCSG, structural genomics, rohopseudom palustris, PSI-2, protein structure initiative; 1.20A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >2vsw_A Dual specificity protein phosphatase 16; hydrolase, dual specificity phosphatase, nucleus, cytoplasm, rhodanese domain, CAsp8; 2.20A {Homo sapiens} PDB: 3tg3_A | Back alignment and structure |
|---|
| >2ouc_A Dual specificity protein phosphatase 10; rhodanese fold, hydrolase; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3ilm_A ALR3790 protein; rhodanese-like, NSR437H, NESG, structural genomics, protein structure initiative, northeast structural genomics consortium; 2.26A {Nostoc SP} PDB: 2kl3_A | Back alignment and structure |
|---|
| >1qxn_A SUD, sulfide dehydrogenase; polysulfide-sulfur transferase, homodimer; NMR {Wolinella succinogenes} SCOP: c.46.1.3 | Back alignment and structure |
|---|
| >1t3k_A Arath CDC25, dual-specificity tyrosine phosphatase; cell cycle, phosphorylation, plant, hydrolase; NMR {Arabidopsis thaliana} SCOP: c.46.1.1 | Back alignment and structure |
|---|
| >1hzm_A Dual specificity protein phosphatase 6; hydrolase; NMR {Homo sapiens} SCOP: c.46.1.1 | Back alignment and structure |
|---|
| >3tg1_B Dual specificity protein phosphatase 10; kinase/rhodanese-like domain, docking interaction, transfera hydrolase complex; 2.71A {Homo sapiens} | Back alignment and structure |
|---|
| >3flh_A Uncharacterized protein LP_1913; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} PDB: 3fnj_A 3i3u_A | Back alignment and structure |
|---|
| >1qb0_A Protein (M-phase inducer phosphatase 2 (CDC25B)); hydrolase, cell cycle phosphatase, dual specificity protein phosphatase; 1.91A {Homo sapiens} SCOP: c.46.1.1 PDB: 1cwr_A 1cws_A 2uzq_A | Back alignment and structure |
|---|
| >3hix_A ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q8YQN0_anAsp, NSR437I, NESG, structural genomics, PSI-2, protein structure initiative; 1.92A {Anabaena SP} PDB: 3k9r_A | Back alignment and structure |
|---|
| >3olh_A MST, 3-mercaptopyruvate sulfurtransferase; structural genomics, structural genomics consortium, SGC, RH fold; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3f4a_A Uncharacterized protein YGR203W; protein phosphatase, rhodanese-like family, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.80A {Saccharomyces cerevisiae} PDB: 3fs5_A* | Back alignment and structure |
|---|
| >2k0z_A Uncharacterized protein HP1203; A/B domain, structural genomics, unknown function, PSI-2, PR structure initiative; NMR {Helicobacter pylori} | Back alignment and structure |
|---|
| >1e0c_A Rhodanese, sulfurtransferase; sulfur metabolism, thiosulfate:cyanide sulfurtransferase; 1.8A {Azotobacter vinelandii} SCOP: c.46.1.2 c.46.1.2 PDB: 1h4k_X 1h4m_X | Back alignment and structure |
|---|
| >4f67_A UPF0176 protein LPG2838; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium; 1.79A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >1rhs_A Sulfur-substituted rhodanese; transferase, sulfurtransferase; 1.36A {Bos taurus} SCOP: c.46.1.2 c.46.1.2 PDB: 1boh_A 1boi_A 1orb_A 2ora_A 1dp2_A* 1rhd_A | Back alignment and structure |
|---|
| >1e0c_A Rhodanese, sulfurtransferase; sulfur metabolism, thiosulfate:cyanide sulfurtransferase; 1.8A {Azotobacter vinelandii} SCOP: c.46.1.2 c.46.1.2 PDB: 1h4k_X 1h4m_X | Back alignment and structure |
|---|
| >2fsx_A RV0390, COG0607: rhodanese-related sulfurtransferase; RV0390 BR SAD DATA with FBAR, structural genomics, PSI; 1.80A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1uar_A Rhodanese; sulfurtransferase, riken structural genomics/PROT initiative, RSGI, structural genomics, transferase; 1.70A {Thermus thermophilus} SCOP: c.46.1.2 c.46.1.2 | Back alignment and structure |
|---|
| >1urh_A 3-mercaptopyruvate sulfurtransferase; rhodanese; 2.8A {Escherichia coli} SCOP: c.46.1.2 c.46.1.2 | Back alignment and structure |
|---|
| >3hzu_A Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, infectious disease, transferase structural genomics; 2.10A {Mycobacterium tuberculosis} PDB: 3p3a_A | Back alignment and structure |
|---|
| >2jtq_A Phage shock protein E; solution structure rhodanese, stress response, transferase; NMR {Escherichia coli} PDB: 2jtr_A 2jts_A | Back alignment and structure |
|---|
| >3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* | Back alignment and structure |
|---|
| >1rhs_A Sulfur-substituted rhodanese; transferase, sulfurtransferase; 1.36A {Bos taurus} SCOP: c.46.1.2 c.46.1.2 PDB: 1boh_A 1boi_A 1orb_A 2ora_A 1dp2_A* 1rhd_A | Back alignment and structure |
|---|
| >1vee_A Proline-rich protein family; hypothetical protein, structural genomics, rhodanese domain, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} PDB: 2dcq_A | Back alignment and structure |
|---|
| >1urh_A 3-mercaptopyruvate sulfurtransferase; rhodanese; 2.8A {Escherichia coli} SCOP: c.46.1.2 c.46.1.2 | Back alignment and structure |
|---|
| >3olh_A MST, 3-mercaptopyruvate sulfurtransferase; structural genomics, structural genomics consortium, SGC, RH fold; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3aay_A Putative thiosulfate sulfurtransferase; sulfurtranserase, structural genomics, PSI, structure initiative; 1.90A {Mycobacterium tuberculosis} PDB: 3aax_A 3hwi_A | Back alignment and structure |
|---|
| >3aay_A Putative thiosulfate sulfurtransferase; sulfurtranserase, structural genomics, PSI, structure initiative; 1.90A {Mycobacterium tuberculosis} PDB: 3aax_A 3hwi_A | Back alignment and structure |
|---|
| >1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 | Back alignment and structure |
|---|
| >3tp9_A Beta-lactamase and rhodanese domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.70A {Alicyclobacillus acidocaldarius subsp} | Back alignment and structure |
|---|
| >2eg4_A Probable thiosulfate sulfurtransferase; structural genomics, NPPSFA, national Pro protein structural and functional analyses; 1.70A {Thermus thermophilus} PDB: 2eg3_A | Back alignment and structure |
|---|
| >1okg_A Possible 3-mercaptopyruvate sulfurtransferase; rhodanese, prolyl isomerase, catalytic triad, serine protease, leishmania pyruvate; HET: CSR; 2.10A {Leishmania major} SCOP: c.46.1.2 c.46.1.2 d.26.1.3 | Back alignment and structure |
|---|
| >1uar_A Rhodanese; sulfurtransferase, riken structural genomics/PROT initiative, RSGI, structural genomics, transferase; 1.70A {Thermus thermophilus} SCOP: c.46.1.2 c.46.1.2 | Back alignment and structure |
|---|
| >3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* | Back alignment and structure |
|---|
| >3tp9_A Beta-lactamase and rhodanese domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.70A {Alicyclobacillus acidocaldarius subsp} | Back alignment and structure |
|---|
| >1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 | Back alignment and structure |
|---|
| >3hzu_A Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, infectious disease, transferase structural genomics; 2.10A {Mycobacterium tuberculosis} PDB: 3p3a_A | Back alignment and structure |
|---|
| >2wlr_A Putative thiosulfate sulfurtransferase YNJE; rhodanese domains; HET: EPE; 1.45A {Escherichia coli} PDB: 2wlx_A* 3ipo_A* 3ipp_A | Back alignment and structure |
|---|
| >2wlr_A Putative thiosulfate sulfurtransferase YNJE; rhodanese domains; HET: EPE; 1.45A {Escherichia coli} PDB: 2wlx_A* 3ipo_A* 3ipp_A | Back alignment and structure |
|---|
| >2eg4_A Probable thiosulfate sulfurtransferase; structural genomics, NPPSFA, national Pro protein structural and functional analyses; 1.70A {Thermus thermophilus} PDB: 2eg3_A | Back alignment and structure |
|---|
| >1okg_A Possible 3-mercaptopyruvate sulfurtransferase; rhodanese, prolyl isomerase, catalytic triad, serine protease, leishmania pyruvate; HET: CSR; 2.10A {Leishmania major} SCOP: c.46.1.2 c.46.1.2 d.26.1.3 | Back alignment and structure |
|---|
| >3r2u_A Metallo-beta-lactamase family protein; structural genomics, for structural genomics of infectious diseases, csgid, HYDR; 2.10A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3utn_X Thiosulfate sulfurtransferase TUM1; rhodanese-like domain; 1.90A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3r2u_A Metallo-beta-lactamase family protein; structural genomics, for structural genomics of infectious diseases, csgid, HYDR; 2.10A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3utn_X Thiosulfate sulfurtransferase TUM1; rhodanese-like domain; 1.90A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1v8c_A MOAD related protein; riken structural genomics/proteomics initiative, RSGI, structural genomics, protein binding; 1.60A {Thermus thermophilus} SCOP: d.15.3.1 d.129.5.1 | Back alignment and structure |
|---|
| >2f46_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 1.41A {Neisseria meningitidis Z2491} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 131 | ||||
| d1tq1a_ | 119 | c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senesc | 2e-17 | |
| d1hzma_ | 154 | c.46.1.1 (A:) Erk2 binding domain of Mapk phosphat | 7e-06 | |
| d1c25a_ | 161 | c.46.1.1 (A:) CDC25a {Human (Homo sapiens) [TaxId: | 7e-05 |
| >d1tq1a_ c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senescence-associated protein {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 119 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Rhodanese/Cell cycle control phosphatase superfamily: Rhodanese/Cell cycle control phosphatase family: Single-domain sulfurtransferase domain: Thiosulfate sulfurtransferase/Senescence-associated protein species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]
Score = 70.3 bits (171), Expect = 2e-17
Identities = 37/55 (67%), Positives = 41/55 (74%)
Query: 67 EAVGVPTSVPVRVAHELLQAGHRYLDVRTPEEFSAGHATGAINVPYMDDKEPEIC 121
E VP+SV V VAH+LL AGHRYLDVRTPEEFS GHA GAINVPYM+ +
Sbjct: 2 EESRVPSSVSVTVAHDLLLAGHRYLDVRTPEEFSQGHACGAINVPYMNRGASGMS 56
|
| >d1hzma_ c.46.1.1 (A:) Erk2 binding domain of Mapk phosphatase mkp-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 154 | Back information, alignment and structure |
|---|
| >d1c25a_ c.46.1.1 (A:) CDC25a {Human (Homo sapiens) [TaxId: 9606]} Length = 161 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 131 | |||
| d1gmxa_ | 108 | Sulfurtransferase GlpE {Escherichia coli [TaxId: 5 | 99.01 | |
| d1yt8a1 | 136 | Thiosulfate sulfurtransferase PA2603 {Pseudomonas | 98.99 | |
| d1t3ka_ | 132 | Dual specificity phosphatase Cdc25 {Thale cress (A | 98.99 | |
| d2gwfa1 | 135 | Ubiquitin carboxyl-terminal hydrolase 8, USP8 {Hum | 98.96 | |
| d1tq1a_ | 119 | Thiosulfate sulfurtransferase/Senescence-associate | 98.96 | |
| d1c25a_ | 161 | CDC25a {Human (Homo sapiens) [TaxId: 9606]} | 98.94 | |
| d1yt8a2 | 101 | Thiosulfate sulfurtransferase PA2603 {Pseudomonas | 98.94 | |
| d1e0ca1 | 135 | Sulfurtransferase {Azotobacter vinelandii [TaxId: | 98.93 | |
| d1e0ca2 | 136 | Sulfurtransferase {Azotobacter vinelandii [TaxId: | 98.89 | |
| d1ymka1 | 174 | CDC25b {Human (Homo sapiens) [TaxId: 9606]} | 98.87 | |
| d1yt8a4 | 130 | Thiosulfate sulfurtransferase PA2603 {Pseudomonas | 98.82 | |
| d1yt8a3 | 157 | Thiosulfate sulfurtransferase PA2603 {Pseudomonas | 98.82 | |
| d1rhsa2 | 144 | Rhodanese {Cow (Bos taurus) [TaxId: 9913]} | 98.74 | |
| d1uara2 | 141 | Sulfurtransferase {Thermus thermophilus [TaxId: 27 | 98.65 | |
| d1hzma_ | 154 | Erk2 binding domain of Mapk phosphatase mkp-3 {Hum | 98.54 | |
| d1uara1 | 143 | Sulfurtransferase {Thermus thermophilus [TaxId: 27 | 98.54 | |
| d1qxna_ | 137 | Polysulfide-sulfur transferase (sulfide dehydrogen | 98.52 | |
| d1urha1 | 147 | 3-mercaptopyruvate sulfurtransferase {Escherichia | 98.48 | |
| d1urha2 | 120 | 3-mercaptopyruvate sulfurtransferase {Escherichia | 98.41 | |
| d1rhsa1 | 149 | Rhodanese {Cow (Bos taurus) [TaxId: 9913]} | 98.41 | |
| d1okga2 | 139 | 3-mercaptopyruvate sulfurtransferase {Leishmania m | 98.28 | |
| d1okga1 | 156 | 3-mercaptopyruvate sulfurtransferase {Leishmania m | 98.17 |
| >d1gmxa_ c.46.1.3 (A:) Sulfurtransferase GlpE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Rhodanese/Cell cycle control phosphatase superfamily: Rhodanese/Cell cycle control phosphatase family: Single-domain sulfurtransferase domain: Sulfurtransferase GlpE species: Escherichia coli [TaxId: 562]
Probab=99.01 E-value=3.3e-11 Score=81.28 Aligned_cols=46 Identities=28% Similarity=0.375 Sum_probs=40.6
Q ss_pred CCccCHHHHHHHHhC-CCEEEeeCChhhhhcCCCCCceeeCCCCCCC
Q 032868 72 PTSVPVRVAHELLQA-GHRYLDVRTPEEFSAGHATGAINVPYMDDKE 117 (131)
Q Consensus 72 ~~~Is~~el~~l~~~-~~~LIDVRep~E~~~ghIpgAi~IPl~~i~~ 117 (131)
++.|+++|+.+++++ +.+|||||++.||..||||||+|+|++++..
T Consensus 4 ~~~Is~~e~~~~l~~~~~~liDvR~~~e~~~ghI~gA~~ip~~~l~~ 50 (108)
T d1gmxa_ 4 FECINVADAHQKLQEKEAVLVDIRDPQSFAMGHAVQAFHLTNDTLGA 50 (108)
T ss_dssp CEEECHHHHHHHHHTTCCEEEECSCHHHHHHCEETTCEECCHHHHHH
T ss_pred CCEeCHHHHHHHHHCCCeEEEECCCHHHHHhcCCCCcccccchhHHH
Confidence 467999999999965 5999999999999999999999999876643
|
| >d1yt8a1 c.46.1.2 (A:107-242) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1t3ka_ c.46.1.1 (A:) Dual specificity phosphatase Cdc25 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2gwfa1 c.46.1.4 (A:181-315) Ubiquitin carboxyl-terminal hydrolase 8, USP8 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tq1a_ c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senescence-associated protein {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1c25a_ c.46.1.1 (A:) CDC25a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yt8a2 c.46.1.2 (A:6-106) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1e0ca1 c.46.1.2 (A:1-135) Sulfurtransferase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1e0ca2 c.46.1.2 (A:136-271) Sulfurtransferase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1ymka1 c.46.1.1 (A:377-550) CDC25b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yt8a4 c.46.1.2 (A:243-372) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1yt8a3 c.46.1.2 (A:373-529) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1rhsa2 c.46.1.2 (A:150-293) Rhodanese {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1uara2 c.46.1.2 (A:145-285) Sulfurtransferase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1hzma_ c.46.1.1 (A:) Erk2 binding domain of Mapk phosphatase mkp-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uara1 c.46.1.2 (A:2-144) Sulfurtransferase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1qxna_ c.46.1.3 (A:) Polysulfide-sulfur transferase (sulfide dehydrogenase, Sud) {Wolinella succinogenes [TaxId: 844]} | Back information, alignment and structure |
|---|
| >d1urha1 c.46.1.2 (A:2-148) 3-mercaptopyruvate sulfurtransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1urha2 c.46.1.2 (A:149-268) 3-mercaptopyruvate sulfurtransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1rhsa1 c.46.1.2 (A:1-149) Rhodanese {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1okga2 c.46.1.2 (A:163-301) 3-mercaptopyruvate sulfurtransferase {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1okga1 c.46.1.2 (A:7-162) 3-mercaptopyruvate sulfurtransferase {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|