Citrus Sinensis ID: 032873

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-
MFNNSKRPNSVRTVSRGTIPVLASSNGSATSRRKDDSSVREPSTVFEEENPNGDSTDAPIVGIIMESDLDLPVMNDAARTLSDFGVPYEIKILPPHQNCKEALSYALSAKERGIKIIIVGDGVEAHLSGTL
ccccccccccccccccccEEEEcccHHHHHHHcccccccccccccccccccccccccccEEEEEEcccccHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHcccEEEEEcccccccccccc
cccccccccccccccEEEEEEEcccHHHHHHHHHHHHccccccccccccccccccccccEEEEEEccHHHHHHHHHHHHHHHHcccEEEEEEccccccHHHHHHHHHHcccccccEEEEEEEccccHHHcc
mfnnskrpnsvrtvsrgtipvlassngsatsrrkddssvrepstvfeeenpngdstdapivgiimesdldlpvmndaartlsdfgvpyeikilpphqncKEALSYALSAKERGIKIIIVGDGVEAHLSGTL
mfnnskrpnsvrtvsrgtipvlassngsatsrrkddssvrepstvfeeenpngdstdapIVGIIMESDLDLPVMNDAARTLSDFGVPYEIKILPPHQNCKEALSYALSAKERGIKIIIVGDGVEAHLSGTL
MFNNSKRPNSVRTVSRGTIPVLASSNGSATSRRKDDSSVREPSTVFEEENPNGDSTDAPIVGIIMESDLDLPVMNDAARTLSDFGVPYEIKILPPHQNCKEALSYALSAKERGIKIIIVGDGVEAHLSGTL
***********************************************************IVGIIMESDLDLPVMNDAARTLSDFGVPYEIKILPPHQNCKEALSYALSAKERGIKIIIVGDGVE*******
MFN**********VSRGTIPVLASSNGSAT*******************************GIIMESDLDLPVMNDAARTLSDFGVPYEIKILPPHQNCKEALSYALSAKERGIKIIIVGDGVEAHLSGTL
*************VSRGTIPVLA****************************NGDSTDAPIVGIIMESDLDLPVMNDAARTLSDFGVPYEIKILPPHQNCKEALSYALSAKERGIKIIIVGDGVEAHLSGTL
*****KRPNSVRTVSRGTIPVLASSNGSATSRRKDDSSVR****************DAPIVGIIMESDLDLPVMNDAARTLSDFGVPYEIKILPPHQNCKEALSYALSAKERGIKIIIVGDGVEAHL****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFNNSKRPNSVRTVSRGTIPVLASSNGSATSRRKDDSSVREPSTVFEEENPNGDSTDAPIVGIIMESDLDLPVMNDAARTLSDFGVPYEIKILPPHQNCKEALSYALSAKERGIKIIIVGDGVEAHLSGTL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query131 2.2.26 [Sep-21-2011]
O58058177 N5-carboxyaminoimidazole yes no 0.580 0.429 0.552 1e-17
P21264571 Phosphoribosylaminoimidaz yes no 0.969 0.222 0.386 9e-16
Q9UY68174 N5-carboxyaminoimidazole yes no 0.557 0.419 0.534 2e-14
Q92210568 Phosphoribosylaminoimidaz N/A no 0.916 0.211 0.398 2e-14
P50504557 Phosphoribosylaminoimidaz N/A no 0.923 0.217 0.374 6e-14
Q9WYS7171 N5-carboxyaminoimidazole yes no 0.557 0.426 0.520 8e-14
P15567552 Phosphoribosylaminoimidaz yes no 0.595 0.141 0.461 3e-13
O74197570 Phosphoribosylaminoimidaz yes no 0.610 0.140 0.45 9e-13
Q44679 177 N5-carboxyaminoimidazole N/A no 0.564 0.418 0.445 3e-12
Q87KE1161 N5-carboxyaminoimidazole yes no 0.526 0.428 0.536 3e-12
>sp|O58058|PURE_PYRHO N5-carboxyaminoimidazole ribonucleotide mutase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=purE PE=3 SV=1 Back     alignment and function desciption
 Score = 88.2 bits (217), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 54/76 (71%)

Query: 56  TDAPIVGIIMESDLDLPVMNDAARTLSDFGVPYEIKILPPHQNCKEALSYALSAKERGIK 115
           ++ P+VGIIM SD DLPVM +AAR L +FGVPYEI I+  H+  + A  YA  A+ERGI+
Sbjct: 7   SEKPLVGIIMGSDSDLPVMKEAARILEEFGVPYEITIISAHRTPERAYEYAKKAEERGIE 66

Query: 116 IIIVGDGVEAHLSGTL 131
           +II G G  AHL G +
Sbjct: 67  VIIAGAGGAAHLPGII 82
Catalyzes the conversion of N5-carboxyaminoimidazole ribonucleotide (N5-CAIR) to 4-carboxy-5-aminoimidazole ribonucleotide (CAIR).
Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (taxid: 70601)
EC: 5EC: .EC: 4EC: .EC: 9EC: 9EC: .EC: 1EC: 8
>sp|P21264|PUR6_YEAST Phosphoribosylaminoimidazole carboxylase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADE2 PE=1 SV=1 Back     alignment and function description
>sp|Q9UY68|PURE_PYRAB N5-carboxyaminoimidazole ribonucleotide mutase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=purE PE=3 SV=1 Back     alignment and function description
>sp|Q92210|PUR6_CANAL Phosphoribosylaminoimidazole carboxylase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ADE2 PE=3 SV=2 Back     alignment and function description
>sp|P50504|PUR6_SCHOC Phosphoribosylaminoimidazole carboxylase OS=Schwanniomyces occidentalis GN=ADE2 PE=3 SV=1 Back     alignment and function description
>sp|Q9WYS7|PURE_THEMA N5-carboxyaminoimidazole ribonucleotide mutase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=purE PE=1 SV=1 Back     alignment and function description
>sp|P15567|PUR6_SCHPO Phosphoribosylaminoimidazole carboxylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ade6 PE=3 SV=1 Back     alignment and function description
>sp|O74197|PUR6_CANGA Phosphoribosylaminoimidazole carboxylase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ADE2 PE=3 SV=2 Back     alignment and function description
>sp|Q44679|PURE_CORAM N5-carboxyaminoimidazole ribonucleotide mutase OS=Corynebacterium ammoniagenes GN=purE PE=3 SV=1 Back     alignment and function description
>sp|Q87KE1|PURE_VIBPA N5-carboxyaminoimidazole ribonucleotide mutase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=purE PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query131
13173434 623 phosphoribosylaminoimidazole carboxylase 0.885 0.186 0.424 1e-17
37983592 621 phosphoribosylaminoimidazole carboxylase 0.885 0.186 0.424 1e-17
14590237177 phosphoribosylaminoimidazole carboxylase 0.580 0.429 0.552 9e-16
449490248 586 PREDICTED: phosphoribosylaminoimidazole 0.541 0.121 0.591 7e-15
449442114 586 PREDICTED: phosphoribosylaminoimidazole 0.541 0.121 0.591 8e-15
410667200164 phosphoribosylaminoimidazole carboxylase 0.572 0.457 0.533 8e-15
193215447176 phosphoribosylaminoimidazole carboxylase 0.625 0.465 0.463 1e-14
268316597171 phosphoribosylaminoimidazole carboxylase 0.587 0.450 0.506 2e-14
154249773178 phosphoribosylaminoimidazole carboxylase 0.557 0.410 0.547 2e-14
356576720 633 PREDICTED: phosphoribosylaminoimidazole 0.679 0.140 0.483 3e-14
>gi|13173434|gb|AAK14408.1| phosphoribosylaminoimidazole carboxylase [Nicotiana tabacum] Back     alignment and taxonomy information
 Score = 94.7 bits (234), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 53/125 (42%), Positives = 72/125 (57%), Gaps = 9/125 (7%)

Query: 7   RPNSVRTVSRGTIPVLASSNGSATSRRKDDSSVREPSTVFEEENPNGDSTDAPIVGIIME 66
           +P   R    G I ++  S G   ++ +          +  EE+ NG    AP VGIIM 
Sbjct: 413 KPEMRRQRKMGHITIVGPSMGIVEAQLR---------VILNEESVNGHPAVAPRVGIIMG 463

Query: 67  SDLDLPVMNDAARTLSDFGVPYEIKILPPHQNCKEALSYALSAKERGIKIIIVGDGVEAH 126
           SD DLPVM DAA+ L++F VP E+KI+  H+  +   SYALSA+ERGI++II G G  AH
Sbjct: 464 SDSDLPVMKDAAKILNEFDVPAEVKIVSAHRTPEMMFSYALSARERGIQVIIAGAGGAAH 523

Query: 127 LSGTL 131
           L G +
Sbjct: 524 LPGMV 528

Source: Nicotiana tabacum

Species: Nicotiana tabacum

Genus: Nicotiana

Family: Solanaceae

Order: Solanales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|37983592|gb|AAR06291.1| phosphoribosylaminoimidazole carboxylase, partial [Nicotiana tabacum] Back     alignment and taxonomy information
>gi|14590237|ref|NP_142303.1| phosphoribosylaminoimidazole carboxylase catalytic subunit [Pyrococcus horikoshii OT3] gi|3914493|sp|O58058.1|PURE_PYRHO RecName: Full=N5-carboxyaminoimidazole ribonucleotide mutase; Short=N5-CAIR mutase; AltName: Full=5-(carboxyamino)imidazole ribonucleotide mutase gi|3256711|dbj|BAA29394.1| 177aa long hypothetical phosphoribosylaminoimidazole carboxylase catalytic subunit [Pyrococcus horikoshii OT3] Back     alignment and taxonomy information
>gi|449490248|ref|XP_004158550.1| PREDICTED: phosphoribosylaminoimidazole carboxylase, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449442114|ref|XP_004138827.1| PREDICTED: phosphoribosylaminoimidazole carboxylase, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|410667200|ref|YP_006919571.1| phosphoribosylaminoimidazole carboxylase catalytic subunit PurE [Thermacetogenium phaeum DSM 12270] gi|409104947|gb|AFV11072.1| phosphoribosylaminoimidazole carboxylase catalytic subunit PurE [Thermacetogenium phaeum DSM 12270] Back     alignment and taxonomy information
>gi|193215447|ref|YP_001996646.1| phosphoribosylaminoimidazole carboxylase catalytic subunit [Chloroherpeton thalassium ATCC 35110] gi|193088924|gb|ACF14199.1| phosphoribosylaminoimidazole carboxylase, catalytic subunit [Chloroherpeton thalassium ATCC 35110] Back     alignment and taxonomy information
>gi|268316597|ref|YP_003290316.1| phosphoribosylaminoimidazole carboxylase catalytic subunit [Rhodothermus marinus DSM 4252] gi|262334131|gb|ACY47928.1| phosphoribosylaminoimidazole carboxylase, catalytic subunit [Rhodothermus marinus DSM 4252] Back     alignment and taxonomy information
>gi|154249773|ref|YP_001410598.1| phosphoribosylaminoimidazole carboxylase, catalytic subunit [Fervidobacterium nodosum Rt17-B1] gi|154153709|gb|ABS60941.1| phosphoribosylaminoimidazole carboxylase, catalytic subunit [Fervidobacterium nodosum Rt17-B1] Back     alignment and taxonomy information
>gi|356576720|ref|XP_003556478.1| PREDICTED: phosphoribosylaminoimidazole carboxylase, chloroplastic-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query131
SGD|S000005654571 ADE2 "Phosphoribosylaminoimida 0.954 0.218 0.392 2e-15
CGD|CAL0003241568 ADE2 [Candida albicans (taxid: 0.809 0.186 0.443 1.1e-13
UNIPROTKB|Q92210568 ADE2 "Phosphoribosylaminoimida 0.809 0.186 0.443 1.1e-13
UNIPROTKB|P96880174 purE "N5-carboxyaminoimidazole 0.557 0.419 0.465 2.7e-13
TIGR_CMR|GSU_0611169 GSU_0611 "phosphoribosylaminoi 0.557 0.431 0.493 5.6e-13
POMBASE|SPCC1322.13552 ade6 "phosphoribosylaminoimida 0.580 0.137 0.473 9.4e-13
TAIR|locus:2040771642 AT2G37690 [Arabidopsis thalian 0.557 0.113 0.506 1.2e-12
DICTYBASE|DDB_G0283987 997 purC/E "PAICS" [Dictyostelium 0.969 0.127 0.343 2.9e-12
UNIPROTKB|Q9KVT7161 purE "N5-carboxyaminoimidazole 0.526 0.428 0.507 8.2e-12
TIGR_CMR|VC_0052161 VC_0052 "phosphoribosylaminoim 0.526 0.428 0.507 8.2e-12
SGD|S000005654 ADE2 "Phosphoribosylaminoimidazole carboxylase" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
 Score = 203 (76.5 bits), Expect = 2.0e-15, P = 2.0e-15
 Identities = 51/130 (39%), Positives = 71/130 (54%)

Query:     1 MFNNSKRPNSVRTVSRGTIPVLASSNGSATSRRKDDSSVRE-PSTVFEEENPNGDSTDAP 59
             ++    RPN  R V  G I ++ASS      R    +   + P  +   +  + ++   P
Sbjct:   348 LYGKESRPN--RKV--GHINIIASSMAECEQRLNYITGRTDIPIKISVAQKLDLEAMVKP 403

Query:    60 IVGIIMESDLDLPVMNDAARTLSDFGVPYEIKILPPHQNCKEALSYALSAKERGIKIIIV 119
             +VGIIM SD DLPVM+ A   L DFGVP+E+ I+  H+      +YA+SA +RGIK II 
Sbjct:   404 LVGIIMGSDSDLPVMSAACAVLKDFGVPFEVTIVSAHRTPHRMSAYAISASKRGIKTIIA 463

Query:   120 GDGVEAHLSG 129
             G G  AHL G
Sbjct:   464 GAGGAAHLPG 473
GO:0006189 "'de novo' IMP biosynthetic process" evidence=IEA;TAS
GO:0006164 "purine nucleotide biosynthetic process" evidence=IEA;TAS
GO:0005524 "ATP binding" evidence=IEA
GO:0034023 "5-(carboxyamino)imidazole ribonucleotide mutase activity" evidence=IEA
GO:0003824 "catalytic activity" evidence=IEA
GO:0004638 "phosphoribosylaminoimidazole carboxylase activity" evidence=IEA;IMP
GO:0046872 "metal ion binding" evidence=IEA
GO:0006144 "purine nucleobase metabolic process" evidence=IMP;TAS
GO:0005737 "cytoplasm" evidence=IDA
GO:0016829 "lyase activity" evidence=IEA
GO:0016831 "carboxy-lyase activity" evidence=IEA
GO:0000166 "nucleotide binding" evidence=IEA
CGD|CAL0003241 ADE2 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
UNIPROTKB|Q92210 ADE2 "Phosphoribosylaminoimidazole carboxylase" [Candida albicans SC5314 (taxid:237561)] Back     alignment and assigned GO terms
UNIPROTKB|P96880 purE "N5-carboxyaminoimidazole ribonucleotide mutase" [Mycobacterium tuberculosis (taxid:1773)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_0611 GSU_0611 "phosphoribosylaminoimidazole carboxylase, catalytic subunit" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
POMBASE|SPCC1322.13 ade6 "phosphoribosylaminoimidazole carboxylase Ade6" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
TAIR|locus:2040771 AT2G37690 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0283987 purC/E "PAICS" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|Q9KVT7 purE "N5-carboxyaminoimidazole ribonucleotide mutase" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms
TIGR_CMR|VC_0052 VC_0052 "phosphoribosylaminoimidazole carboxylase, catalytic subunit" [Vibrio cholerae O1 biovar El Tor (taxid:686)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query131
PLN02948577 PLN02948, PLN02948, phosphoribosylaminoimidazole c 3e-25
pfam00731150 pfam00731, AIRC, AIR carboxylase 3e-22
smart01001152 smart01001, AIRC, AIR carboxylase 6e-22
COG0041162 COG0041, PurE, Phosphoribosylcarboxyaminoimidazole 7e-22
TIGR01162156 TIGR01162, purE, phosphoribosylaminoimidazole carb 7e-20
>gnl|CDD|178534 PLN02948, PLN02948, phosphoribosylaminoimidazole carboxylase Back     alignment and domain information 
 Score = 99.0 bits (247), Expect = 3e-25
 Identities = 45/115 (39%), Positives = 58/115 (50%), Gaps = 11/115 (9%)

Query: 17  GTIPVLASSNGSATSRRKD--DSSVREPSTVFEEENPNGDSTDAPIVGIIMESDLDLPVM 74
           G I V+  S     +R          +P  + +           P+VGIIM SD DLP M
Sbjct: 376 GHITVVGPSAAEVEARLDQLLAEESADPDALPK---------GTPLVGIIMGSDSDLPTM 426

Query: 75  NDAARTLSDFGVPYEIKILPPHQNCKEALSYALSAKERGIKIIIVGDGVEAHLSG 129
            DAA  L  FGVPYE+ I+  H+  +   SYA SA  RG+++II G G  AHL G
Sbjct: 427 KDAAEILDSFGVPYEVTIVSAHRTPERMFSYARSAHSRGLQVIIAGAGGAAHLPG 481

Length = 577
>gnl|CDD|144362 pfam00731, AIRC, AIR carboxylase Back     alignment and domain information
>gnl|CDD|214965 smart01001, AIRC, AIR carboxylase Back     alignment and domain information
>gnl|CDD|223119 COG0041, PurE, Phosphoribosylcarboxyaminoimidazole (NCAIR) mutase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|130230 TIGR01162, purE, phosphoribosylaminoimidazole carboxylase, PurE protein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 131
COG0041162 PurE Phosphoribosylcarboxyaminoimidazole (NCAIR) m 100.0
PLN02948577 phosphoribosylaminoimidazole carboxylase 99.97
TIGR01162156 purE phosphoribosylaminoimidazole carboxylase, Pur 99.96
PF00731150 AIRC: AIR carboxylase; InterPro: IPR000031 Phospho 99.95
KOG2835373 consensus Phosphoribosylamidoimidazole-succinocarb 99.24
COG1691254 NCAIR mutase (PurE)-related proteins [General func 99.19
KOG2835373 consensus Phosphoribosylamidoimidazole-succinocarb 97.38
cd08170 351 GlyDH Glycerol dehydrogenases (GlyDH) catalyzes ox 96.03
cd08550 349 GlyDH-like Glycerol_dehydrogenase-like. Families o 95.92
PRK10076213 pyruvate formate lyase II activase; Provisional 95.63
cd08185 380 Fe-ADH1 Iron-containing alcohol dehydrogenases-lik 95.5
cd08183 374 Fe-ADH2 Iron-containing alcohol dehydrogenases-lik 95.1
cd08551 370 Fe-ADH iron-containing alcohol dehydrogenases (Fe- 94.96
cd08171 345 GlyDH-like2 Glycerol dehydrogenase-like. Glycerol 94.89
PRK09423 366 gldA glycerol dehydrogenase; Provisional 94.87
cd08195 345 DHQS Dehydroquinate synthase (DHQS) catalyzes the 94.84
cd08175 348 G1PDH Glycerol-1-phosphate dehydrogenase (G1PDH) c 94.72
PRK00843 350 egsA NAD(P)-dependent glycerol-1-phosphate dehydro 94.5
TIGR01357 344 aroB 3-dehydroquinate synthase. This model represe 94.47
cd08186 383 Fe-ADH8 Iron-containing alcohol dehydrogenase. Typ 94.39
cd08194 375 Fe-ADH6 Iron-containing alcohol dehydrogenases-lik 94.33
cd08182 367 HEPD Hydroxyethylphosphoate dehydrogenase (HEPD) c 94.31
cd08176 377 LPO Lactadehyde:propanediol oxidoreductase (LPO) c 94.25
PF00763117 THF_DHG_CYH: Tetrahydrofolate dehydrogenase/cycloh 94.16
PF00465 366 Fe-ADH: Iron-containing alcohol dehydrogenase ; In 94.15
cd08178 398 AAD_C C-terminal alcohol dehydrogenase domain of t 94.04
TIGR02638 379 lactal_redase lactaldehyde reductase. This clade o 93.91
cd08187 382 BDH Butanol dehydrogenase catalyzes the conversion 93.89
PRK00002 358 aroB 3-dehydroquinate synthase; Reviewed 93.69
cd0302890 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-inte 93.69
cd08197 355 DOIS 2-deoxy-scyllo-inosose synthase (DOIS) cataly 93.62
cd08192 370 Fe-ADH7 Iron-containing alcohol dehydrogenases-lik 93.61
cd08181 357 PPD-like 1,3-propanediol dehydrogenase-like (PPD). 93.51
cd08173 339 Gro1PDH Sn-glycerol-1-phosphate dehydrogenase (Gro 93.5
cd08188 377 Fe-ADH4 Iron-containing alcohol dehydrogenases-lik 93.39
PF06258311 Mito_fiss_Elm1: Mitochondrial fission ELM1; InterP 93.33
PRK10624 382 L-1,2-propanediol oxidoreductase; Provisional 93.31
cd08189 374 Fe-ADH5 Iron-containing alcohol dehydrogenases-lik 93.29
cd08179 375 NADPH_BDH NADPH-dependent butanol dehydrogenase in 93.26
PF10096 243 DUF2334: Uncharacterized protein conserved in bact 92.79
PRK15454 395 ethanol dehydrogenase EutG; Provisional 92.74
cd08193 376 HVD 5-hydroxyvalerate dehydrogenase (HVD) catalyze 92.71
TIGR0036597 monothiol glutaredoxin, Grx4 family. The gene for 92.62
cd08199 354 EEVS 2-epi-5-epi-valiolone synthase (EEVS). 2-epi- 92.61
cd08190 414 HOT Hydroxyacid-oxoacid transhydrogenase (HOT) inv 92.59
cd07766 332 DHQ_Fe-ADH Dehydroquinate synthase-like (DHQ-like) 92.5
cd08549 332 G1PDH_related Glycerol-1-phosphate_dehydrogenase a 92.05
PRK09860 383 putative alcohol dehydrogenase; Provisional 91.82
cd03786 363 GT1_UDP-GlcNAc_2-Epimerase Bacterial members of th 91.57
PRK15138 387 aldehyde reductase; Provisional 91.02
cd08191 386 HHD 6-hydroxyhexanoate dehydrogenase (HHD) catalyz 90.75
COG069580 GrxC Glutaredoxin and related proteins [Posttransl 90.57
PLN02834 433 3-dehydroquinate synthase 90.46
PF04392 294 ABC_sub_bind: ABC transporter substrate binding pr 90.02
cd0086091 ThrRS_anticodon ThrRS Threonyl-anticodon binding d 89.62
cd08177 337 MAR Maleylacetate reductase is involved in many ar 89.46
PRK11914 306 diacylglycerol kinase; Reviewed 89.15
cd0302773 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Eg 88.96
cd08180 332 PDD 1,3-propanediol dehydrogenase (PPD) catalyzes 88.3
PF13407 257 Peripla_BP_4: Periplasmic binding protein domain; 88.07
COG2984 322 ABC-type uncharacterized transport system, peripla 87.65
PRK10653 295 D-ribose transporter subunit RbsB; Provisional 87.29
PRK01372 304 ddl D-alanine--D-alanine ligase; Reviewed 87.02
PRK10014 342 DNA-binding transcriptional repressor MalI; Provis 86.97
cd01988132 Na_H_Antiporter_C The C-terminal domain of a subfa 86.75
COG1454 377 EutG Alcohol dehydrogenase, class IV [Energy produ 86.05
PRK10703 341 DNA-binding transcriptional repressor PurR; Provis 85.97
PF01380131 SIS: SIS domain SIS domain web page.; InterPro: IP 85.9
cd08169 344 DHQ-like Dehydroquinate synthase-like which includ 85.74
cd06318 282 PBP1_ABC_sugar_binding_like_9 Periplasmic sugar-bi 85.25
cd01452187 VWA_26S_proteasome_subunit 26S proteasome plays a 85.11
PRK10586 362 putative oxidoreductase; Provisional 84.64
cd08172 347 GlyDH-like1 Glycerol dehydrogenases-like. Glycerol 84.49
TIGR03702 293 lip_kinase_YegS lipid kinase YegS. Members of this 84.45
PRK13055 334 putative lipid kinase; Reviewed 84.27
PRK13805 862 bifunctional acetaldehyde-CoA/alcohol dehydrogenas 84.18
cd01539 303 PBP1_GGBP Periplasmic glucose/galactose-binding pr 84.08
cd08184 347 Fe-ADH3 Iron-containing alcohol dehydrogenases-lik 83.82
cd01391 269 Periplasmic_Binding_Protein_Type_1 Type 1 periplas 83.81
cd06305 273 PBP1_methylthioribose_binding_like Methylthioribos 83.36
cd03174265 DRE_TIM_metallolyase DRE-TIM metallolyase superfam 83.19
PRK10423 327 transcriptional repressor RbsR; Provisional 83.13
TIGR02417 327 fruct_sucro_rep D-fructose-responsive transcriptio 83.12
cd0341875 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX b 83.07
PRK13337 304 putative lipid kinase; Reviewed 83.05
COG1597 301 LCB5 Sphingosine kinase and enzymes related to euk 82.99
cd06321 271 PBP1_ABC_sugar_binding_like_11 Periplasmic sugar-b 82.95
cd06273 268 PBP1_GntR_like_1 This group includes the ligand-bi 82.84
cd01542 259 PBP1_TreR_like Ligand-binding domain of DNA transc 82.55
PRK14190 284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 82.41
cd07943263 DRE_TIM_HOA 4-hydroxy-2-oxovalerate aldolase, N-te 82.24
cd0479587 SIS SIS domain. SIS (Sugar ISomerase) domains are 82.19
cd0085991 HisRS_anticodon HisRS Histidyl-anticodon binding d 81.87
PF0046260 Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Gl 81.82
cd05212140 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding dom 81.7
cd08174 331 G1PDH-like Glycerol-1-phosphate dehydrogenase-like 81.24
PF02882160 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cycl 80.98
PLN02958 481 diacylglycerol kinase/D-erythro-sphingosine kinase 80.78
PRK11303 328 DNA-binding transcriptional regulator FruR; Provis 80.39
cd06296 270 PBP1_CatR_like Ligand-binding domain of a LacI-lik 80.3
>COG0041 PurE Phosphoribosylcarboxyaminoimidazole (NCAIR) mutase [Nucleotide transport and metabolism] Back     alignment and domain information 
Probab=100.00  E-value=2.5e-34  Score=222.09  Aligned_cols=73  Identities=47%  Similarity=0.813  Sum_probs=71.6

Q ss_pred             CeEEEEeccCCCHHHHHHHHHHHHHhCCCeeEEEEcCCCChHHHHHHHHHHhhCCCeEEEEecCcCCcCcCCC
Q 032873           59 PIVGIIMESDLDLPVMNDAARTLSDFGVPYEIKILPPHQNCKEALSYALSAKERGIKIIIVGDGVEAHLSGTL  131 (131)
Q Consensus        59 ~~V~IimGS~SDl~~~~ka~~~L~~fGI~~ev~V~SAHRtp~~~~~~~~~~~~~g~~ViIA~AG~aAhLpGvv  131 (131)
                      ++|+|||||+|||++|++|+++|++|||+||++|+||||||+++.+|+++++++|++||||+||+||||||||
T Consensus         3 ~~V~IIMGS~SD~~~mk~Aa~~L~~fgi~ye~~VvSAHRTPe~m~~ya~~a~~~g~~viIAgAGgAAHLPGmv   75 (162)
T COG0041           3 PKVGIIMGSKSDWDTMKKAAEILEEFGVPYEVRVVSAHRTPEKMFEYAEEAEERGVKVIIAGAGGAAHLPGMV   75 (162)
T ss_pred             ceEEEEecCcchHHHHHHHHHHHHHcCCCeEEEEEeccCCHHHHHHHHHHHHHCCCeEEEecCcchhhcchhh
Confidence            3899999999999999999999999999999999999999999999999999999999999999999999996

>PLN02948 phosphoribosylaminoimidazole carboxylase Back     alignment and domain information
>TIGR01162 purE phosphoribosylaminoimidazole carboxylase, PurE protein Back     alignment and domain information
>PF00731 AIRC: AIR carboxylase; InterPro: IPR000031 Phosphoribosylaminoimidazole carboxylase is a fusion protein in plants and fungi, but consists of two non-interacting proteins in bacteria, PurK and PurE Back     alignment and domain information
>KOG2835 consensus Phosphoribosylamidoimidazole-succinocarboxamide synthase [Nucleotide transport and metabolism] Back     alignment and domain information
>COG1691 NCAIR mutase (PurE)-related proteins [General function prediction only] Back     alignment and domain information
>KOG2835 consensus Phosphoribosylamidoimidazole-succinocarboxamide synthase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd08170 GlyDH Glycerol dehydrogenases (GlyDH) catalyzes oxidation of glycerol to dihydroxyacetone in glycerol dissmilation Back     alignment and domain information
>cd08550 GlyDH-like Glycerol_dehydrogenase-like Back     alignment and domain information
>PRK10076 pyruvate formate lyase II activase; Provisional Back     alignment and domain information
>cd08185 Fe-ADH1 Iron-containing alcohol dehydrogenases-like Back     alignment and domain information
>cd08183 Fe-ADH2 Iron-containing alcohol dehydrogenases-like Back     alignment and domain information
>cd08551 Fe-ADH iron-containing alcohol dehydrogenases (Fe-ADH)-like Back     alignment and domain information
>cd08171 GlyDH-like2 Glycerol dehydrogenase-like Back     alignment and domain information
>PRK09423 gldA glycerol dehydrogenase; Provisional Back     alignment and domain information
>cd08195 DHQS Dehydroquinate synthase (DHQS) catalyzes the conversion of DAHP to DHQ in shikimate pathway for aromatic compounds synthesis Back     alignment and domain information
>cd08175 G1PDH Glycerol-1-phosphate dehydrogenase (G1PDH) catalyzes the reversible reduction of dihydroxyacetone phosphate (DHAP) to glycerol-1-phosphate (G1P) in an NADH-dependent manner Back     alignment and domain information
>PRK00843 egsA NAD(P)-dependent glycerol-1-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01357 aroB 3-dehydroquinate synthase Back     alignment and domain information
>cd08186 Fe-ADH8 Iron-containing alcohol dehydrogenase Back     alignment and domain information
>cd08194 Fe-ADH6 Iron-containing alcohol dehydrogenases-like Back     alignment and domain information
>cd08182 HEPD Hydroxyethylphosphoate dehydrogenase (HEPD) catalyzes the reduction of phosphonoacetaldehyde (PnAA) to hydroxyethylphosphoate (HEP) Back     alignment and domain information
>cd08176 LPO Lactadehyde:propanediol oxidoreductase (LPO) catalyzes the interconversion between L-lactaldehyde and L-1,2-propanediol in Escherichia coli and other enterobacteria Back     alignment and domain information
>PF00763 THF_DHG_CYH: Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain; InterPro: IPR020630 Enzymes that participate in the transfer of one-carbon units require the coenzyme tetrahydrofolate (THF) Back     alignment and domain information
>PF00465 Fe-ADH: Iron-containing alcohol dehydrogenase ; InterPro: IPR001670 Alcohol dehydrogenase (1 Back     alignment and domain information
>cd08178 AAD_C C-terminal alcohol dehydrogenase domain of the acetaldehyde dehydrogenase-alcohol dehydrogenase bifunctional two-domain protein (AAD) Back     alignment and domain information
>TIGR02638 lactal_redase lactaldehyde reductase Back     alignment and domain information
>cd08187 BDH Butanol dehydrogenase catalyzes the conversion of butyraldehyde to butanol with the cofactor NAD(P)H being oxidized in the process Back     alignment and domain information
>PRK00002 aroB 3-dehydroquinate synthase; Reviewed Back     alignment and domain information
>cd03028 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-interacting cousin of TRX (PICOT)-like subfamily; composed of PICOT and GRX-PICOT-like proteins Back     alignment and domain information
>cd08197 DOIS 2-deoxy-scyllo-inosose synthase (DOIS) catalyzes carbocycle formation from D-glucose-6-phosphate to 2-deoxy-scyllo-inosose through a multistep reaction in the biosynthesis of aminoglycoside antibiotics Back     alignment and domain information
>cd08192 Fe-ADH7 Iron-containing alcohol dehydrogenases-like, involved in the linear alkylbenzenesulfonate (LAS) degradation pathway Back     alignment and domain information
>cd08181 PPD-like 1,3-propanediol dehydrogenase-like (PPD) Back     alignment and domain information
>cd08173 Gro1PDH Sn-glycerol-1-phosphate dehydrogenase (Gro1PDH) catalyzes the reversible conversion between dihydroxyacetone phosphate and glycerol-1-phosphate using either NADH or NADPH as a coenzyme Back     alignment and domain information
>cd08188 Fe-ADH4 Iron-containing alcohol dehydrogenases-like Back     alignment and domain information
>PF06258 Mito_fiss_Elm1: Mitochondrial fission ELM1; InterPro: IPR009367 This family consists of several hypothetical eukaryotic and prokaryotic proteins Back     alignment and domain information
>PRK10624 L-1,2-propanediol oxidoreductase; Provisional Back     alignment and domain information
>cd08189 Fe-ADH5 Iron-containing alcohol dehydrogenases-like Back     alignment and domain information
>cd08179 NADPH_BDH NADPH-dependent butanol dehydrogenase involved in the butanol and ethanol formation pathway in bacteria Back     alignment and domain information
>PF10096 DUF2334: Uncharacterized protein conserved in bacteria (DUF2334); InterPro: IPR018763 This group of proteins has no known function Back     alignment and domain information
>PRK15454 ethanol dehydrogenase EutG; Provisional Back     alignment and domain information
>cd08193 HVD 5-hydroxyvalerate dehydrogenase (HVD) catalyzes the oxidation of 5-hydroxyvalerate to 5-oxovalerate with NAD+ as cofactor Back     alignment and domain information
>TIGR00365 monothiol glutaredoxin, Grx4 family Back     alignment and domain information
>cd08199 EEVS 2-epi-5-epi-valiolone synthase (EEVS) Back     alignment and domain information
>cd08190 HOT Hydroxyacid-oxoacid transhydrogenase (HOT) involved in gamma-hydroxybutyrate metabolism Back     alignment and domain information
>cd07766 DHQ_Fe-ADH Dehydroquinate synthase-like (DHQ-like) and iron-containing alcohol dehydrogenases (Fe-ADH) Back     alignment and domain information
>cd08549 G1PDH_related Glycerol-1-phosphate_dehydrogenase and related proteins Back     alignment and domain information
>PRK09860 putative alcohol dehydrogenase; Provisional Back     alignment and domain information
>cd03786 GT1_UDP-GlcNAc_2-Epimerase Bacterial members of the UDP-N-Acetylglucosamine (GlcNAc) 2-Epimerase family are known to catalyze the reversible interconversion of UDP-GlcNAc and UDP-N-acetylmannosamine (UDP-ManNAc) Back     alignment and domain information
>PRK15138 aldehyde reductase; Provisional Back     alignment and domain information
>cd08191 HHD 6-hydroxyhexanoate dehydrogenase (HHD) catalyzes the oxidation of 6-hydroxyhexanoate to 6-oxohexanoate Back     alignment and domain information
>COG0695 GrxC Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02834 3-dehydroquinate synthase Back     alignment and domain information
>PF04392 ABC_sub_bind: ABC transporter substrate binding protein; InterPro: IPR007487 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>cd00860 ThrRS_anticodon ThrRS Threonyl-anticodon binding domain Back     alignment and domain information
>cd08177 MAR Maleylacetate reductase is involved in many aromatic compounds degradation pathways of aerobic microbes Back     alignment and domain information
>PRK11914 diacylglycerol kinase; Reviewed Back     alignment and domain information
>cd03027 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Egl-10, and Pleckstrin (DEP) subfamily; composed of uncharacterized proteins containing a GRX domain and additional domains DEP and DUF547, both of which have unknown functions Back     alignment and domain information
>cd08180 PDD 1,3-propanediol dehydrogenase (PPD) catalyzes the reduction of 3-hydroxypropionaldehyde (3-HPA) to 1,3-propanediol in glycerol metabolism Back     alignment and domain information
>PF13407 Peripla_BP_4: Periplasmic binding protein domain; PDB: 3BRS_B 3GBP_A 3GA5_A 1GCG_A 1GCA_A 3H75_A 3D02_A 3L49_B 3EJW_B 3T95_A Back     alignment and domain information
>COG2984 ABC-type uncharacterized transport system, periplasmic component [General function prediction only] Back     alignment and domain information
>PRK10653 D-ribose transporter subunit RbsB; Provisional Back     alignment and domain information
>PRK01372 ddl D-alanine--D-alanine ligase; Reviewed Back     alignment and domain information
>PRK10014 DNA-binding transcriptional repressor MalI; Provisional Back     alignment and domain information
>cd01988 Na_H_Antiporter_C The C-terminal domain of a subfamily of Na+ /H+ antiporter existed in bacteria and archea Back     alignment and domain information
>COG1454 EutG Alcohol dehydrogenase, class IV [Energy production and conversion] Back     alignment and domain information
>PRK10703 DNA-binding transcriptional repressor PurR; Provisional Back     alignment and domain information
>PF01380 SIS: SIS domain SIS domain web page Back     alignment and domain information
>cd08169 DHQ-like Dehydroquinate synthase-like which includes dehydroquinate synthase, 2-deoxy-scyllo-inosose synthase, and 2-epi-5-epi-valiolone synthase Back     alignment and domain information
>cd06318 PBP1_ABC_sugar_binding_like_9 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>cd01452 VWA_26S_proteasome_subunit 26S proteasome plays a major role in eukaryotic protein breakdown, especially for ubiquitin-tagged proteins Back     alignment and domain information
>PRK10586 putative oxidoreductase; Provisional Back     alignment and domain information
>cd08172 GlyDH-like1 Glycerol dehydrogenases-like Back     alignment and domain information
>TIGR03702 lip_kinase_YegS lipid kinase YegS Back     alignment and domain information
>PRK13055 putative lipid kinase; Reviewed Back     alignment and domain information
>PRK13805 bifunctional acetaldehyde-CoA/alcohol dehydrogenase; Provisional Back     alignment and domain information
>cd01539 PBP1_GGBP Periplasmic glucose/galactose-binding protein (GGBP) involved in chemotaxis towards, and active transport of, glucose and galactose in various bacterial species Back     alignment and domain information
>cd08184 Fe-ADH3 Iron-containing alcohol dehydrogenases-like Back     alignment and domain information
>cd01391 Periplasmic_Binding_Protein_Type_1 Type 1 periplasmic binding fold superfamily Back     alignment and domain information
>cd06305 PBP1_methylthioribose_binding_like Methylthioribose-binding protein-like of ABC-type transport systems that belong to a family of pentose/hexose sugar-binding proteins of the type I periplasmic binding protein (PBP1) superfamily Back     alignment and domain information
>cd03174 DRE_TIM_metallolyase DRE-TIM metallolyase superfamily Back     alignment and domain information
>PRK10423 transcriptional repressor RbsR; Provisional Back     alignment and domain information
>TIGR02417 fruct_sucro_rep D-fructose-responsive transcription factor Back     alignment and domain information
>cd03418 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX bacterial class 1 and 3 (b_1_3)-like subfamily; composed of bacterial GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>PRK13337 putative lipid kinase; Reviewed Back     alignment and domain information
>COG1597 LCB5 Sphingosine kinase and enzymes related to eukaryotic diacylglycerol kinase [Lipid metabolism / General function prediction only] Back     alignment and domain information
>cd06321 PBP1_ABC_sugar_binding_like_11 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>cd06273 PBP1_GntR_like_1 This group includes the ligand-binding domain of putative DNA transcription repressors which are highly similar to that of the repressor specific for gluconate (GntR), a member of the LacI-GalR family of bacterial transcription regulators Back     alignment and domain information
>cd01542 PBP1_TreR_like Ligand-binding domain of DNA transcription repressor specific for trehalose (TreR) which is a member of the LacI-GalR family of bacterial transcription regulators Back     alignment and domain information
>PRK14190 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd07943 DRE_TIM_HOA 4-hydroxy-2-oxovalerate aldolase, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>cd04795 SIS SIS domain Back     alignment and domain information
>cd00859 HisRS_anticodon HisRS Histidyl-anticodon binding domain Back     alignment and domain information
>PF00462 Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors Back     alignment and domain information
>cd05212 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>cd08174 G1PDH-like Glycerol-1-phosphate dehydrogenase-like Back     alignment and domain information
>PF02882 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain; InterPro: IPR020631 Enzymes that participate in the transfer of one-carbon units require the coenzyme tetrahydrofolate (THF) Back     alignment and domain information
>PLN02958 diacylglycerol kinase/D-erythro-sphingosine kinase Back     alignment and domain information
>PRK11303 DNA-binding transcriptional regulator FruR; Provisional Back     alignment and domain information
>cd06296 PBP1_CatR_like Ligand-binding domain of a LacI-like transcriptional regulator, CatR which is involved in catechol degradation Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query131
1o4v_A183 Crystal Structure Of The Catalytic Subunit Of A Pho 7e-15
3lp6_A174 Crystal Structure Of Rv3275c-E60a From Mycobacteriu 1e-10
4grd_A173 Crystal Structure Of Phosphoribosylaminoimidazole C 1e-10
1xmp_A170 Crystal Structure Of Pure (Ba0288) From Bacillus An 6e-10
4b4k_A181 Crystal Structure Of Bacillus Anthracis Pure Length 6e-10
2fw1_A183 Structure Of Pure (n5-carboxyaminoimidazole Ribonuc 9e-10
1u11_A182 Pure (N5-Carboxyaminoimidazole Ribonucleotide Mutas 9e-10
2fwa_A183 Structure Of Pure (n5-carboxyaminoimidazole Ribonuc 8e-09
2fw6_A183 Structure Of Pure (N5-Carboxyaminoimidazole Ribonuc 8e-09
3oow_A166 Octameric Structure Of The Phosphoribosylaminoimida 1e-08
2fwb_A183 Structure Of Pure (N5-Carboxyaminoimidazole Ribonuc 1e-08
2fw9_A183 Structure Of Pure (n5-carboxyaminoimidazole Ribonuc 1e-08
3opq_A163 Phosphoribosylaminoimidazole Carboxylase With Fruct 1e-08
2fwi_A183 Structure Of Pure (n5-carboxyaminoimidazole Ribonuc 2e-08
2nsh_A169 E. Coli Pure H45q Mutant Complexed With Nitro-Air L 1e-06
2nsl_A169 E. Coli Pure H45n Mutant Complexed With Cair Length 2e-06
2fw8_A183 Structure Of Pure (N5-Carboxyaminoimidazole Ribonuc 2e-06
3kuu_A174 Structure Of The Pure Phosphoribosylaminoimidazole 5e-06
1qcz_A169 Crystal Structure Of E. Coli Pure, An Unusual Mutas 6e-06
2ate_A169 Structure Of The Complex Of Pure With Nitroair Leng 6e-06
1d7a_A161 Crystal Structure Of E. Coli Pure-Mononucleotide Co 9e-06
3trh_A169 Structure Of A Phosphoribosylaminoimidazole Carboxy 3e-04
3ors_A163 Crystal Structure Of N5-Carboxyaminoimidazole Ribon 4e-04
>pdb|1O4V|A Chain A, Crystal Structure Of The Catalytic Subunit Of A Phosphoribosylaminoimidazole Mutase (Tm0446) From Thermotoga Maritima At 1.77 A Resolution Length = 183 Back     alignment and structure 
Iteration: 1

 Score = 75.9 bits (185), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 47/73 (64%)
Query: 59  PIVGIIMESDLDLPVMNDAARTLSDFGVPYEIKILPPHQNCKEALSYALSAKERGIKIII 118
           P VGIIM SD DLPVM  AA  L +FG+ YEI I+  H+       YA +A+ERGI++II
Sbjct: 14  PRVGIIMGSDSDLPVMKQAAEILEEFGIDYEITIVSAHRTPDRMFEYAKNAEERGIEVII 73
Query: 119 VGDGVEAHLSGTL 131
            G G  AHL G +
Sbjct: 74  AGAGGAAHLPGMV 86
>pdb|3LP6|A Chain A, Crystal Structure Of Rv3275c-E60a From Mycobacterium Tubercu 1.7a Resolution Length = 174 Back     alignment and structure
>pdb|4GRD|A Chain A, Crystal Structure Of Phosphoribosylaminoimidazole Carboxylase Catalytic Subunit From Burkholderia Cenocepacia J2315 Length = 173 Back     alignment and structure
>pdb|1XMP|A Chain A, Crystal Structure Of Pure (Ba0288) From Bacillus Anthracis At 1.8 Resolution Length = 170 Back     alignment and structure
>pdb|4B4K|A Chain A, Crystal Structure Of Bacillus Anthracis Pure Length = 181 Back     alignment and structure
>pdb|2FW1|A Chain A, Structure Of Pure (n5-carboxyaminoimidazole Ribonucleotide Mutase) From The Acidophilic Bacterium Acetobacter Aceti, At Ph 8.5 Length = 183 Back     alignment and structure
>pdb|1U11|A Chain A, Pure (N5-Carboxyaminoimidazole Ribonucleotide Mutase) From The Acidophile Acetobacter Aceti Length = 182 Back     alignment and structure
>pdb|2FWA|A Chain A, Structure Of Pure (n5-carboxyaminoimidazole Ribonucleotide Mutase) H89n From The Acidophilic Bacterium Acetobacter Aceti, At Ph 7 Length = 183 Back     alignment and structure
>pdb|2FW6|A Chain A, Structure Of Pure (N5-Carboxyaminoimidazole Ribonucleotide Mutase) Mutant H59n From The Acidophilic Bacterium Acetobacter Aceti, At Ph 5.4 Length = 183 Back     alignment and structure
>pdb|3OOW|A Chain A, Octameric Structure Of The Phosphoribosylaminoimidazole Carboxylase Catalytic Subunit From Francisella Tularensis Subsp. Tularensis Schu S4. Length = 166 Back     alignment and structure
>pdb|2FWB|A Chain A, Structure Of Pure (N5-Carboxyaminoimidazole Ribonucleotide Mutase) H89f From The Acidophilic Bacterium Acetobacter Aceti, At Ph 8 Length = 183 Back     alignment and structure
>pdb|2FW9|A Chain A, Structure Of Pure (n5-carboxyaminoimidazole Ribonucleotide Mutase) H59f From The Acidophilic Bacterium Acetobacter Aceti, At Ph 8 Length = 183 Back     alignment and structure
>pdb|3OPQ|A Chain A, Phosphoribosylaminoimidazole Carboxylase With Fructose-6-Phosphate Bound To The Central Channel Of The Octameric Protein Structure. Length = 163 Back     alignment and structure
>pdb|2FWI|A Chain A, Structure Of Pure (n5-carboxyaminoimidazole Ribonucleotide Mutase) H59d, From The Acidophilic Bacterium Acetobacter Aceti, Complexed With 5-aminoimidazole Ribonucleotide (air) Length = 183 Back     alignment and structure
>pdb|2NSH|A Chain A, E. Coli Pure H45q Mutant Complexed With Nitro-Air Length = 169 Back     alignment and structure
>pdb|2NSL|A Chain A, E. Coli Pure H45n Mutant Complexed With Cair Length = 169 Back     alignment and structure
>pdb|2FW8|A Chain A, Structure Of Pure (N5-Carboxyaminoimidazole Ribonucleotide Mutase) H89g From The Acidophilic Bacterium Acetobacter Aceti, At Ph 8 Length = 183 Back     alignment and structure
>pdb|3KUU|A Chain A, Structure Of The Pure Phosphoribosylaminoimidazole Carboxylase Catalytic Subunit From Yersinia Pestis Length = 174 Back     alignment and structure
>pdb|1QCZ|A Chain A, Crystal Structure Of E. Coli Pure, An Unusual Mutase That Catalyzes The Conversion Of N5-carboxyaminoimidazole Ribonucleotide (n5-cair) To 4-carboxyaminoimidazole Ribonucleotide (cair) In The Purine Biosynthetic Pathway Length = 169 Back     alignment and structure
>pdb|2ATE|A Chain A, Structure Of The Complex Of Pure With Nitroair Length = 169 Back     alignment and structure
>pdb|1D7A|A Chain A, Crystal Structure Of E. Coli Pure-Mononucleotide Complex. Length = 161 Back     alignment and structure
>pdb|3TRH|A Chain A, Structure Of A Phosphoribosylaminoimidazole Carboxylase Catalytic Subunit (Pure) From Coxiella Burnetii Length = 169 Back     alignment and structure
>pdb|3ORS|A Chain A, Crystal Structure Of N5-Carboxyaminoimidazole Ribonucleotide Mutase From Staphylococcus Aureus Length = 163 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query131
1o4v_A183 Phosphoribosylaminoimidazole mutase PURE; structur 2e-26
3lp6_A174 Phosphoribosylaminoimidazole carboxylase catalyti; 1e-25
3trh_A169 Phosphoribosylaminoimidazole carboxylase carboxylt 8e-24
3ors_A163 N5-carboxyaminoimidazole ribonucleotide mutase; is 2e-23
3rg8_A159 Phosphoribosylaminoimidazole carboxylase, PURE PR; 2e-23
4b4k_A181 N5-carboxyaminoimidazole ribonucleotide mutase; is 5e-23
1xmp_A170 PURE, phosphoribosylaminoimidazole carboxylase; pu 7e-23
3kuu_A174 Phosphoribosylaminoimidazole carboxylase catalyti 1e-22
3oow_A166 Phosphoribosylaminoimidazole carboxylase,catalyic; 3e-22
1u11_A182 PURE (N5-carboxyaminoimidazole ribonucleotide MUT; 4e-22
2ywx_A157 Phosphoribosylaminoimidazole carboxylase catalyti; 4e-19
2h31_A425 Multifunctional protein ADE2; alpha-beta-alpha, li 1e-13
>1o4v_A Phosphoribosylaminoimidazole mutase PURE; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; 1.77A {Thermotoga maritima} SCOP: c.23.8.1 Length = 183 Back     alignment and structure
 Score = 96.2 bits (240), Expect = 2e-26
 Identities = 38/82 (46%), Positives = 48/82 (58%)

Query: 48  EENPNGDSTDAPIVGIIMESDLDLPVMNDAARTLSDFGVPYEIKILPPHQNCKEALSYAL 107
            +  +      P VGIIM SD DLPVM  AA  L +FG+ YEI I+  H+       YA 
Sbjct: 3   SDKIHHHHHHVPRVGIIMGSDSDLPVMKQAAEILEEFGIDYEITIVSAHRTPDRMFEYAK 62

Query: 108 SAKERGIKIIIVGDGVEAHLSG 129
           +A+ERGI++II G G  AHL G
Sbjct: 63  NAEERGIEVIIAGAGGAAHLPG 84
>3lp6_A Phosphoribosylaminoimidazole carboxylase catalyti; alpha and beta protein, structural genomics, PSI-2, protein initiative; 1.70A {Mycobacterium tuberculosis} Length = 174 Back     alignment and structure
>3trh_A Phosphoribosylaminoimidazole carboxylase carboxyltransferase subunit; purines, pyrimidines, nucleosides, nucleotides, lyase; 2.20A {Coxiella burnetii} Length = 169 Back     alignment and structure
>3ors_A N5-carboxyaminoimidazole ribonucleotide mutase; isomerase, isomerase,biosynthetic protein; 1.45A {Staphylococcus aureus subsp} Length = 163 Back     alignment and structure
>3rg8_A Phosphoribosylaminoimidazole carboxylase, PURE PR; purine biosynthesis, lyase; 1.74A {Treponema denticola} PDB: 3rgg_A* Length = 159 Back     alignment and structure
>4b4k_A N5-carboxyaminoimidazole ribonucleotide mutase; isomerase; 2.50A {Bacillus anthracis} Length = 181 Back     alignment and structure
>1xmp_A PURE, phosphoribosylaminoimidazole carboxylase; purine biosynthesis, spine, lyase; 1.80A {Bacillus anthracis} SCOP: c.23.8.1 Length = 170 Back     alignment and structure
>3kuu_A Phosphoribosylaminoimidazole carboxylase catalyti PURE; 3-layer (ABA) sandwich, rossmann fold, csgid, lyase, structu genomics; 1.41A {Yersinia pestis} PDB: 1d7a_A* 1qcz_A 2ate_A* 2nsl_A* 2nsh_A* 2nsj_A* Length = 174 Back     alignment and structure
>3oow_A Phosphoribosylaminoimidazole carboxylase,catalyic; structural genomics, center for structural genomics of infec diseases, csgid; HET: MSE; 1.75A {Francisella tularensis subsp} PDB: 3opq_A* Length = 166 Back     alignment and structure
>1u11_A PURE (N5-carboxyaminoimidazole ribonucleotide MUT; acidophIle, protein stability, lyase; HET: CIT; 1.55A {Acetobacter aceti} SCOP: c.23.8.1 PDB: 2fwj_A* 2fw1_A* 2fwb_A 2fwa_A 2fw9_A 2fw7_A 2fw6_A 2fwp_A* 2fwi_A* 2fw8_A Length = 182 Back     alignment and structure
>2ywx_A Phosphoribosylaminoimidazole carboxylase catalyti; rossmann fold, structural genomics, NPPSFA; 2.31A {Methanocaldococcus jannaschii} Length = 157 Back     alignment and structure
>2h31_A Multifunctional protein ADE2; alpha-beta-alpha, ligase, lyase; 2.80A {Homo sapiens} Length = 425 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query131
4b4k_A181 N5-carboxyaminoimidazole ribonucleotide mutase; is 99.97
2h31_A425 Multifunctional protein ADE2; alpha-beta-alpha, li 99.97
4grd_A173 N5-CAIR mutase, phosphoribosylaminoimidazole carbo 99.97
1xmp_A170 PURE, phosphoribosylaminoimidazole carboxylase; pu 99.96
3trh_A169 Phosphoribosylaminoimidazole carboxylase carboxylt 99.96
3kuu_A174 Phosphoribosylaminoimidazole carboxylase catalyti 99.96
3ors_A163 N5-carboxyaminoimidazole ribonucleotide mutase; is 99.96
3oow_A166 Phosphoribosylaminoimidazole carboxylase,catalyic; 99.96
3rg8_A159 Phosphoribosylaminoimidazole carboxylase, PURE PR; 99.96
1u11_A182 PURE (N5-carboxyaminoimidazole ribonucleotide MUT; 99.96
3lp6_A174 Phosphoribosylaminoimidazole carboxylase catalyti; 99.96
1o4v_A183 Phosphoribosylaminoimidazole mutase PURE; structur 99.96
2ywx_A157 Phosphoribosylaminoimidazole carboxylase catalyti; 99.94
3uhj_A 387 Probable glycerol dehydrogenase; structural genomi 95.2
1jq5_A 370 Glycerol dehydrogenase; oxidoreductase, NAD, glyce 94.88
3bfj_A 387 1,3-propanediol oxidoreductase; opportunistic path 94.31
1o2d_A 371 Alcohol dehydrogenase, iron-containing; TM0920, st 93.76
3okf_A 390 3-dehydroquinate synthase; structural genomics, ce 93.57
3ce9_A 354 Glycerol dehydrogenase; NP_348253.1, 3-dehydroquin 93.16
3ox4_A 383 Alcohol dehydrogenase 2; iron, NAD, oxidoreductase 93.13
1rrm_A 386 Lactaldehyde reductase; structural genomics, dehyd 92.36
1ta9_A 450 Glycerol dehydrogenase; oxidoredu; 1.90A {Schizosa 92.31
1vlj_A 407 NADH-dependent butanol dehydrogenase; TM0820, stru 92.25
1sg6_A 393 Pentafunctional AROM polypeptide; shikimate pathwa 92.16
3s99_A 356 Basic membrane lipoprotein; ssgcid, structural gen 90.54
3zyw_A111 Glutaredoxin-3; metal binding protein; 1.84A {Homo 90.16
3l49_A 291 ABC sugar (ribose) transporter, periplasmic substr 90.09
3h5o_A 339 Transcriptional regulator GNTR; transcription regu 89.92
3ipz_A109 Monothiol glutaredoxin-S14, chloroplastic; electro 89.59
3dbi_A 338 Sugar-binding transcriptional regulator, LACI FAM; 89.3
1oj7_A 408 Hypothetical oxidoreductase YQHD; structural genom 89.11
3egc_A 291 Putative ribose operon repressor; structural genom 89.06
3hl0_A 353 Maleylacetate reductase; structur genomics, PSI-2, 89.03
2gru_A 368 2-deoxy-scyllo-inosose synthase; aminoglycoside, 2 88.42
3kjx_A 344 Transcriptional regulator, LACI family; LACL famil 88.22
3eth_A355 Phosphoribosylaminoimidazole carboxylase ATPase su 88.16
1aba_A87 Glutaredoxin; electron transport; HET: MES; 1.45A 87.92
3jzd_A 358 Iron-containing alcohol dehydrogenase; YP_298327.1 87.54
3qbe_A 368 3-dehydroquinate synthase; shikimate pathway, myco 87.26
3o1i_D 304 Periplasmic protein TORT; ligand free, two compone 86.95
3e3m_A 355 Transcriptional regulator, LACI family; structural 86.86
3lft_A 295 Uncharacterized protein; ABC, ATPase, cassette, L- 86.78
3msz_A89 Glutaredoxin 1; alpha-beta sandwich, center for st 86.15
3m9w_A 313 D-xylose-binding periplasmic protein; xylose bindi 86.15
1xah_A 354 Sadhqs, 3-dehydroquinate synthase; shikimate pathw 85.88
1nvm_A 345 HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered 85.47
2o20_A 332 Catabolite control protein A; CCPA, transcriptiona 85.05
3jy6_A 276 Transcriptional regulator, LACI family; NYSGXRC, P 85.01
3dlo_A155 Universal stress protein; unknown function, struct 84.99
3gx8_A121 Monothiol glutaredoxin-5, mitochondrial; TRX fold, 84.92
2wem_A118 Glutaredoxin-related protein 5; chromosome 14 open 84.89
3ctp_A 330 Periplasmic binding protein/LACI transcriptional; 84.76
3lkv_A 302 Uncharacterized conserved domain protein; ATPase b 84.75
1dbq_A 289 Purine repressor; transcription regulation, DNA-bi 84.55
3l6u_A 293 ABC-type sugar transport system periplasmic compo; 83.72
3jvd_A 333 Transcriptional regulators; structural genomics, P 83.6
1byk_A 255 Protein (trehalose operon repressor); LACI family, 83.58
2hqb_A 296 Transcriptional activator of COMK gene; berkeley s 83.56
1tjy_A 316 Sugar transport protein; protein-ligand complex, s 83.4
2fn9_A 290 Ribose ABC transporter, periplasmic ribose-bindin; 83.25
1wik_A109 Thioredoxin-like protein 2; picot homology 2 domai 83.2
3miz_A 301 Putative transcriptional regulator protein, LACI f 82.94
2iks_A 293 DNA-binding transcriptional dual regulator; escher 82.89
1ujn_A 348 Dehydroquinate synthase; riken structu genomics/pr 82.86
2yan_A105 Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {H 82.7
3c3k_A 285 Alanine racemase; structural genomics, protein str 82.64
3uug_A 330 Multiple sugar-binding periplasmic receptor CHVE; 82.32
3bil_A 348 Probable LACI-family transcriptional regulator; st 82.09
3hs3_A 277 Ribose operon repressor; PSI-II, NYSGXRC, periplas 81.66
3h75_A 350 Periplasmic sugar-binding domain protein; protein 81.62
3kke_A 303 LACI family transcriptional regulator; structural 81.37
2wci_A135 Glutaredoxin-4; redox-active center, iron-sulfur c 81.34
3gyb_A 280 Transcriptional regulators (LACI-family transcript 81.06
3qmx_A99 Glutaredoxin A, glutaredoxin 3; electron transport 80.46
1mjh_A162 Protein (ATP-binding domain of protein MJ0577); hy 80.46
3ksm_A 276 ABC-type sugar transport system, periplasmic COMP; 80.35
3hgm_A147 Universal stress protein TEAD; rossman fold, signa 80.33
2qh8_A 302 Uncharacterized protein; conserved domain protein, 80.15
2vo9_A179 EAD500, L-alanyl-D-glutamate peptidase; cell WALL 80.13
>4b4k_A N5-carboxyaminoimidazole ribonucleotide mutase; isomerase; 2.50A {Bacillus anthracis} Back     alignment and structure
Probab=99.97  E-value=1.2e-32  Score=215.55  Aligned_cols=77  Identities=39%  Similarity=0.646  Sum_probs=72.6

Q ss_pred             CCCCCeEEEEeccCCCHHHHHHHHHHHHHhCCCeeEEEEcCCCChHHHHHHHHHHhhCCCeEEEEecCcCCcCcCCC
Q 032873           55 STDAPIVGIIMESDLDLPVMNDAARTLSDFGVPYEIKILPPHQNCKEALSYALSAKERGIKIIIVGDGVEAHLSGTL  131 (131)
Q Consensus        55 ~~~~~~V~IimGS~SDl~~~~ka~~~L~~fGI~~ev~V~SAHRtp~~~~~~~~~~~~~g~~ViIA~AG~aAhLpGvv  131 (131)
                      ..++|+|+|||||+|||++|++|.++|++|||+||++|+||||+|+++.+|+++++++|++||||+||++|||||||
T Consensus        19 ~~mkp~V~IimGS~SD~~v~~~a~~~L~~~gI~~e~~V~SAHRtp~~l~~~~~~a~~~g~~ViIa~AG~aahLpGvv   95 (181)
T 4b4k_A           19 SHMKSLVGVIMGSTSDWETMKYACDILDELNIPYEKKVVSAHRTPDYMFEYAETARERGLKVIIAGAGGAAHLPGMV   95 (181)
T ss_dssp             ---CCSEEEEESSGGGHHHHHHHHHHHHHTTCCEEEEECCTTTSHHHHHHHHHHTTTTTCCEEEEEECSSCCHHHHH
T ss_pred             CCCCccEEEEECCHhHHHHHHHHHHHHHHcCCCeeEEEEccccChHHHHHHHHHHHhcCceEEEEeccccccchhhH
Confidence            45678999999999999999999999999999999999999999999999999999999999999999999999985
>2h31_A Multifunctional protein ADE2; alpha-beta-alpha, ligase, lyase; 2.80A {Homo sapiens} Back     alignment and structure
>4grd_A N5-CAIR mutase, phosphoribosylaminoimidazole carboxylase catalyti; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures; 1.85A {Burkholderia cenocepacia} Back     alignment and structure
>1xmp_A PURE, phosphoribosylaminoimidazole carboxylase; purine biosynthesis, spine, lyase; 1.80A {Bacillus anthracis} SCOP: c.23.8.1 Back     alignment and structure
>3trh_A Phosphoribosylaminoimidazole carboxylase carboxyltransferase subunit; purines, pyrimidines, nucleosides, nucleotides, lyase; 2.20A {Coxiella burnetii} Back     alignment and structure
>3kuu_A Phosphoribosylaminoimidazole carboxylase catalyti PURE; 3-layer (ABA) sandwich, rossmann fold, csgid, lyase, structu genomics; 1.41A {Yersinia pestis} SCOP: c.23.8.1 PDB: 1d7a_A* 1qcz_A 2ate_A* 2nsl_A* 2nsh_A* 2nsj_A* Back     alignment and structure
>3ors_A N5-carboxyaminoimidazole ribonucleotide mutase; isomerase, isomerase,biosynthetic protein; 1.45A {Staphylococcus aureus subsp} Back     alignment and structure
>3oow_A Phosphoribosylaminoimidazole carboxylase,catalyic; structural genomics, center for structural genomics of infec diseases, csgid; HET: MSE; 1.75A {Francisella tularensis subsp} SCOP: c.23.8.1 PDB: 3opq_A* Back     alignment and structure
>3rg8_A Phosphoribosylaminoimidazole carboxylase, PURE PR; purine biosynthesis, lyase; 1.74A {Treponema denticola} SCOP: c.23.8.0 PDB: 3rgg_A* Back     alignment and structure
>1u11_A PURE (N5-carboxyaminoimidazole ribonucleotide MUT; acidophIle, protein stability, lyase; HET: CIT; 1.55A {Acetobacter aceti} SCOP: c.23.8.1 PDB: 2fwj_A* 2fw1_A* 2fwb_A 2fwa_A 2fw9_A 2fw7_A 2fw6_A 2fwp_A* 2fwi_A* 2fw8_A Back     alignment and structure
>3lp6_A Phosphoribosylaminoimidazole carboxylase catalyti; alpha and beta protein, structural genomics, PSI-2, protein initiative; 1.70A {Mycobacterium tuberculosis} SCOP: c.23.8.0 Back     alignment and structure
>1o4v_A Phosphoribosylaminoimidazole mutase PURE; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; 1.77A {Thermotoga maritima} SCOP: c.23.8.1 Back     alignment and structure
>2ywx_A Phosphoribosylaminoimidazole carboxylase catalyti; rossmann fold, structural genomics, NPPSFA; 2.31A {Methanocaldococcus jannaschii} Back     alignment and structure
>3uhj_A Probable glycerol dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.34A {Sinorhizobium meliloti} Back     alignment and structure
>1jq5_A Glycerol dehydrogenase; oxidoreductase, NAD, glycerol metabolism; HET: NAD; 1.70A {Geobacillus stearothermophilus} SCOP: e.22.1.2 PDB: 1jpu_A* 1jqa_A* Back     alignment and structure
>3bfj_A 1,3-propanediol oxidoreductase; opportunistic pathogens, decamer, structural genomics,struct proteomics in europe, spine; 2.70A {Klebsiella pneumoniae} Back     alignment and structure
>1o2d_A Alcohol dehydrogenase, iron-containing; TM0920, structural genomics, JCSG, PSI, protein structure initiative; HET: MSE NAP TRS; 1.30A {Thermotoga maritima} SCOP: e.22.1.2 PDB: 1vhd_A* Back     alignment and structure
>3okf_A 3-dehydroquinate synthase; structural genomics, center for structural genomics of infec diseases, csgid, NAD, lyase; HET: NAD; 2.50A {Vibrio cholerae o1 biovar eltor} Back     alignment and structure
>3ce9_A Glycerol dehydrogenase; NP_348253.1, 3-dehydroquinate syntha structural genomics, joint center for structural genomics; HET: MSE; 2.37A {Clostridium acetobutylicum atcc 824} Back     alignment and structure
>3ox4_A Alcohol dehydrogenase 2; iron, NAD, oxidoreductase; HET: NAD; 2.00A {Zymomonas mobilis} PDB: 3owo_A* Back     alignment and structure
>1rrm_A Lactaldehyde reductase; structural genomics, dehydrogenase, PSI, protein structure initiative; HET: APR; 1.60A {Escherichia coli} SCOP: e.22.1.2 PDB: 2bi4_A* 2bl4_A* Back     alignment and structure
>1ta9_A Glycerol dehydrogenase; oxidoredu; 1.90A {Schizosaccharomyces pombe} Back     alignment and structure
>1vlj_A NADH-dependent butanol dehydrogenase; TM0820, structural G JCSG, protein structure initiative, PSI, joint center for S genomics; HET: NAP; 1.78A {Thermotoga maritima} SCOP: e.22.1.2 Back     alignment and structure
>1sg6_A Pentafunctional AROM polypeptide; shikimate pathway, aromatic amino acid biosynthesis, DHQS, O form J, domain movement, cyclase, lyase; HET: NAD; 1.70A {Emericella nidulans} SCOP: e.22.1.1 PDB: 1nr5_A* 1nrx_A* 1nua_A 1nva_A* 1nvb_A* 1nvd_A* 1nve_A* 1nvf_A* 1dqs_A* Back     alignment and structure
>3s99_A Basic membrane lipoprotein; ssgcid, structural genomics, SEA structural genomics center for infectious disease, adenine; HET: ADE; 2.05A {Brucella melitensis biovar abortus} Back     alignment and structure
>3zyw_A Glutaredoxin-3; metal binding protein; 1.84A {Homo sapiens} Back     alignment and structure
>3l49_A ABC sugar (ribose) transporter, periplasmic substrate-binding subunit; sugar binding/transporter, structural genomics, PSI; HET: UNL; 2.30A {Rhodobacter sphaeroides} Back     alignment and structure
>3h5o_A Transcriptional regulator GNTR; transcription regulator, GNTR,chromobacterium violaceum, PSI, SGX, DNA-binding; 2.30A {Chromobacterium violaceum} Back     alignment and structure
>3ipz_A Monothiol glutaredoxin-S14, chloroplastic; electron transport, PL redox-active center, transit peptide, transport, oxidoreduc; 2.40A {Arabidopsis thaliana} PDB: 2lku_A Back     alignment and structure
>3dbi_A Sugar-binding transcriptional regulator, LACI FAM; structural genomics, sugar-binding transcriptional regulator structure initiative, PSI-2; HET: MSE; 2.45A {Escherichia coli K12} Back     alignment and structure
>1oj7_A Hypothetical oxidoreductase YQHD; structural genomics; HET: NZQ; 2.0A {Escherichia coli} SCOP: e.22.1.2 Back     alignment and structure
>3egc_A Putative ribose operon repressor; structural genomics, unknown function, DNA-binding, transcri transcription regulation, PSI-2; 2.35A {Burkholderia thailandensis} Back     alignment and structure
>3hl0_A Maleylacetate reductase; structur genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; HET: MSE NAD EPE; 1.60A {Agrobacterium tumefaciens str} Back     alignment and structure
>2gru_A 2-deoxy-scyllo-inosose synthase; aminoglycoside, 2-deoxystreptamine, dehydroquinate synthase, lyase; HET: NAD EXO CAK; 2.15A {Bacillus circulans} PDB: 2d2x_A* Back     alignment and structure
>3kjx_A Transcriptional regulator, LACI family; LACL family, protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.33A {Silicibacter pomeroyi} Back     alignment and structure
>3eth_A Phosphoribosylaminoimidazole carboxylase ATPase subunit; ATP-grAsp, purine biosynthesis, antimicrobial, ATP-binding, decarboxylase, lyase; HET: ATP; 1.60A {Escherichia coli} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 PDB: 1b6r_A* 3etj_A* 1b6s_A* Back     alignment and structure
>1aba_A Glutaredoxin; electron transport; HET: MES; 1.45A {Enterobacteria phage T4} SCOP: c.47.1.1 PDB: 1aaz_A 1de1_A 1de2_A Back     alignment and structure
>3jzd_A Iron-containing alcohol dehydrogenase; YP_298327.1, putative alcohol dehedrogenase, structural GENO joint center for structural genomics; HET: MSE NAD PG4 P6G PGE; 2.10A {Ralstonia eutropha} Back     alignment and structure
>3qbe_A 3-dehydroquinate synthase; shikimate pathway, mycobacte tuberculosis, nicotinamide adenine dinucleotide (NAD)-depen enzyme; 2.07A {Mycobacterium tuberculosis} PDB: 3qbd_A Back     alignment and structure
>3o1i_D Periplasmic protein TORT; ligand free, two component sensor, periplasmic binding prote signaling protein; HET: PE4; 2.80A {Vibrio parahaemolyticus} PDB: 3o1h_B* 3o1j_C Back     alignment and structure
>3e3m_A Transcriptional regulator, LACI family; structural genomics, DNA-binding, plasmid, transcription regulation, PSI-2; 1.60A {Silicibacter pomeroyi} Back     alignment and structure
>3lft_A Uncharacterized protein; ABC, ATPase, cassette, L-Trp, PSI, MCSG, structural genomics center for structural genomics; HET: MSE TRP; 1.35A {Streptococcus pneumoniae} Back     alignment and structure
>3msz_A Glutaredoxin 1; alpha-beta sandwich, center for structural genomics of infec diseases, csgid, oxidoreductase; HET: GSH; 2.05A {Francisella tularensis subsp} PDB: 3lgc_A* Back     alignment and structure
>3m9w_A D-xylose-binding periplasmic protein; xylose binding protein, conformational changes, SUGA protein; 2.15A {Escherichia coli} PDB: 3m9x_A* 3ma0_A* Back     alignment and structure
>1xah_A Sadhqs, 3-dehydroquinate synthase; shikimate pathway, aromatic amino acid biosynthesis, open form, form B, domain movement, cyclase; HET: NAD; 2.20A {Staphylococcus aureus} PDB: 1xag_A* 1xai_A* 1xaj_A* 1xal_A* Back     alignment and structure
>1nvm_A HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: a.5.7.1 c.1.10.5 Back     alignment and structure
>2o20_A Catabolite control protein A; CCPA, transcriptional regulator, helix-turn-helix, transcrip; 1.90A {Lactococcus lactis} Back     alignment and structure
>3jy6_A Transcriptional regulator, LACI family; NYSGXRC, PSI-II, protein S initiative, structural genomics; 1.97A {Lactobacillus brevis} Back     alignment and structure
>3dlo_A Universal stress protein; unknown function, structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics; HET: MSE; 1.97A {Archaeoglobus fulgidus} PDB: 3qtb_A* Back     alignment and structure
>3gx8_A Monothiol glutaredoxin-5, mitochondrial; TRX fold, electron transport, mitochondrion, redox-active center, transit peptide, transport; 1.67A {Saccharomyces cerevisiae} Back     alignment and structure
>3ctp_A Periplasmic binding protein/LACI transcriptional; structural genomics, protein structure initiative; HET: XLF; 1.41A {Alkaliphilus metalliredigens} Back     alignment and structure
>3lkv_A Uncharacterized conserved domain protein; ATPase binding cassette, PSI, MCSG, structural genomics, Pro structure initiative; HET: PHE; 2.20A {Vibrio cholerae} Back     alignment and structure
>1dbq_A Purine repressor; transcription regulation, DNA-binding regulatory protein; 2.20A {Escherichia coli} SCOP: c.93.1.1 PDB: 1jhz_A Back     alignment and structure
>3l6u_A ABC-type sugar transport system periplasmic compo; structural genomics, nysgrc, target 11006S, PSI-2, protein S initiative; 1.90A {Exiguobacterium sibiricum} Back     alignment and structure
>3jvd_A Transcriptional regulators; structural genomics, PSI-2, sugar binding protein, transcrip regulation, protein structure initiative; 2.30A {Corynebacterium glutamicum} Back     alignment and structure
>1byk_A Protein (trehalose operon repressor); LACI family, phosphate binding, protein structure, trehalose repressor, gene regulation; HET: T6P; 2.50A {Escherichia coli} SCOP: c.93.1.1 Back     alignment and structure
>2hqb_A Transcriptional activator of COMK gene; berkeley structure genomics center target 1957B, structural genomics, PSI; 2.70A {Bacillus halodurans} Back     alignment and structure
>1tjy_A Sugar transport protein; protein-ligand complex, signaling protein; HET: PAV; 1.30A {Salmonella typhimurium} SCOP: c.93.1.1 PDB: 1tm2_A 3t95_A* 3ejw_A* Back     alignment and structure
>2fn9_A Ribose ABC transporter, periplasmic ribose-bindin; RBP, ribose binding protein, periplasmic binding protein, thermophilic proteins; 1.40A {Thermotoga maritima} PDB: 2fn8_A* Back     alignment and structure
>1wik_A Thioredoxin-like protein 2; picot homology 2 domain, picot protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 Back     alignment and structure
>3miz_A Putative transcriptional regulator protein, LACI family; LACL family, protein structure initiative II (PSI II), NYSGXRC, structural genomics; 1.91A {Rhizobium etli} Back     alignment and structure
>2iks_A DNA-binding transcriptional dual regulator; escherichia coli structural genomics, PSI-2, protein structure initiative; 1.85A {Escherichia coli} Back     alignment and structure
>1ujn_A Dehydroquinate synthase; riken structu genomics/proteomics initiative, RSGI, structural genomics,; 1.80A {Thermus thermophilus} SCOP: e.22.1.1 Back     alignment and structure
>2yan_A Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {Homo sapiens} Back     alignment and structure
>3c3k_A Alanine racemase; structural genomics, protein structure initiative, NEW YORK research center for structural genomics, nysgxrc; 1.99A {Actinobacillus succinogenes} Back     alignment and structure
>3uug_A Multiple sugar-binding periplasmic receptor CHVE; periplasmic binding protein, sugar-binding protein, sugar binding protein; HET: BDP; 1.75A {Agrobacterium tumefaciens} PDB: 3urm_A* Back     alignment and structure
>3bil_A Probable LACI-family transcriptional regulator; structural genomics, unknown function, PSI-2, protein structure initiative; 2.50A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3hs3_A Ribose operon repressor; PSI-II, NYSGXRC, periplasmic binding protein, structural genomics, protein structure initiative; 1.60A {Lactobacillus acidophilus} Back     alignment and structure
>3h75_A Periplasmic sugar-binding domain protein; protein structure initiative II (PSI II), sugar binding PROT alpha/beta fold; 1.60A {Pseudomonas fluorescens pf-5} Back     alignment and structure
>3kke_A LACI family transcriptional regulator; structural genomics, DNA-binding, transcription regulation, PSI-2; 2.20A {Mycobacterium smegmatis str} Back     alignment and structure
>2wci_A Glutaredoxin-4; redox-active center, iron-sulfur cluster scaffolder, Fe2S2, homodimer, transport, glutathione, thioredoxin fold; HET: GSH; 1.90A {Escherichia coli} PDB: 1yka_A Back     alignment and structure
>3gyb_A Transcriptional regulators (LACI-family transcriptional regulatory protein); protein structure initiative II(PSI II), nysgxrc; 1.60A {Corynebacterium glutamicum} Back     alignment and structure
>3qmx_A Glutaredoxin A, glutaredoxin 3; electron transport; 1.82A {Synechocystis SP} SCOP: c.47.1.0 Back     alignment and structure
>1mjh_A Protein (ATP-binding domain of protein MJ0577); hypothetical protein, structural genomics, functional assignment; HET: ATP; 1.70A {Methanocaldococcus jannaschii} SCOP: c.26.2.4 Back     alignment and structure
>3ksm_A ABC-type sugar transport system, periplasmic COMP; periplasmic component, PSI- 11023L, structural genomics, protein structure initiative; HET: BDR; 1.90A {Hahella chejuensis} Back     alignment and structure
>3hgm_A Universal stress protein TEAD; rossman fold, signaling protein; HET: ATP; 1.90A {Halomonas elongata} SCOP: c.26.2.0 Back     alignment and structure
>2vo9_A EAD500, L-alanyl-D-glutamate peptidase; cell WALL biogenesis/degradation, secreted, cell WALL, hydro; 1.8A {Bacteriophage A500} SCOP: d.65.1.5 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 131
d1qcza_163 c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoi 4e-18
d1o4va_169 c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoi 5e-17
d1xmpa_155 c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoi 7e-17
d1u11a_159 c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoi 4e-16
>d1qcza_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Escherichia coli [TaxId: 562]} Length = 163 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Flavodoxin-like
superfamily: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE)
family: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE)
domain: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE)
species: Escherichia coli [TaxId: 562]

 Score = 73.4 bits (180), Expect = 4e-18
 Identities = 25/73 (34%), Positives = 38/73 (52%)

Query: 59  PIVGIIMESDLDLPVMNDAARTLSDFGVPYEIKILPPHQNCKEALSYALSAKERGIKIII 118
             V I+M S  D   M  AA       VP+ ++++  H+   +  S+A SA+E G ++II
Sbjct: 2   ARVAIVMGSKSDWATMQFAAEIFEILNVPHHVEVVSAHRTPDKLFSFAESAEENGYQVII 61

Query: 119 VGDGVEAHLSGTL 131
            G G  AHL G +
Sbjct: 62  AGAGGAAHLPGMI 74
>d1o4va_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Thermotoga maritima [TaxId: 2336]} Length = 169 Back     information, alignment and structure
>d1xmpa_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Bacillus anthracis [TaxId: 1392]} Length = 155 Back     information, alignment and structure
>d1u11a_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Acetobacter aceti [TaxId: 435]} Length = 159 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query131
d1qcza_163 N5-CAIR mutase (phosphoribosylaminoimidazole carbo 99.96
d1u11a_159 N5-CAIR mutase (phosphoribosylaminoimidazole carbo 99.96
d1xmpa_155 N5-CAIR mutase (phosphoribosylaminoimidazole carbo 99.96
d1o4va_169 N5-CAIR mutase (phosphoribosylaminoimidazole carbo 99.95
d3etja179 N5-carboxyaminoimidazole ribonucleotide synthetase 96.0
d1jq5a_ 366 Glycerol dehydrogenase {Bacillus stearothermophilu 95.32
d1o2da_ 359 Alcohol dehydrogenase TM0920 {Thermotoga maritima 94.65
d2bona1 295 Lipid kinase YegS {Escherichia coli [TaxId: 562]} 93.55
d2dria_ 271 D-ribose-binding protein {Escherichia coli, strain 93.54
d1vlja_ 398 NADH-dependent butanol dehydrogenase A (TM0820) {T 93.18
d1rrma_ 385 Lactaldehyde reductase FucO {Escherichia coli [Tax 92.13
d1byka_ 255 Trehalose repressor, C-terminal domain {Escherichi 90.64
d1tjya_ 316 AI-2 receptor LsrB {Salmonella typhi [TaxId: 90370 90.53
d1guda_ 288 D-allose-binding protein {Escherichia coli [TaxId: 89.25
d1a4ia2125 Tetrahydrofolate dehydrogenase/cyclohydrolase {Hum 89.22
d1kjqa174 Glycinamide ribonucleotide transformylase PurT, C- 88.69
d2nzug1 275 Glucose-resistance amylase regulator CcpA, C-termi 87.63
d1zl0a2167 LD-carboxypeptidase A, N-terminal domain {Pseudomo 87.07
d1gpua3146 Transketolase (TK), C-domain {Baker's yeast (Sacch 86.78
d2qv7a1 312 Diacylglycerol kinase DgkB {Staphylococcus aureus 86.65
d1g94a2 354 Bacterial alpha-amylase {Pseudoalteromonas halopla 86.43
d1jx6a_ 338 Quorum-sensing signal (autoinducer-2) binding prot 84.52
d1wika_109 Thioredoxin-like protein 2 {Mouse (Mus musculus) [ 84.04
d1b0aa2121 Tetrahydrofolate dehydrogenase/cyclohydrolase {Esc 83.71
d1utaa_77 Cell division protein FtsN {Escherichia coli [TaxI 83.69
d2pjua1186 Propionate catabolism operon regulatory protein Pr 83.67
d2rhca1 257 beta-keto acyl carrier protein reductase {Streptom 83.58
d1fova_82 Glutaredoxin (Grx, thioltransferase) {Escherichia 83.2
d1b5ta_ 275 Methylenetetrahydrofolate reductase {Escherichia c 82.79
d1oj7a_ 390 Hypothetical oxidoreductase yqhD {Escherichia coli 82.49
d2r8oa3136 Transketolase (TK), C-domain {Escherichia coli [Ta 82.06
d2bd0a1 240 Bacterial sepiapterin reductase {Chlorobium tepidu 81.48
d1b0aa1166 Methylenetetrahydrofolate dehydrogenase/cyclohydro 81.09
d1zema1 260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 80.91
d2fvya1 305 Galactose/glucose-binding protein {Escherichia col 80.81
d1dbqa_ 282 Purine repressor (PurR), C-terminal domain {Escher 80.72
>d1qcza_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Flavodoxin-like
superfamily: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE)
family: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE)
domain: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE)
species: Escherichia coli [TaxId: 562]

Probab=99.96  E-value=5.4e-31  Score=201.26  Aligned_cols=73  Identities=34%  Similarity=0.531  Sum_probs=71.4

Q ss_pred             CeEEEEeccCCCHHHHHHHHHHHHHhCCCeeEEEEcCCCChHHHHHHHHHHhhCCCeEEEEecCcCCcCcCCC
Q 032873           59 PIVGIIMESDLDLPVMNDAARTLSDFGVPYEIKILPPHQNCKEALSYALSAKERGIKIIIVGDGVEAHLSGTL  131 (131)
Q Consensus        59 ~~V~IimGS~SDl~~~~ka~~~L~~fGI~~ev~V~SAHRtp~~~~~~~~~~~~~g~~ViIA~AG~aAhLpGvv  131 (131)
                      ++|+|||||+||+++|+++.++|++|||+||++|+||||+|+++.+|+++++++|++||||+||+||||||||
T Consensus         2 aKV~IImGS~SD~~~~~~a~~~L~~~gI~~e~~v~SAHRtp~~l~~~~~~~~~~~~~ViIa~AG~aa~Lpgvv   74 (163)
T d1qcza_           2 ARVAIVMGSKSDWATMQFAAEIFEILNVPHHVEVVSAHRTPDKLFSFAESAEENGYQVIIAGAGGAAHLPGMI   74 (163)
T ss_dssp             CCEEEEESSGGGHHHHHHHHHHHHHHTCCEEEEECCTTTCHHHHHHHHHHTTTTTCSEEEEEECSSCCHHHHH
T ss_pred             CeEEEEECcHhhHHHHHHHHHHHHHcCCCeEEEEeccccCHHHHHHHHHHHHHcCCeEEEEeccCCCcccchh
Confidence            6899999999999999999999999999999999999999999999999999999999999999999999985
>d1u11a_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Acetobacter aceti [TaxId: 435]} Back     information, alignment and structure
>d1xmpa_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Bacillus anthracis [TaxId: 1392]} Back     information, alignment and structure
>d1o4va_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d3etja1 b.84.2.1 (A:277-355) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), C-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jq5a_ e.22.1.2 (A:) Glycerol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1o2da_ e.22.1.2 (A:) Alcohol dehydrogenase TM0920 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2bona1 e.52.1.2 (A:5-299) Lipid kinase YegS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2dria_ c.93.1.1 (A:) D-ribose-binding protein {Escherichia coli, strain k-12 [TaxId: 562]} Back     information, alignment and structure
>d1vlja_ e.22.1.2 (A:) NADH-dependent butanol dehydrogenase A (TM0820) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1rrma_ e.22.1.2 (A:) Lactaldehyde reductase FucO {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1byka_ c.93.1.1 (A:) Trehalose repressor, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tjya_ c.93.1.1 (A:) AI-2 receptor LsrB {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d1guda_ c.93.1.1 (A:) D-allose-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a4ia2 c.58.1.2 (A:2-126) Tetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kjqa1 b.84.2.1 (A:319-392) Glycinamide ribonucleotide transformylase PurT, C-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2nzug1 c.93.1.1 (G:58-332) Glucose-resistance amylase regulator CcpA, C-terminal domain {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1zl0a2 c.23.16.7 (A:3-169) LD-carboxypeptidase A, N-terminal domain {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1gpua3 c.48.1.1 (A:535-680) Transketolase (TK), C-domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2qv7a1 e.52.1.2 (A:1-312) Diacylglycerol kinase DgkB {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1g94a2 c.1.8.1 (A:1-354) Bacterial alpha-amylase {Pseudoalteromonas haloplanktis (Alteromonas haloplanktis) [TaxId: 228]} Back     information, alignment and structure
>d1jx6a_ c.93.1.1 (A:) Quorum-sensing signal (autoinducer-2) binding protein LuxP {Vibrio harveyi [TaxId: 669]} Back     information, alignment and structure
>d1wika_ c.47.1.1 (A:) Thioredoxin-like protein 2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1b0aa2 c.58.1.2 (A:2-122) Tetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1utaa_ d.58.52.1 (A:) Cell division protein FtsN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pjua1 c.92.3.1 (A:11-196) Propionate catabolism operon regulatory protein PrpR {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1fova_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli, Grx3 [TaxId: 562]} Back     information, alignment and structure
>d1b5ta_ c.1.23.1 (A:) Methylenetetrahydrofolate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oj7a_ e.22.1.2 (A:) Hypothetical oxidoreductase yqhD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2r8oa3 c.48.1.1 (A:528-663) Transketolase (TK), C-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d2fvya1 c.93.1.1 (A:2-306) Galactose/glucose-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dbqa_ c.93.1.1 (A:) Purine repressor (PurR), C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure