Citrus Sinensis ID: 033071

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------13
MFTNNQRQEERTGRSGTPRLQYLQELVSQFQNSTDEERKEKIVANLANFAYDPYNYTFLRQLNVLELFLDCITEPNEKLVEFGVGGICNASVDPANAAIITKSGGIPLIIECLSSPVRNTVNQRFLPF
ccccHHHHHHHHcccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHccccHHHHHHHHHcccHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHHHHHHcccHHHHHHHHccccccccccccccc
ccccHHHHHHHcccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHHHHHHcccccHHHHHcccccHHHHccccccc
mftnnqrqeertgrsgtprLQYLQELVSQFQNSTDEERKEKIVANLANfaydpynyTFLRQLNVLELFLDCitepneklvefgvggicnasvdpanAAIItksggipliieclsspvrntvnqrflpf
mftnnqrqeertgrsgtprlQYLQELVSQFQNSTDEERKEKIVANLANFAYDPYNYTFLRQLNVLELFLDCITEPNEKLVEFGVGGICNASVDPANAAIITKSGGIPLIIEclsspvrntvnqrflpf
MFTNNQRQEERTGRSGTPRLQYLQELVSQFQNSTDEERKEKIVANLANFAYDPYNYTFLRQLNVLELFLDCITEPNEKLVEFGVGGICNASVDPANAAIITKSGGIPLIIECLSSPVRNTVNQRFLPF
****************************************KIVANLANFAYDPYNYTFLRQLNVLELFLDCITEPNEKLVEFGVGGICNASVDPANAAIITKSGGIPLIIECLSSPVR**********
*************************LVSQ*********KEKIVANLANFAYDPYNYTFLRQLNVLELFLDCITEPNEKLVEFGVGGICNASVDPANAAIITKSGGIPLIIECLSSPVRNTVNQRFLPF
***************GTPRLQYLQELVSQF********KEKIVANLANFAYDPYNYTFLRQLNVLELFLDCITEPNEKLVEFGVGGICNASVDPANAAIITKSGGIPLIIECLSSPVRNTVNQRFLPF
*************RSGTPRLQYLQELVSQFQNSTDEERKEKIVANLANFAYDPYNYTFLRQLNVLELFLDCITEPNEKLVEFGVGGICNASVDPANAAIITKSGGIPLIIECLSSPVRNTVNQRFLPF
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFTNNQRQEERTGRSGTPRLQYLQELVSQFQNSTDEERKEKIVANLANFAYDPYNYTFLRQLNVLELFLDCITEPNEKLVEFGVGGICNASVDPANAAIITKSGGIPLIIECLSSPVRNTVNQRFLPF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query128 2.2.26 [Sep-21-2011]
Q9H6L4198 Armadillo repeat-containi yes no 0.804 0.520 0.592 4e-30
Q3UJZ3198 Armadillo repeat-containi yes no 0.804 0.520 0.563 8e-30
>sp|Q9H6L4|ARMC7_HUMAN Armadillo repeat-containing protein 7 OS=Homo sapiens GN=ARMC7 PE=1 SV=1 Back     alignment and function desciption
 Score =  130 bits (326), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 61/103 (59%), Positives = 77/103 (74%)

Query: 19  RLQYLQELVSQFQNSTDEERKEKIVANLANFAYDPYNYTFLRQLNVLELFLDCITEPNEK 78
           RL YLQ LV++FQ +  ++ KE+++ANLANFAYDP NY +LRQL VL+LFLD ++E NE 
Sbjct: 13  RLGYLQALVTEFQETQSQDAKEQVLANLANFAYDPSNYEYLRQLQVLDLFLDSLSEENET 72

Query: 79  LVEFGVGGICNASVDPANAAIITKSGGIPLIIECLSSPVRNTV 121
           LVEF +GG+CN   D AN   I  +GG+PLII CLSSP   TV
Sbjct: 73  LVEFAIGGLCNLCPDRANKEHILHAGGVPLIINCLSSPNEETV 115

Homo sapiens (taxid: 9606)
>sp|Q3UJZ3|ARMC7_MOUSE Armadillo repeat-containing protein 7 OS=Mus musculus GN=Armc7 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query128
224054220178 predicted protein [Populus trichocarpa] 0.953 0.685 0.893 9e-59
255564444172 Armadillo repeat-containing protein, put 0.953 0.709 0.877 4e-58
225466251177 PREDICTED: armadillo repeat-containing p 0.953 0.689 0.852 1e-55
357147526176 PREDICTED: armadillo repeat-containing p 0.953 0.693 0.819 3e-55
242034989176 hypothetical protein SORBIDRAFT_01g02830 0.945 0.687 0.834 5e-55
212722442176 uncharacterized protein LOC100194252 [Ze 0.945 0.687 0.834 8e-55
357111169176 PREDICTED: armadillo repeat-containing p 0.953 0.693 0.811 1e-54
297805232180 armadillo/beta-catenin repeat family pro 0.953 0.677 0.827 1e-54
21618145180 unknown [Arabidopsis thaliana] 0.953 0.677 0.836 1e-54
15240175180 armadillo/beta-catenin-like repeat-conta 0.953 0.677 0.836 1e-54
>gi|224054220|ref|XP_002298151.1| predicted protein [Populus trichocarpa] gi|222845409|gb|EEE82956.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  231 bits (588), Expect = 9e-59,   Method: Compositional matrix adjust.
 Identities = 109/122 (89%), Positives = 117/122 (95%)

Query: 1   MFTNNQRQEERTGRSGTPRLQYLQELVSQFQNSTDEERKEKIVANLANFAYDPYNYTFLR 60
           MFTNNQRQEERTG+ GTPRLQYLQELV+QFQN+ DEERKE+IVANLANFAYDPYNYTFLR
Sbjct: 1   MFTNNQRQEERTGKYGTPRLQYLQELVNQFQNAADEERKERIVANLANFAYDPYNYTFLR 60

Query: 61  QLNVLELFLDCITEPNEKLVEFGVGGICNASVDPANAAIITKSGGIPLIIECLSSPVRNT 120
           QLNVLELFLDCITEPNEKLVEFG+GGICN+  DPANAAIIT+SGGIPL I+CLSSPVRNT
Sbjct: 61  QLNVLELFLDCITEPNEKLVEFGIGGICNSCDDPANAAIITQSGGIPLTIQCLSSPVRNT 120

Query: 121 VN 122
           VN
Sbjct: 121 VN 122

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255564444|ref|XP_002523218.1| Armadillo repeat-containing protein, putative [Ricinus communis] gi|223537514|gb|EEF39139.1| Armadillo repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|225466251|ref|XP_002270403.1| PREDICTED: armadillo repeat-containing protein 7 [Vitis vinifera] gi|297738150|emb|CBI27351.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|357147526|ref|XP_003574378.1| PREDICTED: armadillo repeat-containing protein 7-like [Brachypodium distachyon] Back     alignment and taxonomy information
>gi|242034989|ref|XP_002464889.1| hypothetical protein SORBIDRAFT_01g028300 [Sorghum bicolor] gi|241918743|gb|EER91887.1| hypothetical protein SORBIDRAFT_01g028300 [Sorghum bicolor] Back     alignment and taxonomy information
>gi|212722442|ref|NP_001132765.1| uncharacterized protein LOC100194252 [Zea mays] gi|194695338|gb|ACF81753.1| unknown [Zea mays] gi|238006382|gb|ACR34226.1| unknown [Zea mays] gi|413923648|gb|AFW63580.1| hypothetical protein ZEAMMB73_692312 [Zea mays] Back     alignment and taxonomy information
>gi|357111169|ref|XP_003557387.1| PREDICTED: armadillo repeat-containing protein 7-like [Brachypodium distachyon] Back     alignment and taxonomy information
>gi|297805232|ref|XP_002870500.1| armadillo/beta-catenin repeat family protein [Arabidopsis lyrata subsp. lyrata] gi|297316336|gb|EFH46759.1| armadillo/beta-catenin repeat family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|21618145|gb|AAM67195.1| unknown [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|15240175|ref|NP_198545.1| armadillo/beta-catenin-like repeat-containing protein [Arabidopsis thaliana] gi|9758715|dbj|BAB09101.1| unnamed protein product [Arabidopsis thaliana] gi|98960935|gb|ABF58951.1| At5g37290 [Arabidopsis thaliana] gi|332006778|gb|AED94161.1| armadillo/beta-catenin-like repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query128
TAIR|locus:2169165180 AT5G37290 [Arabidopsis thalian 0.953 0.677 0.836 5.6e-52
MGI|MGI:2679719198 Armc7 "armadillo repeat contai 0.804 0.520 0.563 3.1e-28
RGD|1310043198 Armc7 "armadillo repeat contai 0.804 0.520 0.563 5e-28
ZFIN|ZDB-GENE-060929-288192 armc7 "armadillo repeat contai 0.835 0.557 0.551 1.5e-26
FB|FBgn0038425 286 CG14881 [Drosophila melanogast 0.781 0.349 0.32 5.2e-13
MGI|MGI:1916449854 Armc2 "armadillo repeat contai 0.742 0.111 0.273 0.00084
TAIR|locus:2169165 AT5G37290 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 539 (194.8 bits), Expect = 5.6e-52, P = 5.6e-52
 Identities = 102/122 (83%), Positives = 111/122 (90%)

Query:     1 MFTNNQRQEERTGRSGTPRLQYLQELVSQFQNSTDEERKEKIVANLANFAYDPYNYTFLR 60
             MFTNNQRQEERTG+ GTPRLQYLQELVSQFQN+TDEE KE+IVANLANFAYDPYNYT LR
Sbjct:     1 MFTNNQRQEERTGKHGTPRLQYLQELVSQFQNATDEETKERIVANLANFAYDPYNYTILR 60

Query:    61 QLNVLELFLDCITEPNEKLVEFGVGGICNASVDPANAAIITKSGGIPLIIECLSSPVRNT 120
             QLNVLELF+DCITEPNEKLVEFG+GGICNA  +P N A I ++ GIPLII+ LSSPVRNT
Sbjct:    61 QLNVLELFVDCITEPNEKLVEFGIGGICNACAEPKNVATIVEADGIPLIIKSLSSPVRNT 120

Query:   121 VN 122
             VN
Sbjct:   121 VN 122
GO:0005634 "nucleus" evidence=ISM
GO:0008150 "biological_process" evidence=ND
MGI|MGI:2679719 Armc7 "armadillo repeat containing 7" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1310043 Armc7 "armadillo repeat containing 7" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060929-288 armc7 "armadillo repeat containing 7" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
FB|FBgn0038425 CG14881 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
MGI|MGI:1916449 Armc2 "armadillo repeat containing 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
fgenesh4_pg.C_LG_I001196
hypothetical protein (178 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query128
cd00020120 cd00020, ARM, Armadillo/beta-catenin-like repeats 8e-09
>gnl|CDD|237987 cd00020, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information 
 Score = 49.6 bits (119), Expect = 8e-09
 Identities = 22/97 (22%), Positives = 46/97 (47%), Gaps = 5/97 (5%)

Query: 23  LQELVSQFQNSTDEERKE--KIVANLANFAYDPYNYTFLRQLNVLELFLDCITEPNEKLV 80
           L  LVS   +S +  ++E    ++NL+    D  N   + +   L   +  +   +E++V
Sbjct: 9   LPALVSLLSSSDENVQREAAWALSNLSAGNND--NIQAVVEAGGLPALVQLLKSEDEEVV 66

Query: 81  EFGVGGICN-ASVDPANAAIITKSGGIPLIIECLSSP 116
           +  +  + N A+    N  I+ ++GG+P ++  L S 
Sbjct: 67  KAALWALRNLAAGPEDNKLIVLEAGGVPKLVNLLDSS 103

An approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila segment polarity gene armadillo; these repeats were also found in the mammalian armadillo homolog beta-catenin, the junctional plaque protein plakoglobin, the adenomatous polyposis coli (APC) tumor suppressor protein, and a number of other proteins. ARM has been implicated in mediating protein-protein interactions, but no common features among the target proteins recognized by the ARM repeats have been identified; related to the HEAT domain; three consecutive copies of the repeat are represented by this alignment model. Length = 120

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 128
KOG4646173 consensus Uncharacterized conserved protein, conta 100.0
cd00020120 ARM Armadillo/beta-catenin-like repeats. An approx 99.4
PF04826 254 Arm_2: Armadillo-like; InterPro: IPR006911 This en 99.02
KOG1206 272 consensus Peroxisomal multifunctional beta-oxidati 98.65
cd00020120 ARM Armadillo/beta-catenin-like repeats. An approx 98.58
PF05804 708 KAP: Kinesin-associated protein (KAP) 98.52
PLN03200 2102 cellulose synthase-interactive protein; Provisiona 98.48
PLN03200 2102 cellulose synthase-interactive protein; Provisiona 98.31
PF05804 708 KAP: Kinesin-associated protein (KAP) 98.27
PF0051441 Arm: Armadillo/beta-catenin-like repeat; InterPro: 98.25
KOG4224 550 consensus Armadillo repeat protein VAC8 required f 98.01
PF04826254 Arm_2: Armadillo-like; InterPro: IPR006911 This en 97.94
smart0018541 ARM Armadillo/beta-catenin-like repeats. Approx. 4 97.88
PF09759102 Atx10homo_assoc: Spinocerebellar ataxia type 10 pr 97.83
KOG4224 550 consensus Armadillo repeat protein VAC8 required f 97.81
PF0051441 Arm: Armadillo/beta-catenin-like repeat; InterPro: 97.68
KOG0166 514 consensus Karyopherin (importin) alpha [Intracellu 97.53
smart0018541 ARM Armadillo/beta-catenin-like repeats. Approx. 4 97.29
KOG1048717 consensus Neural adherens junction protein Plakoph 97.09
KOG1048717 consensus Neural adherens junction protein Plakoph 96.72
PF1364688 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I 96.71
KOG2160 342 consensus Armadillo/beta-catenin-like repeat-conta 96.59
KOG2122 2195 consensus Beta-catenin-binding protein APC, contai 96.49
COG5064 526 SRP1 Karyopherin (importin) alpha [Intracellular t 96.37
KOG1293 678 consensus Proteins containing armadillo/beta-caten 96.34
KOG4646173 consensus Uncharacterized conserved protein, conta 96.25
PF10508 503 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; 96.2
COG5064 526 SRP1 Karyopherin (importin) alpha [Intracellular t 95.88
PF10508 503 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; 95.74
PF03224312 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004 95.7
KOG4500 604 consensus Rho/Rac GTPase guanine nucleotide exchan 95.26
KOG0166514 consensus Karyopherin (importin) alpha [Intracellu 95.13
PRK09687280 putative lyase; Provisional 95.01
PF1351355 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O 94.84
PF05536 543 Neurochondrin: Neurochondrin 94.45
PF03224312 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004 93.18
PF14663115 RasGEF_N_2: Rapamycin-insensitive companion of mTO 93.07
PF08045257 CDC14: Cell division control protein 14, SIN compo 92.56
PF1364688 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I 91.85
KOG4500 604 consensus Rho/Rac GTPase guanine nucleotide exchan 91.35
PF06025 379 DUF913: Domain of Unknown Function (DUF913); Inter 90.67
PF04063192 DUF383: Domain of unknown function (DUF383); Inter 90.47
PF11701157 UNC45-central: Myosin-binding striated muscle asse 90.44
KOG4199461 consensus Uncharacterized conserved protein [Funct 90.0
PF09759102 Atx10homo_assoc: Spinocerebellar ataxia type 10 pr 88.99
KOG2122 2195 consensus Beta-catenin-binding protein APC, contai 88.34
PF0298531 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT re 84.92
PRK09687280 putative lyase; Provisional 84.31
KOG4199 461 consensus Uncharacterized conserved protein [Funct 83.78
KOG2160 342 consensus Armadillo/beta-catenin-like repeat-conta 83.52
PF12460415 MMS19_C: RNAPII transcription regulator C-terminal 82.79
cd00256 429 VATPase_H VATPase_H, regulatory vacuolar ATP synth 81.23
PF01602 526 Adaptin_N: Adaptin N terminal region; InterPro: IP 80.72
KOG1222 791 consensus Kinesin associated protein KAP [Intracel 80.17
>KOG4646 consensus Uncharacterized conserved protein, contains ARM repeats [Function unknown] Back     alignment and domain information 
Probab=100.00  E-value=3.8e-61  Score=372.23  Aligned_cols=121  Identities=55%  Similarity=0.859  Sum_probs=119.0

Q ss_pred             HHHHHhhCCCCCChHHHHHHHHHHhhcCChHHHHHHHHHHhhhhccCCCcHHHHHhhcchhHHHHhhcCCcHHHHHHHhh
Q 033071            6 QRQEERTGRSGTPRLQYLQELVSQFQNSTDEERKEKIVANLANFAYDPYNYTFLRQLNVLELFLDCITEPNEKLVEFGVG   85 (128)
Q Consensus         6 ~~l~~Rtg~~g~~R~eyLq~LV~Efq~t~~~eakeqvlAnLaNFAyDP~N~~~Lrql~vidlFld~L~~~n~~l~efaig   85 (128)
                      +++++|||++|++|+||||+||+|||+|+++|+||||+||||||||||+||.|||||+|+|+|+|+|+++|+.|||||||
T Consensus         1 ~~qk~rt~~hgi~Rl~Ylq~LV~efq~tt~~eakeqv~ANLANFAYDP~Nys~Lrql~vLdlFvdsl~e~ne~LvefgIg   80 (173)
T KOG4646|consen    1 RTQKRRTPAHGIDRLEYLQHLVDEFQTTTNIEAKEQVTANLANFAYDPINYSHLRQLDVLDLFVDSLEEQNELLVEFGIG   80 (173)
T ss_pred             CCcccCCCCccCcHHHHHHHHHHHHHHhccHHHHHHHHHHHHhhccCcchHHHHHHhhHHHHHHHHhhcccHHHHHHhHH
Confidence            36899999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhhhcccChhhHHHHHhcCChhhHHhhhcCCChhhhhhccc
Q 033071           86 GICNASVDPANAAIITKSGGIPLIIECLSSPVRNTVNQRFL  126 (128)
Q Consensus        86 gLcNlclDp~n~~~I~~~ggi~~i~~~LsS~~e~tVl~a~t  126 (128)
                      ||||+|+||.|+++|++.+|||+||.|||||+|+||.||++
T Consensus        81 glCNlC~d~~n~~~I~ea~g~plii~~lssp~e~tv~sa~~  121 (173)
T KOG4646|consen   81 GLCNLCLDKTNAKFIREALGLPLIIFVLSSPPEITVHSAAL  121 (173)
T ss_pred             HHHhhccChHHHHHHHHhcCCceEEeecCCChHHHHHHHHH
Confidence            99999999999999999999999999999999999999985

>cd00020 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function Back     alignment and domain information
>KOG1206 consensus Peroxisomal multifunctional beta-oxidation protein and related enzymes [Lipid transport and metabolism] Back     alignment and domain information
>cd00020 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>PF05804 KAP: Kinesin-associated protein (KAP) Back     alignment and domain information
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>PF05804 KAP: Kinesin-associated protein (KAP) Back     alignment and domain information
>PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless Back     alignment and domain information
>KOG4224 consensus Armadillo repeat protein VAC8 required for vacuole fusion, inheritance and cytosol-to-vacuole protein targeting [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function Back     alignment and domain information
>smart00185 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>PF09759 Atx10homo_assoc: Spinocerebellar ataxia type 10 protein domain; InterPro: IPR019156 This is the conserved C-terminal 100 residues of Ataxin-10 Back     alignment and domain information
>KOG4224 consensus Armadillo repeat protein VAC8 required for vacuole fusion, inheritance and cytosol-to-vacuole protein targeting [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless Back     alignment and domain information
>KOG0166 consensus Karyopherin (importin) alpha [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>smart00185 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>KOG1048 consensus Neural adherens junction protein Plakophilin and related Armadillo repeat proteins [Signal transduction mechanisms; Extracellular structures] Back     alignment and domain information
>KOG1048 consensus Neural adherens junction protein Plakophilin and related Armadillo repeat proteins [Signal transduction mechanisms; Extracellular structures] Back     alignment and domain information
>PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A Back     alignment and domain information
>KOG2160 consensus Armadillo/beta-catenin-like repeat-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2122 consensus Beta-catenin-binding protein APC, contains ARM repeats [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1293 consensus Proteins containing armadillo/beta-catenin-like repeat [General function prediction only] Back     alignment and domain information
>KOG4646 consensus Uncharacterized conserved protein, contains ARM repeats [Function unknown] Back     alignment and domain information
>PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells Back     alignment and domain information
>COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information
>PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells Back     alignment and domain information
>PF03224 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004908 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>KOG4500 consensus Rho/Rac GTPase guanine nucleotide exchange factor smgGDS/Vimar [Signal transduction mechanisms] Back     alignment and domain information
>KOG0166 consensus Karyopherin (importin) alpha [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B Back     alignment and domain information
>PF05536 Neurochondrin: Neurochondrin Back     alignment and domain information
>PF03224 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004908 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>PF14663 RasGEF_N_2: Rapamycin-insensitive companion of mTOR RasGEF_N domain Back     alignment and domain information
>PF08045 CDC14: Cell division control protein 14, SIN component; InterPro: IPR012535 Cdc14 is a component of the septation initiation network (SIN) and is required for the localisation and activity of Sid1 Back     alignment and domain information
>PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A Back     alignment and domain information
>KOG4500 consensus Rho/Rac GTPase guanine nucleotide exchange factor smgGDS/Vimar [Signal transduction mechanisms] Back     alignment and domain information
>PF06025 DUF913: Domain of Unknown Function (DUF913); InterPro: IPR010314 This is a domain of unknown function found towards the N terminus of a family of E3 ubiquitin protein ligases, including yeast TOM1, many of which appear to play a role in mRNA transcription and processing Back     alignment and domain information
>PF04063 DUF383: Domain of unknown function (DUF383); InterPro: IPR007205 This is a protein of unknown function Back     alignment and domain information
>PF11701 UNC45-central: Myosin-binding striated muscle assembly central; InterPro: IPR024660 The UNC-45 or small muscle protein 1 of Caenorhabditis elegans is expressed in two forms from different genomic positions in mammals: as a general tissue protein (UNC-45a) and as a specific form (UNC-45b) expressed only in striated and skeletal muscle Back     alignment and domain information
>KOG4199 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF09759 Atx10homo_assoc: Spinocerebellar ataxia type 10 protein domain; InterPro: IPR019156 This is the conserved C-terminal 100 residues of Ataxin-10 Back     alignment and domain information
>KOG2122 consensus Beta-catenin-binding protein APC, contains ARM repeats [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF02985 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 [] Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>KOG4199 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2160 consensus Armadillo/beta-catenin-like repeat-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12460 MMS19_C: RNAPII transcription regulator C-terminal; InterPro: IPR024687 This domain, approximately 60 amino acids in length, is found in the N-terminal region of MMS19 proteins Back     alignment and domain information
>cd00256 VATPase_H VATPase_H, regulatory vacuolar ATP synthase subunit H (Vma13p); activation component of the peripheral V1 complex of V-ATPase, a heteromultimeric enzyme which uses ATP to actively transport protons into organelles and extracellular compartments Back     alignment and domain information
>PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1222 consensus Kinesin associated protein KAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query128
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 5e-13
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 3e-09
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 4e-09
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 1e-08
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 2e-07
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 9e-04
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 3e-12
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 9e-09
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 1e-08
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 2e-08
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 2e-08
2z6g_A780 B-catenin; FULL-length, beta-catenin, cell adhesio 1e-04
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 6e-12
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 7e-09
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 9e-09
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 8e-08
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 2e-06
2z6h_A644 Catenin beta-1, beta-catenin; C-terminal domain, a 5e-04
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 7e-09
3nmw_A 354 APC variant protein; ARMADIILO repeats domain, cel 7e-06
3nmw_A 354 APC variant protein; ARMADIILO repeats domain, cel 2e-04
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 1e-07
1xqr_A 296 HSPBP1 protein; armadillo repeat, superhelical twi 1e-06
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 4e-07
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 7e-05
2jdq_A 450 Importin alpha-1 subunit; transport, PB2 subunit, 9e-07
2jdq_A 450 Importin alpha-1 subunit; transport, PB2 subunit, 4e-04
4db8_A 252 Armadillo-repeat protein; solenoid repeat, de novo 4e-06
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 8e-06
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 1e-05
3nmz_A 458 APC variant protein; protein-protein complex, arma 7e-06
3nmz_A 458 APC variant protein; protein-protein complex, arma 2e-05
3nmz_A458 APC variant protein; protein-protein complex, arma 4e-04
1wa5_B 530 Importin alpha subunit; nuclear transport/complex, 1e-04
3oqs_A 510 Importin subunit alpha-2; importin alpha, karyophe 2e-04
3oqs_A 510 Importin subunit alpha-2; importin alpha, karyophe 2e-04
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
 Score = 63.3 bits (154), Expect = 5e-13
 Identities = 26/107 (24%), Positives = 38/107 (35%), Gaps = 4/107 (3%)

Query: 14  RSGTPRLQYLQELVSQFQNSTDEERKEKIVAN----LANFAYDPYNYTFLRQLNVLELFL 69
                  Q    +    Q   +  R E+IV      L   A D +N   +R LN + LF+
Sbjct: 407 VRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFV 466

Query: 70  DCITEPNEKLVEFGVGGICNASVDPANAAIITKSGGIPLIIECLSSP 116
             +  P E +     G +C  + D   A  I   G    + E L S 
Sbjct: 467 QLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSR 513
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354 Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354 Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354 Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Length = 296 Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Length = 296 Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 Back     alignment and structure
>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 Back     alignment and structure
>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query128
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 99.41
3l6x_A 584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 99.39
3tt9_A 233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 99.38
4hxt_A252 De novo protein OR329; structural genomics, PSI-bi 99.37
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 99.36
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 99.35
1xm9_A 457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 99.34
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 99.29
4hxt_A 252 De novo protein OR329; structural genomics, PSI-bi 99.28
1xm9_A 457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 99.24
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 99.24
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 99.22
3ul1_B 510 Importin subunit alpha-2; arm repeat, armadillo re 99.21
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 99.17
3tpo_A 529 Importin subunit alpha-2; nuclear import, protein 99.15
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 99.13
3nmz_A458 APC variant protein; protein-protein complex, arma 99.13
3nmz_A 458 APC variant protein; protein-protein complex, arma 99.12
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 99.12
3l6x_A 584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 99.1
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 99.08
4b8j_A 528 Importin subunit alpha-1A; transport protein, nucl 99.02
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 99.0
3tpo_A529 Importin subunit alpha-2; nuclear import, protein 99.0
1xqr_A 296 HSPBP1 protein; armadillo repeat, superhelical twi 98.95
1xqr_A 296 HSPBP1 protein; armadillo repeat, superhelical twi 98.95
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 98.94
3ul1_B 510 Importin subunit alpha-2; arm repeat, armadillo re 98.94
1wa5_B 530 Importin alpha subunit; nuclear transport/complex, 98.91
2jdq_A 450 Importin alpha-1 subunit; transport, PB2 subunit, 98.87
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 98.82
4b8j_A 528 Importin subunit alpha-1A; transport protein, nucl 98.79
3now_A 810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 98.72
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 98.72
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 98.63
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 98.58
3opb_A 778 SWI5-dependent HO expression protein 4; heat and a 98.17
4gmo_A 684 Putative uncharacterized protein; ARM, heat, solen 98.06
3opb_A 778 SWI5-dependent HO expression protein 4; heat and a 98.0
4gmo_A 684 Putative uncharacterized protein; ARM, heat, solen 96.84
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 96.54
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 96.11
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 96.06
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 95.88
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 95.52
3grl_A 651 General vesicular transport factor P115; vesicle t 95.31
3grl_A 651 General vesicular transport factor P115; vesicle t 95.06
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 94.8
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 94.73
2vgl_B 591 AP-2 complex subunit beta-1; cytoplasmic vesicle, 93.53
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 91.45
2vgl_B 591 AP-2 complex subunit beta-1; cytoplasmic vesicle, 88.81
1b3u_A 588 Protein (protein phosphatase PP2A); scaffold prote 87.98
2qk2_A242 LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 86.67
3dad_A 339 FH1/FH2 domain-containing protein 1; formin, FHOD1 85.84
1b3u_A 588 Protein (protein phosphatase PP2A); scaffold prote 85.69
1ibr_B 462 P95, importin beta-1 subunit, nuclear factor; smal 82.98
2qk2_A242 LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 82.27
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Back     alignment and structure
Probab=99.41  E-value=6.9e-13  Score=95.65  Aligned_cols=103  Identities=18%  Similarity=0.346  Sum_probs=91.6

Q ss_pred             HHHHHHHHhhcCChHHHHHHHHHHhhhhc-cCCCcHHHHHhhcchhHHHHhhcCCcHHHHHHHhhhhhhccc-ChhhHHH
Q 033071           22 YLQELVSQFQNSTDEERKEKIVANLANFA-YDPYNYTFLRQLNVLELFLDCITEPNEKLVEFGVGGICNASV-DPANAAI   99 (128)
Q Consensus        22 yLq~LV~Efq~t~~~eakeqvlAnLaNFA-yDP~N~~~Lrql~vidlFld~L~~~n~~l~efaiggLcNlcl-Dp~n~~~   99 (128)
                      +-..|+.-. .+++.+.|+.++..|+|++ .++.+...+.+.++++.++.+|.++++.+++.|+..|+|+|. ++.+++.
T Consensus        13 ~~~~l~~LL-~s~~~~v~~~a~~~L~~l~~~~~~~~~~i~~~g~i~~L~~lL~~~~~~v~~~a~~~L~~l~~~~~~~~~~   91 (210)
T 4db6_A           13 ELPQMVQQL-NSPDQQELQSALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQA   91 (210)
T ss_dssp             CHHHHHHHT-TCSCHHHHHHHHHHHHHHHTSCHHHHHHHHHTTHHHHHHHHTTCSCHHHHHHHHHHHHHHTTSCHHHHHH
T ss_pred             hhHHHHHHh-cCCCHHHHHHHHHHHHHHHcCCHHHHHHHHHcCCHHHHHHHHcCCCHHHHHHHHHHHHHHhcCCcHHHHH
Confidence            334555555 6778999999999999999 679999999999999999999999999999999999999995 7999999


Q ss_pred             HHhcCChhhHHhhhcCCChhhhhhcc
Q 033071          100 ITKSGGIPLIIECLSSPVRNTVNQRF  125 (128)
Q Consensus       100 I~~~ggi~~i~~~LsS~~e~tVl~a~  125 (128)
                      |++.|+|+.++.+|+++++++...|.
T Consensus        92 i~~~g~i~~L~~lL~~~~~~v~~~a~  117 (210)
T 4db6_A           92 VIDAGALPALVQLLSSPNEQILQEAL  117 (210)
T ss_dssp             HHHTTCHHHHHHHTTCSCHHHHHHHH
T ss_pred             HHHCCCHHHHHHHHcCCcHHHHHHHH
Confidence            99999999999999999988766553
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Back     alignment and structure
>4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Back     alignment and structure
>4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Back     alignment and structure
>3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Back     alignment and structure
>3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Back     alignment and structure
>4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Back     alignment and structure
>3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Back     alignment and structure
>3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Back     alignment and structure
>4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>4gmo_A Putative uncharacterized protein; ARM, heat, solenoid, nuclear transport, chaperone, RPL5, RPL KAP104, nucleus; 2.10A {Chaetomium thermophilum var} PDB: 4gmn_A Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>4gmo_A Putative uncharacterized protein; ARM, heat, solenoid, nuclear transport, chaperone, RPL5, RPL KAP104, nucleus; 2.10A {Chaetomium thermophilum var} PDB: 4gmn_A Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Back     alignment and structure
>3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A Back     alignment and structure
>3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Back     alignment and structure
>2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Back     alignment and structure
>2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Back     alignment and structure
>2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3dad_A FH1/FH2 domain-containing protein 1; formin, FHOD1, GTPase-binding domain, ubiquitin-superfold, armadillo repeats, actin-binding, coiled coil; 2.30A {Homo sapiens} Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Back     alignment and structure
>1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A Back     alignment and structure
>2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 128
d1jdha_529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 2e-11
d1jdha_ 529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 1e-08
d1xqra1 264 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (Hsp 1e-04
d1xm9a1 457 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo 6e-04
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: ARM repeat
family: Armadillo repeat
domain: beta-Catenin
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 57.6 bits (137), Expect = 2e-11
 Identities = 26/107 (24%), Positives = 38/107 (35%), Gaps = 4/107 (3%)

Query: 14  RSGTPRLQYLQELVSQFQNSTDEERKEKIVAN----LANFAYDPYNYTFLRQLNVLELFL 69
                  Q    +    Q   +  R E+IV      L   A D +N   +R LN + LF+
Sbjct: 407 VRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFV 466

Query: 70  DCITEPNEKLVEFGVGGICNASVDPANAAIITKSGGIPLIIECLSSP 116
             +  P E +     G +C  + D   A  I   G    + E L S 
Sbjct: 467 QLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSR 513
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 264 Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 457 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query128
d1xm9a1 457 Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.43
d1jdha_529 beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} 99.25
d1jdha_ 529 beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} 99.19
d1xqra1264 Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi 99.14
d1xqra1264 Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi 99.07
d1q1sc_ 434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 99.02
d1wa5b_ 503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 98.99
d1xm9a1457 Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} 98.98
d1q1sc_ 434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 98.98
d1wa5b_ 503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 98.49
d1te4a_111 MTH187 {Archaeon Methanobacterium thermoautotrophi 96.01
d1te4a_111 MTH187 {Archaeon Methanobacterium thermoautotrophi 92.92
d1oyza_ 276 Hypothetical protein YibA {Escherichia coli [TaxId 90.44
d1b3ua_ 588 Constant regulatory domain of protein phosphatase 87.14
d1b3ua_ 588 Constant regulatory domain of protein phosphatase 85.71
d1oyza_ 276 Hypothetical protein YibA {Escherichia coli [TaxId 84.06
d2vgla_ 584 Adaptin alpha C subunit N-terminal fragment {Mouse 82.49
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: ARM repeat
family: Plakophilin 1 helical region
domain: Plakophilin 1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.43  E-value=2.6e-13  Score=99.30  Aligned_cols=96  Identities=17%  Similarity=0.209  Sum_probs=87.5

Q ss_pred             HHHHHHHhhcCChHHHHHHHHHHhhhhcc-CCCcHHHHHhhcchhHHHHhhcCCcHHHHHHHhhhhhhccc-ChhhHHHH
Q 033071           23 LQELVSQFQNSTDEERKEKIVANLANFAY-DPYNYTFLRQLNVLELFLDCITEPNEKLVEFGVGGICNASV-DPANAAII  100 (128)
Q Consensus        23 Lq~LV~Efq~t~~~eakeqvlAnLaNFAy-DP~N~~~Lrql~vidlFld~L~~~n~~l~efaiggLcNlcl-Dp~n~~~I  100 (128)
                      ++.||.-. .+++.+.|+.++.-|.|.++ |+.|+..+++.|+|+.++.+|+++++.+++.|+++|+||+. +++++..|
T Consensus         4 ip~lv~~L-~~~~~~~~~~a~~~l~~l~~~~~~~~~~i~~~g~i~~Lv~lL~~~~~~v~~~a~~aL~~L~~~~~~~~~~i   82 (457)
T d1xm9a1           4 IPKAVQYL-SSQDEKYQAIGAYYIQHTCFQDESAKQQVYQLGGICKLVDLLRSPNQNVQQAAAGALRNLVFRSTTNKLET   82 (457)
T ss_dssp             HHHHHHHH-HSSCTHHHHHHHHHHHHHTSSCSSHHHHHHHTTHHHHHHHHTTSSCHHHHHHHHHHHHHHHSSCHHHHHHH
T ss_pred             HHHHHHHh-CCCCHHHHHHHHHHHHHHHcCCHHHHHHHHHCCcHHHHHHHHCCCCHHHHHHHHHHHHHHHcCCHHHHHHH
Confidence            56778766 78889999999999999987 69999999999999999999999999999999999999995 59999999


Q ss_pred             HhcCChhhHHhhhcCCChh
Q 033071          101 TKSGGIPLIIECLSSPVRN  119 (128)
Q Consensus       101 ~~~ggi~~i~~~LsS~~e~  119 (128)
                      .+.|||+.++.++++....
T Consensus        83 ~~~g~v~~li~~l~~~~~~  101 (457)
T d1xm9a1          83 RRQNGIREAVSLLRRTGNA  101 (457)
T ss_dssp             HHTTCHHHHHHHHTTCCCH
T ss_pred             HHCCChHHHHHHHhccCcH
Confidence            9999999999998765543
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure