Citrus Sinensis ID: 032893

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-
MAKVHDFQEVAKHNNRDDCWLVISGKVYNVTPFLEDHPGGDEVLLAATEKDATDDFEDVGHSDSAREMMEKYHIGEIDSSSVPAKRKYTPPQQAVNSPEDTGSAAKILQFLVPMLILGIAFAFRYFSKKEE
cccEEcHHHHHHHcccccEEEEEccEEEEccccccccccHHHHHHHcccccccHHcccccccHHHHHHHHHcEEEEEcccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccc
cccEEcHHHHHccEccccEEEEEccEEEEccccccccccccHHHHHccccEcHHHHHHHcccHHHHHHHHHHEEEEEcHHHcccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccc
makvhdfqevakhnnrddcwlvisgkvynvtpfledhpggdEVLLAATekdatddfedvghsdsAREMMEKYHIgeidsssvpakrkytppqqavnspedtgSAAKILQFLVPMLILGIAFAFRYFSKKEE
makvhdfqevakhnnrddcwlvISGKVYNVTPFLEDHPGGDEVLLAAtekdatddfeDVGHSDSAREMMEKYHIGeidsssvpakRKYTppqqavnspeDTGSAAKILQFLVPMLILGIAFAFRYFSKKEE
MAKVHDFQEVAKHNNRDDCWLVISGKVYNVTPFLEDHPGGDEVLLAATEKDATDDFEDVGHSDSAREMMEKYHIGEIDSSSVPAKRKYTPPQQAVNSPEDTGSAAKILQFLVPMLILGIAFAFRYFSKKEE
*************NNRDDCWLVISGKVYNVTPFLEDHPGGDEVLL***********************************************************AKILQFLVPMLILGIAFAFRYF*****
*AKVHDFQEVAKHNNRDDCWLVISGKVYNVTPFLEDHPGGDEVLLAATEKDATDDFEDVGHSDSAREMMEKYHIGEID*****************************LQFLVPMLILGIAFAFRYFSKK**
MAKVHDFQEVAKHNNRDDCWLVISGKVYNVTPFLEDHPGGDEVLLAATEKDATDDFEDVGHSDSAREMMEKYHIGEIDSSS*********************SAAKILQFLVPMLILGIAFAFRYFSKKEE
*AKVHDFQEVAKHNNRDDCWLVISGKVYNVTPFLEDHPGGDEVLLAATEKDATDDFEDVGHSDSAREMMEKYHIGEIDSSSV******************TGSAAKILQFLVPMLILGIAFAFRYFSKK**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAKVHDFQEVAKHNNRDDCWLVISGKVYNVTPFLEDHPGGDEVLLAATEKDATDDFEDVGHSDSAREMMEKYHIGEIDSSSVPAKRKYTPPQQAVNSPEDTGSAAKILQFLVPMLILGIAFAFRYFSKKEE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query131 2.2.26 [Sep-21-2011]
Q42342134 Cytochrome b5 isoform A O yes no 0.977 0.955 0.666 5e-46
P40934134 Cytochrome b5 OS=Brassica N/A no 0.977 0.955 0.658 2e-45
P49098136 Cytochrome b5 OS=Nicotian N/A no 0.977 0.941 0.612 4e-44
P49099135 Cytochrome b5, seed isofo N/A no 0.977 0.948 0.612 7e-44
P49100137 Cytochrome b5 OS=Oryza sa yes no 0.977 0.934 0.612 9e-44
O04354132 Cytochrome b5 OS=Borago o N/A no 0.977 0.969 0.589 6e-43
O48845134 Cytochrome b5 isoform B O no no 0.969 0.947 0.609 3e-42
Q9ZWT2140 Cytochrome B5 isoform D O no no 0.984 0.921 0.537 3e-39
P49097135 Cytochrome b5 OS=Cuscuta N/A no 0.992 0.962 0.541 4e-39
Q9ZNV4132 Cytochrome B5 isoform C O no no 0.984 0.977 0.492 6e-30
>sp|Q42342|CYB5A_ARATH Cytochrome b5 isoform A OS=Arabidopsis thaliana GN=CYTB5-A PE=1 SV=2 Back     alignment and function desciption
 Score =  182 bits (462), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 86/129 (66%), Positives = 105/129 (81%), Gaps = 1/129 (0%)

Query: 3   KVHDFQEVAKHNNRDDCWLVISGKVYNVTPFLEDHPGGDEVLLAATEKDATDDFEDVGHS 62
           KV  F+EV+KHN   DCWL+ISGKVY+VTPF++DHPGGDEVLL++T KDAT+DFEDVGHS
Sbjct: 6   KVLSFEEVSKHNKTKDCWLIISGKVYDVTPFMDDHPGGDEVLLSSTGKDATNDFEDVGHS 65

Query: 63  DSAREMMEKYHIGEIDSSSVPAKRKYTPPQQ-AVNSPEDTGSAAKILQFLVPMLILGIAF 121
           D+AR+MM+KY IGEIDSSSVPA R Y  PQQ A N  +      KILQFLVP+LILG+A 
Sbjct: 66  DTARDMMDKYFIGEIDSSSVPATRTYVAPQQPAYNQDKTPEFIIKILQFLVPILILGLAL 125

Query: 122 AFRYFSKKE 130
             R+++KK+
Sbjct: 126 VVRHYTKKD 134
Membrane bound hemoprotein which function as an electron carrier for several membrane bound oxygenases.
Arabidopsis thaliana (taxid: 3702)
>sp|P40934|CYB5_BRAOB Cytochrome b5 OS=Brassica oleracea var. botrytis GN=CYB5 PE=1 SV=1 Back     alignment and function description
>sp|P49098|CYB5_TOBAC Cytochrome b5 OS=Nicotiana tabacum PE=2 SV=1 Back     alignment and function description
>sp|P49099|CYB5S_TOBAC Cytochrome b5, seed isoform OS=Nicotiana tabacum PE=2 SV=1 Back     alignment and function description
>sp|P49100|CYB5_ORYSJ Cytochrome b5 OS=Oryza sativa subsp. japonica GN=Os05g0108800 PE=2 SV=2 Back     alignment and function description
>sp|O04354|CYB5_BOROF Cytochrome b5 OS=Borago officinalis PE=2 SV=1 Back     alignment and function description
>sp|O48845|CYB5B_ARATH Cytochrome b5 isoform B OS=Arabidopsis thaliana GN=CYTB5-B PE=1 SV=1 Back     alignment and function description
>sp|Q9ZWT2|CYB5D_ARATH Cytochrome B5 isoform D OS=Arabidopsis thaliana GN=CYTB5-D PE=1 SV=1 Back     alignment and function description
>sp|P49097|CYB5_CUSRE Cytochrome b5 OS=Cuscuta reflexa PE=2 SV=1 Back     alignment and function description
>sp|Q9ZNV4|CYB5C_ARATH Cytochrome B5 isoform C OS=Arabidopsis thaliana GN=CYTB5-C PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query131
351726704134 uncharacterized protein LOC100305929 [Gl 0.977 0.955 0.713 5e-49
351723153134 uncharacterized protein LOC100499823 [Gl 0.977 0.955 0.713 6e-49
399920236 832 yellow stripe-like protein [Rosa rugosa] 0.977 0.153 0.713 8e-49
357464067 841 YSL transporter [Medicago truncatula] gi 0.977 0.152 0.682 1e-47
50844673133 cytochrome b5 isoform Cb5-A [Vernicia fo 0.977 0.962 0.687 2e-47
330318688134 cytochrome b5 [Camellia sinensis] 0.977 0.955 0.682 2e-47
388502872134 unknown [Medicago truncatula] 0.977 0.955 0.682 3e-47
449456423134 PREDICTED: cytochrome b5 isoform A-like 0.977 0.955 0.705 5e-47
225455278134 PREDICTED: cytochrome b5 isoform 1 [Viti 0.977 0.955 0.697 1e-46
388510986135 unknown [Lotus japonicus] gi|388520673|g 0.984 0.955 0.684 2e-46
>gi|351726704|ref|NP_001235088.1| uncharacterized protein LOC100305929 [Glycine max] gi|255627013|gb|ACU13851.1| unknown [Glycine max] Back     alignment and taxonomy information
 Score =  198 bits (504), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 92/129 (71%), Positives = 110/129 (85%), Gaps = 1/129 (0%)

Query: 3   KVHDFQEVAKHNNRDDCWLVISGKVYNVTPFLEDHPGGDEVLLAATEKDATDDFEDVGHS 62
           K+H F+EVAKHN   DCWL+ISGKVY+VTPF+EDHPGGDEVLL+AT KDAT+DFEDVGHS
Sbjct: 6   KLHTFEEVAKHNQTKDCWLIISGKVYDVTPFMEDHPGGDEVLLSATGKDATNDFEDVGHS 65

Query: 63  DSAREMMEKYHIGEIDSSSVPAKRKYTPPQQAVNSPEDTGS-AAKILQFLVPMLILGIAF 121
           DSAR+MMEKY+IGEID+ +VP KR Y PPQQA  +P+ T     KILQFLVP+LILG+AF
Sbjct: 66  DSARDMMEKYYIGEIDALTVPLKRTYIPPQQAQYNPDKTPEFVIKILQFLVPLLILGLAF 125

Query: 122 AFRYFSKKE 130
             R+++KKE
Sbjct: 126 VVRHYTKKE 134

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|351723153|ref|NP_001236501.1| uncharacterized protein LOC100499823 [Glycine max] gi|255626921|gb|ACU13805.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|399920236|gb|AFP55583.1| yellow stripe-like protein [Rosa rugosa] Back     alignment and taxonomy information
>gi|357464067|ref|XP_003602315.1| YSL transporter [Medicago truncatula] gi|355491363|gb|AES72566.1| YSL transporter [Medicago truncatula] Back     alignment and taxonomy information
>gi|50844673|gb|AAT84458.1| cytochrome b5 isoform Cb5-A [Vernicia fordii] Back     alignment and taxonomy information
>gi|330318688|gb|AEC11004.1| cytochrome b5 [Camellia sinensis] Back     alignment and taxonomy information
>gi|388502872|gb|AFK39502.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|449456423|ref|XP_004145949.1| PREDICTED: cytochrome b5 isoform A-like [Cucumis sativus] gi|449497404|ref|XP_004160392.1| PREDICTED: cytochrome b5 isoform A-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|225455278|ref|XP_002273913.1| PREDICTED: cytochrome b5 isoform 1 [Vitis vinifera] gi|302143955|emb|CBI23060.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|388510986|gb|AFK43559.1| unknown [Lotus japonicus] gi|388520673|gb|AFK48398.1| unknown [Lotus japonicus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query131
TAIR|locus:2168666134 CB5-E "cytochrome B5 isoform E 0.977 0.955 0.666 4.5e-43
TAIR|locus:2046417134 CB5-B "cytochrome B5 isoform B 0.969 0.947 0.609 4.2e-40
TAIR|locus:2156534140 CB5-D "cytochrome B5 isoform D 0.961 0.9 0.550 6.3e-37
TAIR|locus:2039939132 CB5-C "AT2G46650" [Arabidopsis 0.984 0.977 0.492 1.2e-33
TAIR|locus:2028721135 CB5-A "cytochrome B5 isoform A 0.977 0.948 0.477 5e-28
FB|FBgn0264294134 Cyt-b5 "Cytochrome b5" [Drosop 0.870 0.850 0.453 1.6e-22
CGD|CAL0002061126 CYB5 [Candida albicans (taxid: 0.725 0.753 0.418 2.4e-21
UNIPROTKB|F1NSI3144 CYB5B "Uncharacterized protein 0.893 0.812 0.435 2.4e-21
UNIPROTKB|F1NXL2150 CYB5B "Uncharacterized protein 0.893 0.78 0.435 2.4e-21
UNIPROTKB|Q5AFL9126 CYB5 "Likely cytochrome b5" [C 0.725 0.753 0.418 2.4e-21
TAIR|locus:2168666 CB5-E "cytochrome B5 isoform E" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 455 (165.2 bits), Expect = 4.5e-43, P = 4.5e-43
 Identities = 86/129 (66%), Positives = 105/129 (81%)

Query:     3 KVHDFQEVAKHNNRDDCWLVISGKVYNVTPFLEDHPGGDEVLLAATEKDATDDFEDVGHS 62
             KV  F+EV+KHN   DCWL+ISGKVY+VTPF++DHPGGDEVLL++T KDAT+DFEDVGHS
Sbjct:     6 KVLSFEEVSKHNKTKDCWLIISGKVYDVTPFMDDHPGGDEVLLSSTGKDATNDFEDVGHS 65

Query:    63 DSAREMMEKYHIGEIDSSSVPAKRKYTPPQQ-AVNSPEDTGSAAKILQFLVPMLILGIAF 121
             D+AR+MM+KY IGEIDSSSVPA R Y  PQQ A N  +      KILQFLVP+LILG+A 
Sbjct:    66 DTARDMMDKYFIGEIDSSSVPATRTYVAPQQPAYNQDKTPEFIIKILQFLVPILILGLAL 125

Query:   122 AFRYFSKKE 130
               R+++KK+
Sbjct:   126 VVRHYTKKD 134
GO:0020037 "heme binding" evidence=IEA;ISS
GO:0005886 "plasma membrane" evidence=IDA
GO:0009535 "chloroplast thylakoid membrane" evidence=IDA
GO:0005773 "vacuole" evidence=IDA
GO:0005783 "endoplasmic reticulum" evidence=IDA
GO:0005774 "vacuolar membrane" evidence=IDA
GO:0005829 "cytosol" evidence=RCA
GO:0016126 "sterol biosynthetic process" evidence=RCA
GO:0019745 "pentacyclic triterpenoid biosynthetic process" evidence=RCA
GO:0005789 "endoplasmic reticulum membrane" evidence=NAS
TAIR|locus:2046417 CB5-B "cytochrome B5 isoform B" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2156534 CB5-D "cytochrome B5 isoform D" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2039939 CB5-C "AT2G46650" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2028721 CB5-A "cytochrome B5 isoform A" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
FB|FBgn0264294 Cyt-b5 "Cytochrome b5" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
CGD|CAL0002061 CYB5 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
UNIPROTKB|F1NSI3 CYB5B "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NXL2 CYB5B "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q5AFL9 CYB5 "Likely cytochrome b5" [Candida albicans SC5314 (taxid:237561)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O04354CYB5_BOROFNo assigned EC number0.58910.97700.9696N/Ano
Q42342CYB5A_ARATHNo assigned EC number0.66660.97700.9552yesno
P40934CYB5_BRAOBNo assigned EC number0.65890.97700.9552N/Ano
P49100CYB5_ORYSJNo assigned EC number0.61240.97700.9343yesno
Q9USM6CYB52_SCHPONo assigned EC number0.38880.89310.9069yesno
Q9V4N3CYB5_DROMENo assigned EC number0.44530.87020.8507yesno
O43169CYB5B_HUMANNo assigned EC number0.38280.89310.8013yesno
P40312CYB5_YEASTNo assigned EC number0.35530.87780.9583yesno
P49098CYB5_TOBACNo assigned EC number0.61240.97700.9411N/Ano
P49099CYB5S_TOBACNo assigned EC number0.61240.97700.9481N/Ano
P49097CYB5_CUSRENo assigned EC number0.54190.99230.9629N/Ano

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query131
pfam0017374 pfam00173, Cyt-b5, Cytochrome b5-like Heme/Steroid 2e-35
PLN02252 888 PLN02252, PLN02252, nitrate reductase [NADPH] 4e-26
COG5274164 COG5274, CYB5, Cytochrome b involved in lipid meta 3e-24
PLN03198 526 PLN03198, PLN03198, delta6-acyl-lipid desaturase; 2e-13
PLN03199 485 PLN03199, PLN03199, delta6-acyl-lipid desaturase-l 1e-10
>gnl|CDD|201057 pfam00173, Cyt-b5, Cytochrome b5-like Heme/Steroid binding domain Back     alignment and domain information 
 Score =  116 bits (292), Expect = 2e-35
 Identities = 43/74 (58%), Positives = 60/74 (81%)

Query: 5  HDFQEVAKHNNRDDCWLVISGKVYNVTPFLEDHPGGDEVLLAATEKDATDDFEDVGHSDS 64
             +EV KHN   DCW+VI+GKVY+VT FL+DHPGG++V+L+A  KDAT+ FED  HS++
Sbjct: 1  FTLEEVKKHNKDGDCWIVINGKVYDVTRFLKDHPGGEDVILSAAGKDATEAFEDAIHSEA 60

Query: 65 AREMMEKYHIGEID 78
          AR+++EKY +GE+D
Sbjct: 61 ARKLLEKYRVGELD 74

This family includes heme binding domains from a diverse range of proteins. This family also includes proteins that bind to steroids. The family includes progesterone receptors. Many members of this subfamily are membrane anchored by an N-terminal transmembrane alpha helix. This family also includes a domain in some chitin synthases. There is no known ligand for this domain in the chitin synthases. Length = 74
>gnl|CDD|215141 PLN02252, PLN02252, nitrate reductase [NADPH] Back     alignment and domain information
>gnl|CDD|227599 COG5274, CYB5, Cytochrome b involved in lipid metabolism [Energy production and conversion / Lipid metabolism] Back     alignment and domain information
>gnl|CDD|178739 PLN03198, PLN03198, delta6-acyl-lipid desaturase; Provisional Back     alignment and domain information
>gnl|CDD|178740 PLN03199, PLN03199, delta6-acyl-lipid desaturase-like protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 131
KOG0537124 consensus Cytochrome b5 [Energy production and con 99.97
PF0017376 Cyt-b5: Cytochrome b5-like Heme/Steroid binding do 99.92
KOG0536145 consensus Flavohemoprotein b5+b5R [Energy producti 99.9
PLN03198 526 delta6-acyl-lipid desaturase; Provisional 99.85
PLN03199 485 delta6-acyl-lipid desaturase-like protein; Provisi 99.84
COG5274164 CYB5 Cytochrome b involved in lipid metabolism [En 99.83
PLN02252 888 nitrate reductase [NADPH] 99.81
KOG4232 430 consensus Delta 6-fatty acid desaturase/delta-8 sp 99.65
KOG4576167 consensus Sulfite oxidase, heme-binding component 99.55
COG489281 Predicted heme/steroid binding protein [General fu 99.07
KOG1110183 consensus Putative steroid membrane receptor Hpr6. 97.87
KOG1108281 consensus Predicted heme/steroid binding protein [ 97.48
PF1490194 Jiv90: Cleavage inducing molecular chaperone 91.07
>KOG0537 consensus Cytochrome b5 [Energy production and conversion] Back     alignment and domain information 
Probab=99.97  E-value=6.1e-33  Score=194.72  Aligned_cols=85  Identities=56%  Similarity=1.014  Sum_probs=80.6

Q ss_pred             CCccCHHHHhcccCCCCeEEEEcCEEEecCcCcccCCChHHHHhhhhCCCCchhhhhcCCCHHHHHhhhhceeeeecCCC
Q 032893            2 AKVHDFQEVAKHNNRDDCWLVISGKVYNVTPFLEDHPGGDEVLLAATEKDATDDFEDVGHSDSAREMMEKYHIGEIDSSS   81 (131)
Q Consensus         2 ~~~~t~~ev~~h~~~~~~wvvi~g~VYDvT~f~~~HPGG~~~l~~~aG~D~T~~f~~~~hs~~a~~~l~~~~VG~l~~~~   81 (131)
                      .+.||++||++||+++||||+|+|+|||||+|+++||||.++|+.+||+|+|+.|++.+||..|++||++|+||.+..+.
T Consensus         4 ~k~~~~~EV~kHn~~~d~Wvii~gkVYDvT~Fl~eHPGG~~vLl~~AGkDaT~~F~~~gHS~~A~~ml~~y~ig~~~~~~   83 (124)
T KOG0537|consen    4 LKYYTLSEVAKHNKKDDCWVIIHGKVYDVTSFLDEHPGGEDVLLEYAGKDATEAFEDVGHSKDAREMLEEYYIGEVPTTA   83 (124)
T ss_pred             cccccHHHHHhhcCCCCeEEEECCEEEeccchhhhCCChHHHHHHHhchhhHHhccccCCcHHHHHHhhhcccccccCCC
Confidence            57899999999999999999999999999999999999999999999999999999999999999999999999999876


Q ss_pred             CCCCC
Q 032893           82 VPAKR   86 (131)
Q Consensus        82 ~~~~~   86 (131)
                      .+...
T Consensus        84 ~~~~~   88 (124)
T KOG0537|consen   84 RPVVW   88 (124)
T ss_pred             cccee
Confidence            65544

>PF00173 Cyt-b5: Cytochrome b5-like Heme/Steroid binding domain This prints entry is a subset of the Pfam entry; InterPro: IPR001199 Cytochromes b5 are ubiquitous electron transport proteins found in animals, plants and yeasts [] Back     alignment and domain information
>KOG0536 consensus Flavohemoprotein b5+b5R [Energy production and conversion] Back     alignment and domain information
>PLN03198 delta6-acyl-lipid desaturase; Provisional Back     alignment and domain information
>PLN03199 delta6-acyl-lipid desaturase-like protein; Provisional Back     alignment and domain information
>COG5274 CYB5 Cytochrome b involved in lipid metabolism [Energy production and conversion / Lipid metabolism] Back     alignment and domain information
>PLN02252 nitrate reductase [NADPH] Back     alignment and domain information
>KOG4232 consensus Delta 6-fatty acid desaturase/delta-8 sphingolipid desaturase [Lipid transport and metabolism] Back     alignment and domain information
>KOG4576 consensus Sulfite oxidase, heme-binding component [Energy production and conversion] Back     alignment and domain information
>COG4892 Predicted heme/steroid binding protein [General function prediction only] Back     alignment and domain information
>KOG1110 consensus Putative steroid membrane receptor Hpr6 Back     alignment and domain information
>KOG1108 consensus Predicted heme/steroid binding protein [General function prediction only] Back     alignment and domain information
>PF14901 Jiv90: Cleavage inducing molecular chaperone Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query131
3ner_A92 Structure Of Human Type B Cytochrome B5 Length = 92 5e-20
1b5m_A84 Rat Outer Mitochondrial Membrane Cytochrome B5 Leng 9e-20
2ibj_A88 Structure Of House Fly Cytochrome B5 Length = 88 9e-20
3mus_A87 2a Resolution Structure Of Rat Type B Cytochrome B5 1e-19
1eue_A86 Rat Outer Mitochondrial Membrane Cytochrome B5 Leng 2e-19
1awp_A92 Rat Outer Mitochondrial Membrane Cytochrome B5 Leng 4e-19
1icc_A87 Rat Outer Mitochondrial Membrane Cytochrome B5 Leng 5e-19
2i96_A108 Solution Structure Of The Oxidized Microsomal Human 6e-19
2i89_A93 Structure Of Septuple Mutant Of Rat Outer Mitochond 6e-19
3ozz_B82 Structure Of A Cytochrome B5 Core-Swap Mutant Lengt 1e-18
1hko_A104 Nmr Structure Of Bovine Cytochrome B5 Length = 104 2e-18
1lj0_A92 Structure Of Quintuple Mutant Of The Rat Outer Mito 3e-18
1cyo_A93 Bovine Cytochrome B(5) Length = 93 4e-18
1ehb_A82 Crystal Structure Of Recombinant Trypsin-Solubilize 7e-18
1u9u_A82 Crystal Structure Of F58y Mutant Of Cytochrome B5 L 1e-17
1m20_A82 Crystal Structure Of F35y Mutant Of Trypsin-Solubil 1e-17
1i5u_A82 Solution Structure Of Cytochrome B5 Triple Mutant ( 2e-17
2m33_A104 Solution Nmr Structure Of Full-length Oxidized Micr 2e-17
1u9m_A82 Crystal Structure Of F58w Mutant Of Cytochrome B5 L 3e-17
1lr6_A82 Crystal Structure Of V45y Mutant Of Cytochrome B5 L 3e-17
1do9_A94 Solution Structure Of Oxidized Microsomal Rabbit Cy 3e-17
1lqx_A82 Crystal Structure Of V45e Mutant Of Cytochrome B5 L 5e-17
1sh4_A82 Solution Structure Of Oxidized Bovine Microsomal Cy 6e-17
1es1_A82 Crystal Structure Of Val61his Mutant Of Trypsin-Sol 6e-17
1j0q_A82 Solution Structure Of Oxidized Bovine Microsomal Cy 6e-17
1m59_A82 Crystal Structure Of P40v Mutant Of Trypsin-Solubil 7e-17
1m2i_A82 Crystal Structure Of E44aE56A MUTANT OF CYTOCHROME 8e-17
1m2m_A82 Crystal Structure Of E44aE48AE56AD60A MUTANT OF Cyt 8e-17
1f03_A82 Solution Structure Of Oxidized Bovine Microsomal Cy 9e-17
1i87_A98 Solution Structure Of The Water-Soluble Fragment Of 1e-16
1bfx_A99 The Solution Nmr Structure Of The B Form Of Oxidize 1e-16
1blv_A94 Solution Structure Of Oxidized Rat Microsomal Cytoc 1e-16
1aqa_A94 Solution Structure Of Reduced Microsomal Rat Cytoch 1e-16
1ib7_A94 Solution Structure Of F35y Mutant Of Rat Ferro Cyto 3e-16
1jex_A94 Solution Structure Of A67v Mutant Of Rat Ferro Cyto 4e-16
3lf5_A88 Structure Of Human Nadh Cytochrome B5 Oxidoreductas 1e-12
1ldc_A 511 X-Ray Structure Of Two Complexes Of The Y143f Flavo 3e-12
1ltd_A 506 The 2.6 Angstroms Refined Structure Of The Escheric 3e-12
1fcb_A 511 Molecular Structure Of Flavocytochrome B2 At 2.4 An 3e-12
1sze_A 511 L230a Mutant Flavocytochrome B2 With Benzoylformate 3e-12
1szf_A 511 A198g:l230a Mutant Flavocytochrome B2 With Pyruvate 3e-12
2oz0_A 511 Mechanistic And Structural Studies Of H373q Flavocy 3e-12
1cxy_A90 Structure And Characterization Of Ectothiorhodospir 1e-11
3ks0_A95 Crystal Structure Of The Heme Domain Of Flavocytoch 3e-11
1x3x_A82 Crystal Structure Of Cytochrome B5 From Ascaris Suu 1e-07
3r19_A 466 Chicken Sulfite Oxidase Triple Mutant With Altered 2e-04
3r18_A 466 Chicken Sulfite Oxidase Double Mutant With Altered 2e-04
3hc2_A 466 Crystal Structure Of Chicken Sulfite Oxidase Mutant 2e-04
1sox_A 466 Sulfite Oxidase From Chicken Liver Length = 466 2e-04
3hbq_A 466 Structure Of Recombinant Chicken Liver Sulfite Oxid 2e-04
3hbg_A 466 Structure Of Recombinant Chicken Liver Sulfite Oxid 2e-04
>pdb|3NER|A Chain A, Structure Of Human Type B Cytochrome B5 Length = 92 Back     alignment and structure 
Iteration: 1

 Score = 92.8 bits (229), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 57/76 (75%)
Query: 7  FQEVAKHNNRDDCWLVISGKVYNVTPFLEDHPGGDEVLLAATEKDATDDFEDVGHSDSAR 66
           +EVAK N+  + WLVI G+VY+VT FL +HPGG+EVLL     DA++ FEDVGHS  AR
Sbjct: 14 LEEVAKRNSLKELWLVIHGRVYDVTRFLNEHPGGEEVLLEQAGVDASESFEDVGHSSDAR 73
Query: 67 EMMEKYHIGEIDSSSV 82
          EM+++Y+IG+I  S +
Sbjct: 74 EMLKQYYIGDIHPSDL 89
>pdb|1B5M|A Chain A, Rat Outer Mitochondrial Membrane Cytochrome B5 Length = 84 Back     alignment and structure
>pdb|2IBJ|A Chain A, Structure Of House Fly Cytochrome B5 Length = 88 Back     alignment and structure
>pdb|3MUS|A Chain A, 2a Resolution Structure Of Rat Type B Cytochrome B5 Length = 87 Back     alignment and structure
>pdb|1EUE|A Chain A, Rat Outer Mitochondrial Membrane Cytochrome B5 Length = 86 Back     alignment and structure
>pdb|1AWP|A Chain A, Rat Outer Mitochondrial Membrane Cytochrome B5 Length = 92 Back     alignment and structure
>pdb|1ICC|A Chain A, Rat Outer Mitochondrial Membrane Cytochrome B5 Length = 87 Back     alignment and structure
>pdb|2I96|A Chain A, Solution Structure Of The Oxidized Microsomal Human Cytochrome B5 Length = 108 Back     alignment and structure
>pdb|2I89|A Chain A, Structure Of Septuple Mutant Of Rat Outer Mitochondrial Membrane Cytochrome B5 Length = 93 Back     alignment and structure
>pdb|3OZZ|B Chain B, Structure Of A Cytochrome B5 Core-Swap Mutant Length = 82 Back     alignment and structure
>pdb|1HKO|A Chain A, Nmr Structure Of Bovine Cytochrome B5 Length = 104 Back     alignment and structure
>pdb|1LJ0|A Chain A, Structure Of Quintuple Mutant Of The Rat Outer Mitocondrial Cytochrome B5. Length = 92 Back     alignment and structure
>pdb|1CYO|A Chain A, Bovine Cytochrome B(5) Length = 93 Back     alignment and structure
>pdb|1EHB|A Chain A, Crystal Structure Of Recombinant Trypsin-Solubilized Fragment Of Cytochrome B5 Length = 82 Back     alignment and structure
>pdb|1U9U|A Chain A, Crystal Structure Of F58y Mutant Of Cytochrome B5 Length = 82 Back     alignment and structure
>pdb|1M20|A Chain A, Crystal Structure Of F35y Mutant Of Trypsin-Solubilized Fragment Of Cytochrome B5 Length = 82 Back     alignment and structure
>pdb|1I5U|A Chain A, Solution Structure Of Cytochrome B5 Triple Mutant (E48aE56AD60A) Length = 82 Back     alignment and structure
>pdb|2M33|A Chain A, Solution Nmr Structure Of Full-length Oxidized Microsomal Rabbit Cytochrome B5 Length = 104 Back     alignment and structure
>pdb|1U9M|A Chain A, Crystal Structure Of F58w Mutant Of Cytochrome B5 Length = 82 Back     alignment and structure
>pdb|1LR6|A Chain A, Crystal Structure Of V45y Mutant Of Cytochrome B5 Length = 82 Back     alignment and structure
>pdb|1DO9|A Chain A, Solution Structure Of Oxidized Microsomal Rabbit Cytochrome B5. Factors Determining The Heterogeneous Binding Of The Heme Length = 94 Back     alignment and structure
>pdb|1LQX|A Chain A, Crystal Structure Of V45e Mutant Of Cytochrome B5 Length = 82 Back     alignment and structure
>pdb|1SH4|A Chain A, Solution Structure Of Oxidized Bovine Microsomal Cytochrome B5 Mutant V45h Length = 82 Back     alignment and structure
>pdb|1ES1|A Chain A, Crystal Structure Of Val61his Mutant Of Trypsin-Solubilized Fragment Of Cytochrome B5 Length = 82 Back     alignment and structure
>pdb|1J0Q|A Chain A, Solution Structure Of Oxidized Bovine Microsomal Cytochrome B5 Mutant V61h Length = 82 Back     alignment and structure
>pdb|1M59|A Chain A, Crystal Structure Of P40v Mutant Of Trypsin-Solubilized Fragment Of Cytochrome B5 Length = 82 Back     alignment and structure
>pdb|1M2I|A Chain A, Crystal Structure Of E44aE56A MUTANT OF CYTOCHROME B5 Length = 82 Back     alignment and structure
>pdb|1M2M|A Chain A, Crystal Structure Of E44aE48AE56AD60A MUTANT OF Cytochrome B5 Length = 82 Back     alignment and structure
>pdb|1F03|A Chain A, Solution Structure Of Oxidized Bovine Microsomal Cytochrome B5 Mutant (E44a, E48a, E56a, D60a) And Its Interaction With Cytochrome C Length = 82 Back     alignment and structure
>pdb|1I87|A Chain A, Solution Structure Of The Water-Soluble Fragment Of Rat Hepatic Apocytochrome B5 Length = 98 Back     alignment and structure
>pdb|1BFX|A Chain A, The Solution Nmr Structure Of The B Form Of Oxidized Rat Microsomal Cytochrome B5, Minimized Average Structure Length = 99 Back     alignment and structure
>pdb|1BLV|A Chain A, Solution Structure Of Oxidized Rat Microsomal Cytochrome B5 In The Presence Of 2 M Guanidinium Chloride: Monitoring The Early Steps In Protein Unfolding Length = 94 Back     alignment and structure
>pdb|1AQA|A Chain A, Solution Structure Of Reduced Microsomal Rat Cytochrome B5, Nmr, Minimized Average Structure Length = 94 Back     alignment and structure
>pdb|1JEX|A Chain A, Solution Structure Of A67v Mutant Of Rat Ferro Cytochrome B5 Length = 94 Back     alignment and structure
>pdb|3LF5|A Chain A, Structure Of Human Nadh Cytochrome B5 Oxidoreductase (Ncb5or) B5 Domain To 1.25a Resolution Length = 88 Back     alignment and structure
>pdb|1LDC|A Chain A, X-Ray Structure Of Two Complexes Of The Y143f Flavocytochrome B2 Mutant Crystallized In The Presence Of Lactate Or Phenyl-Lactate Length = 511 Back     alignment and structure
>pdb|1LTD|A Chain A, The 2.6 Angstroms Refined Structure Of The Escherichia Coli Recombinant Saccharomyces Cerevisiae Flavocytochrome B2-Sulphite Complex Length = 506 Back     alignment and structure
>pdb|1FCB|A Chain A, Molecular Structure Of Flavocytochrome B2 At 2.4 Angstroms Resolution Length = 511 Back     alignment and structure
>pdb|1SZE|A Chain A, L230a Mutant Flavocytochrome B2 With Benzoylformate Length = 511 Back     alignment and structure
>pdb|1SZF|A Chain A, A198g:l230a Mutant Flavocytochrome B2 With Pyruvate Bound Length = 511 Back     alignment and structure
>pdb|2OZ0|A Chain A, Mechanistic And Structural Studies Of H373q Flavocytochrome B2: Effects Of Mutating The Active Site Base Length = 511 Back     alignment and structure
>pdb|1CXY|A Chain A, Structure And Characterization Of Ectothiorhodospira Vacuolata Cytochrome B558, A Prokaryotic Homologue Of Cytochrome B5 Length = 90 Back     alignment and structure
>pdb|3KS0|A Chain A, Crystal Structure Of The Heme Domain Of Flavocytochrome B2 In Complex With Fab B2b4 Length = 95 Back     alignment and structure
>pdb|1X3X|A Chain A, Crystal Structure Of Cytochrome B5 From Ascaris Suum Length = 82 Back     alignment and structure
>pdb|3R19|A Chain A, Chicken Sulfite Oxidase Triple Mutant With Altered Activity And Substrate Affinity Length = 466 Back     alignment and structure
>pdb|3R18|A Chain A, Chicken Sulfite Oxidase Double Mutant With Altered Activity And Substrate Affinity Length = 466 Back     alignment and structure
>pdb|3HC2|A Chain A, Crystal Structure Of Chicken Sulfite Oxidase Mutant Tyr 322 Phe Length = 466 Back     alignment and structure
>pdb|1SOX|A Chain A, Sulfite Oxidase From Chicken Liver Length = 466 Back     alignment and structure
>pdb|3HBQ|A Chain A, Structure Of Recombinant Chicken Liver Sulfite Oxidase Mutant Cys 185 Ala Length = 466 Back     alignment and structure
>pdb|3HBG|A Chain A, Structure Of Recombinant Chicken Liver Sulfite Oxidase Mutant C185s Length = 466 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query131
1hko_A104 Cytochrome B5; electron transfer protein, heme, el 3e-43
1cyo_A93 Cytochrome B5; electron transport; HET: HEM; 1.50A 3e-42
3ner_A92 Cytochrome B5 type B; heme, electron transport; HE 5e-42
2ibj_A88 Cytochrome B5, CYTB5; FLY cytochrome B5, X-RAY dif 2e-41
3lf5_A88 Cytochrome B5 reductase 4; NCB5OR, electron transf 2e-41
1cxy_A90 Cytochrome B5; helix, beta-strand, electron transp 1e-39
2keo_A112 Probable E3 ubiquitin-protein ligase HERC2; protei 1e-36
1x3x_A82 Cytochrome B5; hemoprotein, porcine parasitic nama 1e-34
1mj4_A82 Sulfite oxidase; cytochrome B5, heme, oxidoreducta 3e-34
1kbi_A 511 Cytochrome B2, L-LCR; flavocytochrome B2, electron 5e-25
1sox_A 466 Sulfite oxidase; oxidoreductase, sulfite oxidation 4e-14
>1hko_A Cytochrome B5; electron transfer protein, heme, electron transport; HET: HEM; NMR {Bos taurus} SCOP: d.120.1.1 PDB: 2i96_A* Length = 104 Back     alignment and structure
 Score =  136 bits (345), Expect = 3e-43
 Identities = 42/99 (42%), Positives = 62/99 (62%), Gaps = 3/99 (3%)

Query: 3   KVHDFQEVAKHNNRDDCWLVISGKVYNVTPFLEDHPGGDEVLLAATEKDATDDFEDVGHS 62
           K +  +E+ KHNN    WL++  KVY++T FLE+HPGG+EVL      DAT++FEDVGHS
Sbjct: 9   KYYTLEEIQKHNNSKSTWLILHYKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHS 68

Query: 63  DSAREMMEKYHIGEIDSSSVPAKRKYTPPQQAVNSPEDT 101
             ARE+ + + IGE+         K T P +++ +  D+
Sbjct: 69  TDARELSKTFIIGELHPDDRS---KITKPSESIITTIDS 104
>1cyo_A Cytochrome B5; electron transport; HET: HEM; 1.50A {Bos taurus} SCOP: d.120.1.1 PDB: 1bfx_A* 1i87_A 1i8c_A 1iet_A 1ieu_A 1do9_A* 1aqa_A* 1aw3_A* 1axx_A* 1b5a_A* 1b5b_A* 1blv_A* 1mny_A* 2axx_A* 1ib7_A* 1jex_A* 1ehb_A* 1nx7_A* 1u9u_A* 1m20_A* ... Length = 93 Back     alignment and structure
>3ner_A Cytochrome B5 type B; heme, electron transport; HET: HEM; 1.45A {Homo sapiens} PDB: 1awp_A* 3mus_A* 1b5m_A* 1eue_A* 1icc_A* 1lj0_A* 2i89_A* Length = 92 Back     alignment and structure
>2ibj_A Cytochrome B5, CYTB5; FLY cytochrome B5, X-RAY diffraction, heme, electron transport; HET: HEM; 1.55A {Musca domestica} Length = 88 Back     alignment and structure
>3lf5_A Cytochrome B5 reductase 4; NCB5OR, electron transfer, redox, heme, endoplasmic reticulu flavoprotein, iron, metal-binding, NAD, oxidoreductase; HET: HEM; 1.25A {Homo sapiens} Length = 88 Back     alignment and structure
>1cxy_A Cytochrome B5; helix, beta-strand, electron transport; HET: HEM; 1.65A {Ectothiorhodospira shaposhnikovii} SCOP: d.120.1.1 Length = 90 Back     alignment and structure
>2keo_A Probable E3 ubiquitin-protein ligase HERC2; protein of unknown function, HERC2 cytochrome domain, ligase binding, phosphoprotein; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>1x3x_A Cytochrome B5; hemoprotein, porcine parasitic namatode, electron transport; HET: HEM; 1.80A {Ascaris suum} Length = 82 Back     alignment and structure
>1mj4_A Sulfite oxidase; cytochrome B5, heme, oxidoreductase; HET: HEM; 1.20A {Homo sapiens} SCOP: d.120.1.1 Length = 82 Back     alignment and structure
>1kbi_A Cytochrome B2, L-LCR; flavocytochrome B2, electron transfer, oxidoreductase; HET: HEM FMN; 2.30A {Saccharomyces cerevisiae} SCOP: c.1.4.1 d.120.1.1 PDB: 1fcb_A* 1lco_A* 1ldc_A* 1sze_A* 2oz0_A* 1szf_A* 1szg_A* 1ltd_A* 1kbj_A* 1qcw_A* 3ks0_A* Length = 511 Back     alignment and structure
>1sox_A Sulfite oxidase; oxidoreductase, sulfite oxidation; HET: MTE HEM EPE; 1.90A {Gallus gallus} SCOP: b.1.18.6 d.120.1.1 d.176.1.1 PDB: 3hc2_A* 3hbq_A* 3hbg_A* 3hbp_A* 3r18_A* 3r19_A* Length = 466 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query131
3ner_A92 Cytochrome B5 type B; heme, electron transport; HE 99.96
1cyo_A93 Cytochrome B5; electron transport; HET: HEM; 1.50A 99.96
1cxy_A90 Cytochrome B5; helix, beta-strand, electron transp 99.96
1hko_A104 Cytochrome B5; electron transfer protein, heme, el 99.96
2ibj_A88 Cytochrome B5, CYTB5; FLY cytochrome B5, X-RAY dif 99.95
3lf5_A88 Cytochrome B5 reductase 4; NCB5OR, electron transf 99.95
1x3x_A82 Cytochrome B5; hemoprotein, porcine parasitic nama 99.95
1mj4_A82 Sulfite oxidase; cytochrome B5, heme, oxidoreducta 99.94
2keo_A112 Probable E3 ubiquitin-protein ligase HERC2; protei 99.93
1sox_A 466 Sulfite oxidase; oxidoreductase, sulfite oxidation 99.86
1kbi_A 511 Cytochrome B2, L-LCR; flavocytochrome B2, electron 99.85
1j03_A102 Putative steroid binding protein; alpha and beta, 99.75
>3ner_A Cytochrome B5 type B; heme, electron transport; HET: HEM; 1.45A {Homo sapiens} SCOP: d.120.1.1 PDB: 1awp_A* 3mus_A* 1b5m_A* 1eue_A* 1icc_A* 1lj0_A* 2i89_A* Back     alignment and structure
Probab=99.96  E-value=5.4e-30  Score=170.58  Aligned_cols=79  Identities=53%  Similarity=0.931  Sum_probs=75.9

Q ss_pred             CccCHHHHhcccCCCCeEEEEcCEEEecCcCcccCCChHHHHhhhhCCCCchhhhhcCCCHHHHHhhhhceeeeecCCC
Q 032893            3 KVHDFQEVAKHNNRDDCWLVISGKVYNVTPFLEDHPGGDEVLLAATEKDATDDFEDVGHSDSAREMMEKYHIGEIDSSS   81 (131)
Q Consensus         3 ~~~t~~ev~~h~~~~~~wvvi~g~VYDvT~f~~~HPGG~~~l~~~aG~D~T~~f~~~~hs~~a~~~l~~~~VG~l~~~~   81 (131)
                      +.||++||++|++.++|||+|+|+|||||+|+..||||..+|+.++|+|+|+.|+..+||.+|+++|++|+||.|..++
T Consensus        10 ~~~t~~Ev~~h~~~~~~wv~i~g~VYDvT~f~~~HPGG~~~l~~~aG~DaT~~F~~~~Hs~~a~~~L~~~~IG~l~~~~   88 (92)
T 3ner_A           10 TYYRLEEVAKRNSLKELWLVIHGRVYDVTRFLNEHPGGEEVLLEQAGVDASESFEDVGHSSDAREMLKQYYIGDIHPSD   88 (92)
T ss_dssp             CEECHHHHTTCEETTEEEEEETTEEEECGGGTTTCTTCSHHHHTTTTSBCHHHHHHTTCCHHHHHHHGGGEEEEECGGG
T ss_pred             CeeCHHHHHhhCCCCCEEEEECCEEEEcccccccCCCHHHHHHHhcCCcchHHHHHcCCCHHHHHHHHhCeeEEEChHh
Confidence            6899999999999999999999999999999999999999999999999999999888999999999999999998654
>1cyo_A Cytochrome B5; electron transport; HET: HEM; 1.50A {Bos taurus} SCOP: d.120.1.1 PDB: 1bfx_A* 1i87_A 1i8c_A 1iet_A 1ieu_A 1do9_A* 1aqa_A* 1aw3_A* 1axx_A* 1b5a_A* 1b5b_A* 1blv_A* 1mny_A* 2axx_A* 1ib7_A* 1jex_A* 1ehb_A* 1nx7_A* 1u9u_A* 1m20_A* ... Back     alignment and structure
>1cxy_A Cytochrome B5; helix, beta-strand, electron transport; HET: HEM; 1.65A {Ectothiorhodospira shaposhnikovii} SCOP: d.120.1.1 Back     alignment and structure
>1hko_A Cytochrome B5; electron transfer protein, heme, electron transport; HET: HEM; NMR {Bos taurus} SCOP: d.120.1.1 PDB: 2i96_A* Back     alignment and structure
>2ibj_A Cytochrome B5, CYTB5; FLY cytochrome B5, X-RAY diffraction, heme, electron transport; HET: HEM; 1.55A {Musca domestica} Back     alignment and structure
>3lf5_A Cytochrome B5 reductase 4; NCB5OR, electron transfer, redox, heme, endoplasmic reticulu flavoprotein, iron, metal-binding, NAD, oxidoreductase; HET: HEM; 1.25A {Homo sapiens} Back     alignment and structure
>1x3x_A Cytochrome B5; hemoprotein, porcine parasitic namatode, electron transport; HET: HEM; 1.80A {Ascaris suum} Back     alignment and structure
>1mj4_A Sulfite oxidase; cytochrome B5, heme, oxidoreductase; HET: HEM; 1.20A {Homo sapiens} SCOP: d.120.1.1 Back     alignment and structure
>2keo_A Probable E3 ubiquitin-protein ligase HERC2; protein of unknown function, HERC2 cytochrome domain, ligase binding, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>1sox_A Sulfite oxidase; oxidoreductase, sulfite oxidation; HET: MTE HEM EPE; 1.90A {Gallus gallus} SCOP: b.1.18.6 d.120.1.1 d.176.1.1 PDB: 3hc2_A* 3hbq_A* 3hbg_A* 3hbp_A* 3r18_A* 3r19_A* Back     alignment and structure
>1kbi_A Cytochrome B2, L-LCR; flavocytochrome B2, electron transfer, oxidoreductase; HET: HEM FMN; 2.30A {Saccharomyces cerevisiae} SCOP: c.1.4.1 d.120.1.1 PDB: 1fcb_A* 1lco_A* 1ldc_A* 1sze_A* 2oz0_A* 1szf_A* 1szg_A* 1ltd_A* 1kbj_A* 1qcw_A* 3ks0_A* Back     alignment and structure
>1j03_A Putative steroid binding protein; alpha and beta, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: d.120.1.2 PDB: 1t0g_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 131
d1cxya_81 d.120.1.1 (A:) Cytochrome b558 {Ectothiorhodospira 4e-31
d1cyoa_88 d.120.1.1 (A:) Cytochrome b5 {Cow (Bos taurus) [Ta 5e-31
d1euea_86 d.120.1.1 (A:) Cytochrome b5 {Rat (Rattus norvegic 4e-30
d1mj4a_80 d.120.1.1 (A:) Sulfite oxidase, N-terminal domain 7e-28
d1kbia297 d.120.1.1 (A:1-97) Flavocytochrome b2, N-terminal 8e-27
d1soxa291 d.120.1.1 (A:3-93) Sulfite oxidase, N-terminal dom 2e-26
>d1cxya_ d.120.1.1 (A:) Cytochrome b558 {Ectothiorhodospira vacuolata [TaxId: 1054]} Length = 81 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Cytochrome b5-like heme/steroid binding domain
superfamily: Cytochrome b5-like heme/steroid binding domain
family: Cytochrome b5
domain: Cytochrome b558
species: Ectothiorhodospira vacuolata [TaxId: 1054]

 Score =  104 bits (260), Expect = 4e-31
 Identities = 27/78 (34%), Positives = 49/78 (62%), Gaps = 4/78 (5%)

Query: 3  KVHDFQEVAKHNNRDDCWLVISGKVYNVTPFLEDHPGGDEVLLAATEKDATDDFEDVG-- 60
           V   ++VA+H++ DDCW+ I GKVY++TP++ +HPG   ++L    +++T+ +E     
Sbjct: 3  PVFTLEQVAEHHSPDDCWMAIHGKVYDLTPYVPNHPGPAGMMLVWCGQESTEAWETKSYG 62

Query: 61 --HSDSAREMMEKYHIGE 76
            HS  A  ++++Y IG 
Sbjct: 63 EPHSSLAARLLQRYLIGT 80
>d1cyoa_ d.120.1.1 (A:) Cytochrome b5 {Cow (Bos taurus) [TaxId: 9913]} Length = 88 Back     information, alignment and structure
>d1euea_ d.120.1.1 (A:) Cytochrome b5 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 86 Back     information, alignment and structure
>d1mj4a_ d.120.1.1 (A:) Sulfite oxidase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1kbia2 d.120.1.1 (A:1-97) Flavocytochrome b2, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 97 Back     information, alignment and structure
>d1soxa2 d.120.1.1 (A:3-93) Sulfite oxidase, N-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 91 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query131
d1cyoa_88 Cytochrome b5 {Cow (Bos taurus) [TaxId: 9913]} 99.97
d1euea_86 Cytochrome b5 {Rat (Rattus norvegicus) [TaxId: 101 99.97
d1cxya_81 Cytochrome b558 {Ectothiorhodospira vacuolata [Tax 99.96
d1soxa291 Sulfite oxidase, N-terminal domain {Chicken (Gallu 99.95
d1mj4a_80 Sulfite oxidase, N-terminal domain {Human (Homo sa 99.95
d1kbia297 Flavocytochrome b2, N-terminal domain {Baker's yea 99.95
d1t0ga_109 Putative steroid binding protein AT2G24940 {Thale 98.77
>d1cyoa_ d.120.1.1 (A:) Cytochrome b5 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Cytochrome b5-like heme/steroid binding domain
superfamily: Cytochrome b5-like heme/steroid binding domain
family: Cytochrome b5
domain: Cytochrome b5
species: Cow (Bos taurus) [TaxId: 9913]

Probab=99.97  E-value=3.5e-32  Score=178.25  Aligned_cols=80  Identities=48%  Similarity=0.855  Sum_probs=76.7

Q ss_pred             CCccCHHHHhcccCCCCeEEEEcCEEEecCcCcccCCChHHHHhhhhCCCCchhhhhcCCCHHHHHhhhhceeeeecCCC
Q 032893            2 AKVHDFQEVAKHNNRDDCWLVISGKVYNVTPFLEDHPGGDEVLLAATEKDATDDFEDVGHSDSAREMMEKYHIGEIDSSS   81 (131)
Q Consensus         2 ~~~~t~~ev~~h~~~~~~wvvi~g~VYDvT~f~~~HPGG~~~l~~~aG~D~T~~f~~~~hs~~a~~~l~~~~VG~l~~~~   81 (131)
                      .|.||++||++||+.++|||+|+|+|||||+|+..||||.++|+.++|+|+|+.|+..+||..|+++|++|+||+|.+++
T Consensus         4 ~k~yt~~Ev~~H~~~~d~Wvii~g~VYDvT~f~~~HPGG~~~i~~~aG~D~T~~F~~~~hs~~a~~~l~~~~IG~l~~~~   83 (88)
T d1cyoa_           4 VKYYTLEEIQKHNNSKSTWLILHYKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHSTDARELSKTFIIGELHPDD   83 (88)
T ss_dssp             CCEECHHHHTTCEETTEEEEEETTEEEECTTTTTTCTTCSHHHHHHTTSBCHHHHHHTTCCHHHHHHHTTTEEEEECGGG
T ss_pred             cccccHHHHHhhCCCCCeEEEECCEEEecchhhcccCCchHHHHHHcCCchHHHHHHHCCCHHHHHHHHcCccEEECccc
Confidence            37899999999999999999999999999999999999999999999999999999999999999999999999998654
>d1euea_ d.120.1.1 (A:) Cytochrome b5 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1cxya_ d.120.1.1 (A:) Cytochrome b558 {Ectothiorhodospira vacuolata [TaxId: 1054]} Back     information, alignment and structure
>d1soxa2 d.120.1.1 (A:3-93) Sulfite oxidase, N-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1mj4a_ d.120.1.1 (A:) Sulfite oxidase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kbia2 d.120.1.1 (A:1-97) Flavocytochrome b2, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1t0ga_ d.120.1.2 (A:) Putative steroid binding protein AT2G24940 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure