Citrus Sinensis ID: 033077


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------13
MESSSSCGAKEEEVEVGDYNSSTMKKARLHSTLTALLDDPILADVPKKPTLSDVDTLISLEMGSAMRISILKLDGTSFDVAVMNSATVKDLKLAIKKKVNDMEQSNLGHRHISWQVFIAPSIQSCSSV
cccccccccccHHHHHcccccHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHcccEEEEEEEcccccEEEEEEcccccHHHHHHHHHHHHHHHHHHccccEEEEEccccccEEEccccc
cccccccccccccEEHcccccHHHHHHHHHHHHHHHHccccHccccccccHHHHHHHHHHHHcccEEEEEEEccccEEEEEEEEcccHHHHHHHHHHHHHHHHHHHcccEEEEHHHEHHcEEEEcccc
messsscgakeeevevgdynsstmkkARLHSTLTallddpiladvpkkptlsdvdTLISLEMGSAMRISILKLDGTSFDVAVMNSATVKDLKLAIKKKVNDmeqsnlghrhiswqvfiapsiqscssv
messsscgakeeevevgdynsstmkKARLHSTLTALLddpiladvpkkptlsdVDTLISLEMGSAMRISILKLDGTSFDVAVMNSATVKDLKLAIKKKVNDMEQSNLghrhiswqvfiapsiqscssv
MESSSSCGAKEEEVEVGDYNSSTMKKARLHSTLTALLDDPILADVPKKPTLSDVDTLISLEMGSAMRISILKLDGTSFDVAVMNSATVKDLKLAIKKKVNDMEQSNLGHRHISWQVFIAPSIQSCSSV
*******************************TLTALLDDPILADVPKKPTLSDVDTLISLEMGSAMRISILKLDGTSFDVAVMNSATVKDLKLAIKKKVNDMEQSNLGHRHISWQVFIAP********
***************************RLHSTLTALLDDPILADVPKKPTLSDVDTLISLEMGSAMRISILKLDGTSFDVAVMNSATVKDLKLAIKK***************SWQVFIAPSIQSCSSV
*******************NSSTMKKARLHSTLTALLDDPILADVPKKPTLSDVDTLISLEMGSAMRISILKLDGTSFDVAVMNSATVKDLKLAIKKKVNDMEQSNLGHRHISWQVFIAPSIQSCSSV
************EVEVGDYNSSTMKKARLHSTLTALLDDPILADVPKKPTLSDVDTLISLEMGSAMRISILKLDGTSFDVAVMNSATVKDLKLAIKKKVNDMEQSNLGHRHISWQVFIAPSIQSCSS*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MESSSSCGAKEEEVEVGDYNSSTMKKARLHSTLTALLDDPILADVPKKPTLSDVDTLISLEMGSAMRISILKLDGTSFDVAVMNSATVKDLKLAIKKKVNDMEQSNLGHRHISWQVFIAPSIQSCSSV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query128 2.2.26 [Sep-21-2011]
Q9BV90132 U11/U12 small nuclear rib yes no 0.671 0.651 0.406 7e-13
Q3ZBQ4123 U11/U12 small nuclear rib yes no 0.617 0.642 0.417 4e-12
Q8VIK1123 U11/U12 small nuclear rib yes no 0.617 0.642 0.417 4e-12
>sp|Q9BV90|SNR25_HUMAN U11/U12 small nuclear ribonucleoprotein 25 kDa protein OS=Homo sapiens GN=SNRNP25 PE=1 SV=1 Back     alignment and function desciption
 Score = 72.4 bits (176), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 35/86 (40%), Positives = 53/86 (61%)

Query: 29  LHSTLTALLDDPILADVPKKPTLSDVDTLISLEMGSAMRISILKLDGTSFDVAVMNSATV 88
               L  ++ DP+L D+P + TL +V++ I+LE G AM + + K+DG    V V+ SATV
Sbjct: 4   FQEGLAMVVQDPLLCDLPIQVTLEEVNSQIALEYGQAMTVRVCKMDGEVMPVVVVQSATV 63

Query: 89  KDLKLAIKKKVNDMEQSNLGHRHISW 114
            DLK AI++ V   ++   G +HISW
Sbjct: 64  LDLKKAIQRYVQLKQEREGGIQHISW 89





Homo sapiens (taxid: 9606)
>sp|Q3ZBQ4|SNR25_BOVIN U11/U12 small nuclear ribonucleoprotein 25 kDa protein OS=Bos taurus GN=SNRNP25 PE=2 SV=2 Back     alignment and function description
>sp|Q8VIK1|SNR25_MOUSE U11/U12 small nuclear ribonucleoprotein 25 kDa protein OS=Mus musculus GN=Snrnp25 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query128
225459779176 PREDICTED: U11/U12 small nuclear ribonuc 0.867 0.630 0.819 8e-47
224065725173 predicted protein [Populus trichocarpa] 0.859 0.635 0.782 1e-42
356538591190 PREDICTED: U11/U12 small nuclear ribonuc 0.929 0.626 0.697 6e-41
356541000187 PREDICTED: U11/U12 small nuclear ribonuc 0.953 0.652 0.680 7e-41
255638264190 unknown [Glycine max] 0.953 0.642 0.672 2e-40
356538589163 PREDICTED: U11/U12 small nuclear ribonuc 0.859 0.674 0.736 6e-40
449455569181 PREDICTED: U11/U12 small nuclear ribonuc 0.820 0.580 0.773 2e-39
307136304181 hypothetical protein [Cucumis melo subsp 0.828 0.585 0.747 6e-38
388501190163 unknown [Lotus japonicus] 0.781 0.613 0.78 1e-37
449519748209 PREDICTED: U11/U12 small nuclear ribonuc 0.710 0.435 0.824 2e-36
>gi|225459779|ref|XP_002285907.1| PREDICTED: U11/U12 small nuclear ribonucleoprotein 25 kDa protein [Vitis vinifera] gi|302141700|emb|CBI18903.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  191 bits (485), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 91/111 (81%), Positives = 103/111 (92%)

Query: 5   SSCGAKEEEVEVGDYNSSTMKKARLHSTLTALLDDPILADVPKKPTLSDVDTLISLEMGS 64
           SS G K EE +VG YNS+ +KKARLHSTLTALLDDPILADVPK+PTLSDVDTLI+LE+GS
Sbjct: 3   SSGGGKREEEDVGSYNSNNVKKARLHSTLTALLDDPILADVPKEPTLSDVDTLINLELGS 62

Query: 65  AMRISILKLDGTSFDVAVMNSATVKDLKLAIKKKVNDMEQSNLGHRHISWQ 115
           AMRIS++KLD TSFDVAV+NSATVKDLKLAIKKK+NDMEQS +GHRHISW+
Sbjct: 63  AMRISVIKLDSTSFDVAVLNSATVKDLKLAIKKKINDMEQSKMGHRHISWK 113




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224065725|ref|XP_002301940.1| predicted protein [Populus trichocarpa] gi|222843666|gb|EEE81213.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356538591|ref|XP_003537786.1| PREDICTED: U11/U12 small nuclear ribonucleoprotein 25 kDa protein-like isoform 2 [Glycine max] Back     alignment and taxonomy information
>gi|356541000|ref|XP_003538972.1| PREDICTED: U11/U12 small nuclear ribonucleoprotein 25 kDa protein-like [Glycine max] Back     alignment and taxonomy information
>gi|255638264|gb|ACU19445.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|356538589|ref|XP_003537785.1| PREDICTED: U11/U12 small nuclear ribonucleoprotein 25 kDa protein-like isoform 1 [Glycine max] Back     alignment and taxonomy information
>gi|449455569|ref|XP_004145525.1| PREDICTED: U11/U12 small nuclear ribonucleoprotein 25 kDa protein-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|307136304|gb|ADN34128.1| hypothetical protein [Cucumis melo subsp. melo] Back     alignment and taxonomy information
>gi|388501190|gb|AFK38661.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|449519748|ref|XP_004166896.1| PREDICTED: U11/U12 small nuclear ribonucleoprotein 25 kDa protein-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query128
TAIR|locus:2077447165 AT3G07860 "AT3G07860" [Arabido 0.882 0.684 0.649 7.4e-34
UNIPROTKB|Q9BV90132 SNRNP25 "U11/U12 small nuclear 0.640 0.621 0.426 7.1e-13
ZFIN|ZDB-GENE-050417-179173 zgc:112000 "zgc:112000" [Danio 0.648 0.479 0.385 1.2e-12
UNIPROTKB|Q3ZBQ4123 SNRNP25 "U11/U12 small nuclear 0.617 0.642 0.417 3.1e-12
MGI|MGI:1925622123 Snrnp25 "small nuclear ribonuc 0.617 0.642 0.417 3.1e-12
RGD|1310922119 Snrnp25 "small nuclear ribonuc 0.609 0.655 0.410 4.5e-11
TAIR|locus:2145502 208 AT5G25340 "AT5G25340" [Arabido 0.367 0.225 0.510 1.3e-06
TAIR|locus:2116495 239 AT4G32270 "AT4G32270" [Arabido 0.367 0.196 0.387 0.00027
TAIR|locus:2077447 AT3G07860 "AT3G07860" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 368 (134.6 bits), Expect = 7.4e-34, P = 7.4e-34
 Identities = 74/114 (64%), Positives = 93/114 (81%)

Query:    14 VEVGDYNSSTMKKARLHSTLTALLDDPILADVPKKPTLSDVDTLISLEMGSAMRISILKL 73
             +E GDY+  T K+ +L S L+ LL DPILADVP+ PTLSDV TL+SLE GSAMR+S++KL
Sbjct:     1 MESGDYDVET-KREKLKSVLSQLLADPILADVPRNPTLSDVVTLVSLEKGSAMRLSVVKL 59

Query:    74 DGTSFDVAVMNSATVKDLKLAIKKKVNDMEQSNLGHRHISWQVFIAPSIQSCSS 127
             DG+S DVAVMNSAT+KDLKL IKKKVN+MEQ+N+GHRHISW+   +    SC++
Sbjct:    60 DGSSLDVAVMNSATLKDLKLLIKKKVNEMEQANMGHRHISWKHVWSNFCLSCNN 113




GO:0003674 "molecular_function" evidence=ND
GO:0005634 "nucleus" evidence=ISM
GO:0006626 "protein targeting to mitochondrion" evidence=RCA
UNIPROTKB|Q9BV90 SNRNP25 "U11/U12 small nuclear ribonucleoprotein 25 kDa protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050417-179 zgc:112000 "zgc:112000" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q3ZBQ4 SNRNP25 "U11/U12 small nuclear ribonucleoprotein 25 kDa protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:1925622 Snrnp25 "small nuclear ribonucleoprotein 25 (U11/U12)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1310922 Snrnp25 "small nuclear ribonucleoprotein 25 (U11/U12)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
TAIR|locus:2145502 AT5G25340 "AT5G25340" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2116495 AT4G32270 "AT4G32270" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00015525001
SubName- Full=Chromosome chr18 scaffold_1, whole genome shotgun sequence; (176 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 128
cd0180478 midnolin_N Ubiquitin-like domain of midnolin. midn 97.51
cd0179173 Ubl5 UBL5 ubiquitin-like modifier. UBL5 (also know 97.22
cd0180676 Nedd8 Nebb8-like ubiquitin protein. Nedd8 (also kn 97.11
cd0180577 RAD23_N Ubiquitin-like domain of RAD23. RAD23 belo 97.09
cd0180376 Ubiquitin Ubiquitin. Ubiquitin (includes Ubq/RPL40 97.06
cd0179280 ISG15_repeat1 ISG15 ubiquitin-like protein, first 97.01
cd0180972 Scythe_N Ubiquitin-like domain of Scythe protein. 96.98
cd0180774 GDX_N ubiquitin-like domain of GDX. GDX contains a 96.9
smart0021364 UBQ Ubiquitin homologues. Ubiquitin-mediated prote 96.58
cd0181074 ISG15_repeat2 ISG15 ubiquitin-like protein, second 96.49
cd0181271 BAG1_N Ubiquitin-like domain of BAG1. BAG1_N N-ter 96.36
PTZ0004476 ubiquitin; Provisional 96.34
cd0179079 Herp_N Homocysteine-responsive endoplasmic reticul 96.13
cd01802103 AN1_N ubiquitin-like domain of AN1. AN1 (also know 96.0
cd0181374 UBP_N UBP ubiquitin processing protease. The UBP ( 95.95
cd0176969 UBL Ubiquitin-like domain of UBL. UBLs function by 95.77
PF1197672 Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; Inter 95.74
PF0024069 ubiquitin: Ubiquitin family; InterPro: IPR000626 U 95.74
cd0179870 parkin_N amino-terminal ubiquitin-like of parkin p 95.49
cd0179778 NIRF_N amino-terminal ubiquitin-like domain of Np9 95.42
cd0180871 hPLIC_N Ubiquitin-like domain of hPLIC-1 and hPLIC 95.3
cd0179470 DC_UbP_C dendritic cell derived ubiquitin-like pro 95.28
cd0179671 DDI1_N DNA damage inducible protein 1 ubiquitin-li 94.95
TIGR00601 378 rad23 UV excision repair protein Rad23. All protei 94.35
cd0180076 SF3a120_C Ubiquitin-like domain of Mammalian splic 94.0
PLN02560 308 enoyl-CoA reductase 93.69
cd0179374 Fubi Fubi ubiquitin-like protein. Fubi is a ubiqui 93.47
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 93.02
cd0019669 UBQ Ubiquitin-like proteins. Ubiquitin homologs; I 92.11
cd0176387 Sumo Small ubiquitin-related modifier (SUMO). Smal 91.86
PF1154380 UN_NPL4: Nuclear pore localisation protein NPL4; I 90.89
PF0881779 YukD: WXG100 protein secretion system (Wss), prote 89.98
PF1456087 Ubiquitin_2: Ubiquitin-like domain; PDB: 1WJN_A 2K 88.68
KOG0010 493 consensus Ubiquitin-like protein [Posttranslationa 88.4
PF0937980 FERM_N: FERM N-terminal domain ; InterPro: IPR0189 87.86
cd0177597 CYR1_RA Ubiquitin domain of CYR1 adenylate cyclase 87.73
PF14533 213 USP7_C2: Ubiquitin-specific protease C-terminal; P 87.3
PF13881111 Rad60-SLD_2: Ubiquitin-2 like Rad60 SUMO-like; PDB 87.26
cd01795107 USP48_C USP ubiquitin-specific protease. The USP ( 87.13
cd0179975 Hoil1_N Ubiquitin-like domain of HOIL1. HOIL1_N HO 86.77
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 84.81
smart0066681 PB1 PB1 domain. Phox and Bem1p domain, present in 84.45
smart0036272 RRM_2 RNA recognition motif. 84.12
PRK13552 239 frdB fumarate reductase iron-sulfur subunit; Provi 84.05
smart00295 207 B41 Band 4.1 homologues. Also known as ezrin/radix 81.13
PF0078893 RA: Ras association (RalGDS/AF-6) domain; InterPro 80.95
>cd01804 midnolin_N Ubiquitin-like domain of midnolin Back     alignment and domain information
Probab=97.51  E-value=0.00024  Score=48.09  Aligned_cols=36  Identities=33%  Similarity=0.521  Sum_probs=33.7

Q ss_pred             eeEEEEEcCCCceeeEEEeCCCcHHHHHHHHHHHHh
Q 033077           65 AMRISILKLDGTSFDVAVMNSATVKDLKLAIKKKVN  100 (128)
Q Consensus        65 Am~l~V~k~Dgs~~~VvV~~~ATV~dLKkAI~~~~~  100 (128)
                      +|+|+|.-..|..++|.|+.++||.|||+.|+..+.
T Consensus         1 ~m~I~Vk~~~G~~~~l~v~~~~TV~~LK~~I~~~~~   36 (78)
T cd01804           1 PMNLNIHSTTGTRFDLSVPPDETVEGLKKRISQRLK   36 (78)
T ss_pred             CeEEEEEECCCCEEEEEECCcCHHHHHHHHHHHHhC
Confidence            489999999999999999999999999999998874



midnolin_N Midnolin (midbrain nucleolar protein) is expressed in the nucleolus and is thought to regulate genes involved in neurogenesis. Midnolin contains an amino-terminal ubiquitin-like domain.

>cd01791 Ubl5 UBL5 ubiquitin-like modifier Back     alignment and domain information
>cd01806 Nedd8 Nebb8-like ubiquitin protein Back     alignment and domain information
>cd01805 RAD23_N Ubiquitin-like domain of RAD23 Back     alignment and domain information
>cd01803 Ubiquitin Ubiquitin Back     alignment and domain information
>cd01792 ISG15_repeat1 ISG15 ubiquitin-like protein, first repeat of 2 Back     alignment and domain information
>cd01809 Scythe_N Ubiquitin-like domain of Scythe protein Back     alignment and domain information
>cd01807 GDX_N ubiquitin-like domain of GDX Back     alignment and domain information
>smart00213 UBQ Ubiquitin homologues Back     alignment and domain information
>cd01810 ISG15_repeat2 ISG15 ubiquitin-like protein, second repeat of 2 Back     alignment and domain information
>cd01812 BAG1_N Ubiquitin-like domain of BAG1 Back     alignment and domain information
>PTZ00044 ubiquitin; Provisional Back     alignment and domain information
>cd01790 Herp_N Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain protein Back     alignment and domain information
>cd01802 AN1_N ubiquitin-like domain of AN1 Back     alignment and domain information
>cd01813 UBP_N UBP ubiquitin processing protease Back     alignment and domain information
>cd01769 UBL Ubiquitin-like domain of UBL Back     alignment and domain information
>PF11976 Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; InterPro: IPR022617 This entry includes small ubiquitin-related modifier (SUMO) proteins Back     alignment and domain information
>PF00240 ubiquitin: Ubiquitin family; InterPro: IPR000626 Ubiquitinylation is an ATP-dependent process that involves the action of at least three enzymes: a ubiquitin-activating enzyme (E1, IPR000011 from INTERPRO), a ubiquitin-conjugating enzyme (E2, IPR000608 from INTERPRO), and a ubiquitin ligase (E3, IPR000569 from INTERPRO, IPR003613 from INTERPRO), which work sequentially in a cascade Back     alignment and domain information
>cd01798 parkin_N amino-terminal ubiquitin-like of parkin protein Back     alignment and domain information
>cd01797 NIRF_N amino-terminal ubiquitin-like domain of Np95 and NIRF Back     alignment and domain information
>cd01808 hPLIC_N Ubiquitin-like domain of hPLIC-1 and hPLIC2 Back     alignment and domain information
>cd01794 DC_UbP_C dendritic cell derived ubiquitin-like protein Back     alignment and domain information
>cd01796 DDI1_N DNA damage inducible protein 1 ubiquitin-like domain Back     alignment and domain information
>TIGR00601 rad23 UV excision repair protein Rad23 Back     alignment and domain information
>cd01800 SF3a120_C Ubiquitin-like domain of Mammalian splicing factor SF3a_120 Back     alignment and domain information
>PLN02560 enoyl-CoA reductase Back     alignment and domain information
>cd01793 Fubi Fubi ubiquitin-like protein Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>cd00196 UBQ Ubiquitin-like proteins Back     alignment and domain information
>cd01763 Sumo Small ubiquitin-related modifier (SUMO) Back     alignment and domain information
>PF11543 UN_NPL4: Nuclear pore localisation protein NPL4; InterPro: IPR024682 Npl4, along with Ufd1, forms the heterodimer adaptor complex UN, which is involved in the recruitment of p97, an AAA ATPase, for tasks involving the ubiquitin pathway Back     alignment and domain information
>PF08817 YukD: WXG100 protein secretion system (Wss), protein YukD; InterPro: IPR014921 YukD is a bacterial protein that adopts a ubiquitin-like fold [] Back     alignment and domain information
>PF14560 Ubiquitin_2: Ubiquitin-like domain; PDB: 1WJN_A 2KJ6_A 2KJR_A 1V6E_A 1T0Y_A Back     alignment and domain information
>KOG0010 consensus Ubiquitin-like protein [Posttranslational modification, protein turnover, chaperones; General function prediction only] Back     alignment and domain information
>PF09379 FERM_N: FERM N-terminal domain ; InterPro: IPR018979 This domain is the N-terminal ubiquitin-like structural domain of the FERM domain Back     alignment and domain information
>cd01775 CYR1_RA Ubiquitin domain of CYR1 adenylate cyclase Back     alignment and domain information
>PF14533 USP7_C2: Ubiquitin-specific protease C-terminal; PDB: 2YLM_A Back     alignment and domain information
>PF13881 Rad60-SLD_2: Ubiquitin-2 like Rad60 SUMO-like; PDB: 1SE9_A 1WGH_A 2GOW_A Back     alignment and domain information
>cd01795 USP48_C USP ubiquitin-specific protease Back     alignment and domain information
>cd01799 Hoil1_N Ubiquitin-like domain of HOIL1 Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>smart00666 PB1 PB1 domain Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>PRK13552 frdB fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>smart00295 B41 Band 4 Back     alignment and domain information
>PF00788 RA: Ras association (RalGDS/AF-6) domain; InterPro: IPR000159 Proteins with this domain are mostly RasGTP effectors and include guanine-nucleotide releasing factor in mammals [] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query128
1v2y_A105 Solution Structure Of Mouse Hypothetical Gene (Rike 6e-05
>pdb|1V2Y|A Chain A, Solution Structure Of Mouse Hypothetical Gene (Riken Cdna 3300001g02) Product Homologous To Ubiquitin Fold Length = 105 Back     alignment and structure

Iteration: 1

Score = 42.7 bits (99), Expect = 6e-05, Method: Compositional matrix adjust. Identities = 21/51 (41%), Positives = 31/51 (60%) Query: 64 SAMRISILKLDGTSFDVAVMNSATVKDLKLAIKKKVNDMEQSNLGHRHISW 114 S M + + K+DG V V+ +ATV DLK AI++ V ++ G +HISW Sbjct: 6 SGMTVRVCKMDGEVMPVVVVQNATVLDLKKAIQRYVQLKQEREGGVQHISW 56

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query128
1v2y_A105 3300001G02RIK protein; hypothetical protein, ubiqu 2e-20
>1v2y_A 3300001G02RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Length = 105 Back     alignment and structure
 Score = 78.5 bits (193), Expect = 2e-20
 Identities = 21/52 (40%), Positives = 31/52 (59%)

Query: 64  SAMRISILKLDGTSFDVAVMNSATVKDLKLAIKKKVNDMEQSNLGHRHISWQ 115
           S M + + K+DG    V V+ +ATV DLK AI++ V   ++   G +HISW 
Sbjct: 6   SGMTVRVCKMDGEVMPVVVVQNATVLDLKKAIQRYVQLKQEREGGVQHISWS 57


Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query128
1v2y_A105 3300001G02RIK protein; hypothetical protein, ubiqu 99.86
3mtn_B85 UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquit 97.81
3n3k_B85 Ubiquitin; hydrolase, protease, thiol protease, DU 97.68
3dbh_I88 NEDD8; cell cycle, activating enzyme, apoptosis, m 97.47
4hcn_B98 Polyubiquitin, ubiquitin; ubiquitin/NEDD8 deamidas 97.43
3a9j_A76 Ubiquitin; protein complex, cytoplasm, isopeptide 97.42
3v6c_B91 Ubiquitin; structural genomics, structural genomic 97.4
1sif_A88 Ubiquitin; hydrophobic mutants, folding, stability 97.37
2dzi_A81 Ubiquitin-like protein 4A; GDX, structural genomic 97.34
1ndd_A76 NEDD8, protein (ubiquitin-like protein NEDD8); pro 97.33
4eew_A88 Large proline-rich protein BAG6; ubiquitin-like fo 97.31
3phx_B79 Ubiquitin-like protein ISG15; OTU domain, DE-ubiqu 97.24
3k9o_B96 Ubiquitin, UBB+1; E2-25K, complex structure, ATP-b 97.22
2kk8_A84 Uncharacterized protein AT4G05270; solution arabid 97.19
3vdz_A111 Ubiquitin-40S ribosomal protein S27A; gadolinium, 97.18
4fbj_B88 NEDD8; effector-HOST target complex, glutamine dea 97.11
4dwf_A90 HLA-B-associated transcript 3; ubiquitin-like doma 97.08
1wh3_A87 59 kDa 2'-5'-oligoadenylate synthetase like protei 97.08
2bwf_A77 Ubiquitin-like protein DSK2; signaling protein, UB 97.04
1yx5_B98 Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo s 97.03
2wyq_A85 HHR23A, UV excision repair protein RAD23 homolog A 96.99
2hj8_A88 Interferon-induced 17 kDa protein; HR2873B, human 96.94
1wia_A95 Hypothetical ubiquitin-like protein (riken cDNA 20 96.89
2ojr_A111 Ubiquitin; lanthide-binding TAG, terbium, TB, SAD 96.87
1uel_A95 HHR23B, UV excision repair protein RAD23 homolog B 96.85
2uyz_B79 Small ubiquitin-related modifier 1; sumoylation, c 96.79
1wy8_A89 NP95-like ring finger protein, isoform A; ubiquiti 96.73
2faz_A78 Ubiquitin-like containing PHD and ring finger DOM 96.72
3b08_A152 Polyubiquitin-C, ubiquitin; protein complex, signa 96.69
1ttn_A106 DC-UBP, dendritic cell-derived ubiquitin-like prot 96.59
1wx8_A96 Riken cDNA 4931431F19; ubiquitin-like domain, ubiq 96.52
1v86_A95 DNA segment, CHR 7, wayne state university 128, ex 96.47
1uh6_A100 Ubiquitin-like 5; beta-grAsp fold, structural geno 96.43
3b1l_X76 E3 ubiquitin-protein ligase parkin; proteasome, AL 95.43
1wyw_B97 Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Ho 96.36
1wgd_A93 Homocysteine-responsive endoplasmic reticulum- res 96.33
2kd0_A85 LRR repeats and ubiquitin-like domain-containing p 96.28
3m62_B106 UV excision repair protein RAD23; armadillo-like r 96.21
2klc_A101 Ubiquilin-1; ubiquitin-like, structural genomics, 96.21
3u30_A172 Ubiquitin, linear DI-ubiquitin; immune system; 2.4 96.2
3b08_A152 Polyubiquitin-C, ubiquitin; protein complex, signa 96.11
1yqb_A100 Ubiquilin 3; structural genomics consortium, ubiqu 96.1
3rt3_B159 Ubiquitin-like protein ISG15; ubiquitin-like domai 96.09
1we6_A111 Splicing factor, putative; structural genomics, ub 96.08
1wx7_A106 Ubiquilin 3; ubiquitin-like domain, structural gen 96.04
2kan_A94 Uncharacterized protein AR3433A; ubiquitin fold, a 96.02
3m63_B101 Ubiquitin domain-containing protein DSK2; armadill 96.01
2dzm_A100 FAS-associated factor 1; ubiquitin-like domain, HF 95.97
2l7r_A93 Ubiquitin-like protein FUBI; structural genomics, 95.96
1wf9_A107 NPL4 family protein; beta-grAsp fold like domain, 95.92
3l0w_B 169 Monoubiquitinated proliferating cell nuclear antig 95.87
1v5o_A102 1700011N24RIK protein; hypothetical protein, ubiqu 95.84
3q3f_A189 Ribonuclease/ubiquitin chimeric protein; domain SW 95.83
1j8c_A125 Ubiquitin-like protein hplic-2; ubiquitin-like dom 95.82
3rt3_B159 Ubiquitin-like protein ISG15; ubiquitin-like domai 95.79
2kdi_A114 Ubiquitin, vacuolar protein sorting-associated pro 95.76
1wgg_A96 Ubiquitin carboxyl-terminal hydrolase 14; ubiquiti 95.74
2kzr_A86 Ubiquitin thioesterase OTU1; structural genomics, 95.69
1v5t_A90 8430435I17RIK protein; hypothetical protein, ubiqu 95.68
3u5e_m128 60S ribosomal protein L40; translation, ribosome, 95.65
2gow_A125 HCG-1 protein, ubiquitin-like protein 3; BC059385, 95.62
2kdb_A99 Homocysteine-responsive endoplasmic reticulum- res 95.55
1wju_A100 NEDD8 ultimate buster-1; ubiquitin-like domain, st 95.39
1wxv_A92 BAG-family molecular chaperone regulator-1; struct 95.38
2dzj_A88 Synaptic glycoprotein SC2; ubiquitin-like fold, st 95.31
1wgh_A116 Ubiquitin-like 3, HCG-1 protein; ubiquitin-like fo 95.29
4a20_A98 Ubiquitin-like protein MDY2; protein binding, GET- 94.86
1x1m_A107 Ubiquitin-like protein SB132; structural genomics, 94.82
3plu_A93 Ubiquitin-like modifier HUB1; ubiquitin-like, HUB- 94.77
3u30_A172 Ubiquitin, linear DI-ubiquitin; immune system; 2.4 94.56
1we7_A115 SF3A1 protein; structural genomics, ubiquitin-like 94.55
2lxa_A87 Ubiquitin-like protein MDY2; ubiquitin-like domain 94.39
3ai5_A307 Yeast enhanced green fluorescent protein, ubiquit; 94.36
3u5c_f152 40S ribosomal protein S31; translation, ribosome, 94.12
1wjn_A97 Tubulin-folding protein TBCE; ubiquitin-like domai 94.04
4dbg_A105 Ranbp-type and C3HC4-type zinc finger-containing; 93.18
3shq_A 320 UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila 93.07
2daf_A118 FLJ35834 protein; hypothetical protein FLJ35834, u 93.04
1v6e_A95 Cytoskeleton-associated protein 1; tubulin-specifi 92.51
1se9_A126 Ubiquitin family; ubiquitin-like, cell-free, wheat 92.34
2kjr_A95 CG11242; UBL, ubiquitin, ubiquitin-like, structura 91.9
1t0y_A122 Tubulin folding cofactor B; ubiquitin-like, cytosk 91.64
1oqy_A 368 HHR23A, UV excision repair protein RAD23 homolog A 91.48
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 90.4
2fnj_B118 Transcription elongation factor B polypeptide 2; b 90.27
3a4r_A79 Nfatc2-interacting protein; ubiquitin fold, coiled 90.23
2d07_B93 Ubiquitin-like protein SMT3B; hydrolase; 2.10A {Ho 89.79
2xzm_9 189 RPS31E; ribosome, translation; 3.93A {Tetrahymena 89.72
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 89.34
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 88.96
2io1_B94 Small ubiquitin-related modifier 3 precursor; SUMO 88.83
1wm3_A72 Ubiquitin-like protein SMT3B; ubiquitin fold, half 88.47
2pjh_A80 Protein NPL4, nuclear protein localization protein 87.88
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 87.86
2k8h_A110 Small ubiquitin protein; SUMO, post-translational 87.78
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 87.4
2io0_B91 Small ubiquitin-related modifier 2 precursor; SUMO 87.24
2kj6_A97 Tubulin folding cofactor B; methods development, N 86.52
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 86.43
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 84.49
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 84.47
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 84.29
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 84.17
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 83.6
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 83.49
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 83.32
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 83.25
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 83.09
3au4_A 555 Myosin-X; protein-protein complex, motor protein c 82.96
2al3_A90 TUG long isoform; TUG UBL1 insulin, endocytosis/ex 82.94
2bps_A81 YUKD protein; ubiquitin-like protein, ubiquitin; 2 82.88
2eke_C106 Ubiquitin-like protein SMT3; UBC9, SUMO binding mo 81.9
4b6w_A86 Tubulin-specific chaperone; CAP-Gly, ubiquitin-lik 81.77
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 81.67
1wz0_A104 Ubiquitin-like protein SMT3B; SUMO-2, ubiquitin-li 81.58
4ajy_B118 Transcription elongation factor B polypeptide 2; E 80.17
>1v2y_A 3300001G02RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
Probab=99.86  E-value=3.1e-22  Score=143.65  Aligned_cols=66  Identities=32%  Similarity=0.431  Sum_probs=63.7

Q ss_pred             cCCeeEEEEEcCCCceeeEEEeCCCcHHHHHHHHHHHHhhhhhhcCCceeeeccccccceeeecCC
Q 033077           62 MGSAMRISILKLDGTSFDVAVMNSATVKDLKLAIKKKVNDMEQSNLGHRHISWQVFIAPSIQSCSS  127 (128)
Q Consensus        62 ~GqAm~l~V~k~Dgs~~~VvV~~~ATV~dLKkAI~~~~~~~~~r~~g~~~ISWk~VW~~fcL~f~~  127 (128)
                      .|+||+|+|.+++|++|+|.|+.++||+|||++|++++...+++++|+++|||+|+|++|||+|.|
T Consensus         4 ~~~~M~I~Vk~l~g~~~~v~V~~~~TV~dLK~~I~~~~~i~~~~q~g~~~isw~~~w~q~~Li~~G   69 (105)
T 1v2y_A            4 GSSGMTVRVCKMDGEVMPVVVVQNATVLDLKKAIQRYVQLKQEREGGVQHISWSYVWRTYHLTSAG   69 (105)
T ss_dssp             CCCSEEEEEECSSSCEEEEEECTTCBHHHHHHHHHHHHHHHHHHTTCCCCCCHHHHHTTEEEESSS
T ss_pred             CCCcEEEEEEecCCCEEEEEECCCChHHHHHHHHHHHhCCCcccccCcceeeeeecceeEEEEeCC
Confidence            589999999999999999999999999999999999999888888999999999999999999987



>3mtn_B UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquitin-specific protease activity, hydrolase, ubiquitin B structural genomics consortium, SGC; 2.70A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3n3k_B Ubiquitin; hydrolase, protease, thiol protease, DUB, zinc ribbon, inhibitor, ubiqu acetylation, cytoplasm, isopeptide bond, nucleus; 2.60A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3dbh_I NEDD8; cell cycle, activating enzyme, apoptosis, membrane, UBL conjugation pathway, ATP-binding, ligase, nucleotide- binding, polymorphism; 2.85A {Homo sapiens} SCOP: d.15.1.1 PDB: 3dbr_I 3dbl_I Back     alignment and structure
>4hcn_B Polyubiquitin, ubiquitin; ubiquitin/NEDD8 deamidase, NEDD8, protein binding; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3a9j_A Ubiquitin; protein complex, cytoplasm, isopeptide bond, metal-binding, zinc; 1.18A {Mus musculus} PDB: 3a1q_B 2znv_B 3a9k_A 3h7p_A 3jsv_A 3dvg_Y 3dvn_Y 3nob_A 2o6v_D* 3jw0_X 3jvz_X 3nhe_B* 1aar_A 1d3z_A 1f9j_A 1fxt_B 1g6j_A 1nbf_C 1cmx_B 1q5w_B ... Back     alignment and structure
>3v6c_B Ubiquitin; structural genomics, structural genomics consortium, SGC, UB protease, hydrolase-signaling protein complex; 1.70A {Homo sapiens} PDB: 3v6e_B Back     alignment and structure
>1sif_A Ubiquitin; hydrophobic mutants, folding, stability, structural protein; 2.18A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2dzi_A Ubiquitin-like protein 4A; GDX, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ndd_A NEDD8, protein (ubiquitin-like protein NEDD8); proteolysis, signaling protei; 1.60A {Homo sapiens} SCOP: d.15.1.1 PDB: 1r4m_I 1r4n_I* 1xt9_B 2ko3_A 3gzn_I* 2bkr_B 2nvu_I* 3dqv_A 1bt0_A Back     alignment and structure
>4eew_A Large proline-rich protein BAG6; ubiquitin-like fold, GP78-binding, chaperone; 1.30A {Homo sapiens} Back     alignment and structure
>3phx_B Ubiquitin-like protein ISG15; OTU domain, DE-ubiquitinase, DE-isgylase, hydrolase-protein complex; 1.60A {Homo sapiens} Back     alignment and structure
>3k9o_B Ubiquitin, UBB+1; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 2k25_A 2kx0_A Back     alignment and structure
>2kk8_A Uncharacterized protein AT4G05270; solution arabidopsis thaliana, uncharacterized putative protein, NESG, structural genomics; NMR {Arabidopsis thaliana} Back     alignment and structure
>3vdz_A Ubiquitin-40S ribosomal protein S27A; gadolinium, MRI contrast agent, peptide-based contrast agent lanthanide binding TAG; 2.40A {Synthetic construct} PDB: 2ojr_A Back     alignment and structure
>4fbj_B NEDD8; effector-HOST target complex, glutamine deamidase, deamidati bacterial effector, cell cycle-protein binding complex; 1.60A {Homo sapiens} PDB: 4f8c_B Back     alignment and structure
>4dwf_A HLA-B-associated transcript 3; ubiquitin-like domain, BAT3 protein, PF00240, structural GEN joint center for structural genomics, JCSG; 1.80A {Homo sapiens} PDB: 1wx9_A Back     alignment and structure
>1wh3_A 59 kDa 2'-5'-oligoadenylate synthetase like protein; P59 OASL, ubiquitin family, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2bwf_A Ubiquitin-like protein DSK2; signaling protein, UBA, signaling proteins; 1.15A {Saccharomyces cerevisiae} SCOP: d.15.1.1 PDB: 2bwe_S Back     alignment and structure
>1yx5_B Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo sapiens} SCOP: d.15.1.1 PDB: 1yx6_B Back     alignment and structure
>2wyq_A HHR23A, UV excision repair protein RAD23 homolog A; DNA binding protein, DNA excision repair, proteasomal degrad polyubiquitin; 1.65A {Homo sapiens} PDB: 1p98_A 1p9d_U 1p1a_A Back     alignment and structure
>2hj8_A Interferon-induced 17 kDa protein; HR2873B, human ISG15, structure, northeast structural genomics consortium, protein structure initiative, NESG; NMR {Homo sapiens} Back     alignment and structure
>1wia_A Hypothetical ubiquitin-like protein (riken cDNA 2010008E23); 'structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2ojr_A Ubiquitin; lanthide-binding TAG, terbium, TB, SAD phasing, protein binding; 2.60A {Homo sapiens} Back     alignment and structure
>1uel_A HHR23B, UV excision repair protein RAD23 homolog B; UBL, UIM, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2uyz_B Small ubiquitin-related modifier 1; sumoylation, cell division, nuclear protein, ubiquitin-like modifier, UBL conjugation pathway; 1.4A {Homo sapiens} SCOP: d.15.1.1 PDB: 2vrr_B 2iy0_B 2iy1_B 2g4d_B 2las_A 2io2_B 1z5s_B 3uip_B* 1tgz_B* 2bf8_B Back     alignment and structure
>1wy8_A NP95-like ring finger protein, isoform A; ubiquitin-like domain, NP95/ICBP90-like ring finger (NIRF), ubiquitin ligase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2faz_A Ubiquitin-like containing PHD and ring finger DOM protein 1; cell cycle, DNA damage, DNA repair, DNA-binding, ligase, Met binding, nuclear protein; 2.00A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B Back     alignment and structure
>1ttn_A DC-UBP, dendritic cell-derived ubiquitin-like protein; ubiquitin-like domain, solution structure, signaling protein; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1wx8_A Riken cDNA 4931431F19; ubiquitin-like domain, ubiquilin 1-like, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1v86_A DNA segment, CHR 7, wayne state university 128, expressed; ubiquitin fold, structural genomics, D7WSU128E protein; HET: DNA; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1uh6_A Ubiquitin-like 5; beta-grAsp fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>3b1l_X E3 ubiquitin-protein ligase parkin; proteasome, ALFA-beta-protein; 1.85A {Mus musculus} PDB: 1mg8_A 2zeq_A 2knb_A 1iyf_A Back     alignment and structure
>1wyw_B Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 1y8r_C* 2asq_A 2pe6_B 1a5r_A 2kqs_A 3kyc_D* 3rzw_C Back     alignment and structure
>1wgd_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; ENDPLASMIC reticulum stress, UBL domain; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2kd0_A LRR repeats and ubiquitin-like domain-containing protein AT2G30105; ubiquitin-like protein, NESG, leucine-rich repeat, structural genomics; NMR {Arabidopsis thaliana} Back     alignment and structure
>3m62_B UV excision repair protein RAD23; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2klc_A Ubiquilin-1; ubiquitin-like, structural genomics, PSI-2, protein structur initiative, northeast structural genomics consortium, NESG; NMR {Homo sapiens} Back     alignment and structure
>3u30_A Ubiquitin, linear DI-ubiquitin; immune system; 2.43A {Homo sapiens} Back     alignment and structure
>3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B Back     alignment and structure
>1yqb_A Ubiquilin 3; structural genomics consortium, ubiquitin, ubiquitin-like domain, structural genomics, signaling protein SGC; 2.00A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A Back     alignment and structure
>1we6_A Splicing factor, putative; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Back     alignment and structure
>1wx7_A Ubiquilin 3; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2kan_A Uncharacterized protein AR3433A; ubiquitin fold, alpha+beta, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} Back     alignment and structure
>3m63_B Ubiquitin domain-containing protein DSK2; armadillo-like repeats, UBL conjugation pathway, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2dzm_A FAS-associated factor 1; ubiquitin-like domain, HFAF1, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2l7r_A Ubiquitin-like protein FUBI; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; NMR {Homo sapiens} Back     alignment and structure
>1wf9_A NPL4 family protein; beta-grAsp fold like domain, hypothetical protein, structural genomics, NPPSFA; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Back     alignment and structure
>3l0w_B Monoubiquitinated proliferating cell nuclear antigen, proliferating cell nuclear antigen; replication, DNA damage, DNA repair; 2.80A {Saccharomyces cerevisiae} PDB: 3l10_B Back     alignment and structure
>1v5o_A 1700011N24RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>3q3f_A Ribonuclease/ubiquitin chimeric protein; domain SWAP, oligomerization, ubiquitin insertion, hydrolase binding; 2.17A {Bacillus amyloliquefaciens} Back     alignment and structure
>1j8c_A Ubiquitin-like protein hplic-2; ubiquitin-like domain, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A Back     alignment and structure
>2kdi_A Ubiquitin, vacuolar protein sorting-associated protein 27 fusion protein; ubiquitin interacting motif, UIM, protein domain interface; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1wgg_A Ubiquitin carboxyl-terminal hydrolase 14; ubiquitin specific protease 14, USP14, ubiquitin-like fold, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2kzr_A Ubiquitin thioesterase OTU1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative, hydrolase; NMR {Mus musculus} Back     alignment and structure
>1v5t_A 8430435I17RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 2kx3_A Back     alignment and structure
>3u5e_m 60S ribosomal protein L40; translation, ribosome, ribosomal R ribosomal protein, STM1, eukaryotic ribosome; 3.00A {Saccharomyces cerevisiae} PDB: 3u5i_m 4b6a_m 4a18_K 4a19_K 4a1b_K 4a1d_K 4adx_5 3izc_p 3izs_p 3iz5_p 3izr_p Back     alignment and structure
>2gow_A HCG-1 protein, ubiquitin-like protein 3; BC059385, structural genomics, protein structure initiative, PSI; NMR {Homo sapiens} Back     alignment and structure
>2kdb_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; UBL domain, membrane, polymorphism, transmembrane; NMR {Homo sapiens} Back     alignment and structure
>1wju_A NEDD8 ultimate buster-1; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1wxv_A BAG-family molecular chaperone regulator-1; structural genomics, apoptosis, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2dzj_A Synaptic glycoprotein SC2; ubiquitin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wgh_A Ubiquitin-like 3, HCG-1 protein; ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>4a20_A Ubiquitin-like protein MDY2; protein binding, GET-pathway, tail-anchored proteins; 1.78A {Saccharomyces cerevisiae} PDB: 2lxc_A 4goc_A Back     alignment and structure
>1x1m_A Ubiquitin-like protein SB132; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>3plu_A Ubiquitin-like modifier HUB1; ubiquitin-like, HUB-1, SNU66, peptide binding protein; 1.40A {Saccharomyces cerevisiae} PDB: 3plv_A 1m94_A 1p0r_A Back     alignment and structure
>3u30_A Ubiquitin, linear DI-ubiquitin; immune system; 2.43A {Homo sapiens} Back     alignment and structure
>1we7_A SF3A1 protein; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 1zkh_A Back     alignment and structure
>2lxa_A Ubiquitin-like protein MDY2; ubiquitin-like domain, protein-protein interaction, SGT2 BIN domain, GET pathway, protein binding; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3ai5_A Yeast enhanced green fluorescent protein, ubiquit; ubiquitin, fusion protein, fluore protein, transcription; HET: CR2; 1.40A {Aequorea victoria} PDB: 3ako_B* Back     alignment and structure
>3u5c_f 40S ribosomal protein S31; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3u5g_f Back     alignment and structure
>1wjn_A Tubulin-folding protein TBCE; ubiquitin-like domain, progressive motor neuropathy, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>4dbg_A Ranbp-type and C3HC4-type zinc finger-containing; ubiquitin fold, ubiquitination, ligase; 2.71A {Homo sapiens} PDB: 2lgy_A Back     alignment and structure
>3shq_A UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila melanogaster} Back     alignment and structure
>2daf_A FLJ35834 protein; hypothetical protein FLJ35834, ubiquitin-like domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1v6e_A Cytoskeleton-associated protein 1; tubulin-specific chaperone B, tubulin folding cofactor B, microtubule, ubiquitin-like fold, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1se9_A Ubiquitin family; ubiquitin-like, cell-free, wheat GERM, structural genomics, protein structure initiative, CESG; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Back     alignment and structure
>2kjr_A CG11242; UBL, ubiquitin, ubiquitin-like, structural genomics, PSI-2, protein structure initiative; NMR {Drosophila melanogaster} Back     alignment and structure
>1t0y_A Tubulin folding cofactor B; ubiquitin-like, cytoskeleton, microtubule, CESG, structural genomics, protein structure initiative, PSI; NMR {Caenorhabditis elegans} SCOP: d.15.1.1 Back     alignment and structure
>1oqy_A HHR23A, UV excision repair protein RAD23 homolog A; DNA repair, proteasome-mediated degradation, protein- protein interaction, replication; NMR {Homo sapiens} SCOP: a.5.2.1 a.5.2.1 a.189.1.1 d.15.1.1 PDB: 1qze_A 1tp4_A Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2fnj_B Transcription elongation factor B polypeptide 2; beta-sandwich, lectin-like, SPRY, protein transport/signaling protein complex; 1.80A {Mus musculus} SCOP: d.15.1.1 PDB: 1lm8_B 1lqb_A 1vcb_A 2c9w_B 2izv_B 2jz3_B 2xai_C 3dcg_A 3zrc_A* 3zrf_A Back     alignment and structure
>3a4r_A Nfatc2-interacting protein; ubiquitin fold, coiled coil, cytoplasm, methylation, nucleus, transcription; 1.00A {Mus musculus} PDB: 3a4s_C 3rd2_A Back     alignment and structure
>2d07_B Ubiquitin-like protein SMT3B; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 2rpq_A 2awt_A 2io3_B 2iyd_B 1u4a_A 2k1f_A Back     alignment and structure
>2xzm_9 RPS31E; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_9 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>2io1_B Small ubiquitin-related modifier 3 precursor; SUMO, SENP, ULP, complex, protein binding, hydrolase; 2.60A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1wm3_A Ubiquitin-like protein SMT3B; ubiquitin fold, half-open barrel, two helices, protein transport; 1.20A {Homo sapiens} SCOP: d.15.1.1 PDB: 1wm2_A 3uin_B 3uio_B 2ckh_B Back     alignment and structure
>2pjh_A Protein NPL4, nuclear protein localization protein 4 homolog; UFD1, NPL4, AAA, protein binding, transport protein; NMR {Mus musculus} Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>2k8h_A Small ubiquitin protein; SUMO, post-translational modifier, signaling protein; NMR {Trypanosoma brucei} Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2io0_B Small ubiquitin-related modifier 2 precursor; SUMO, SENP, ULP, complex, protein binding, hydrolase; 2.30A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2kj6_A Tubulin folding cofactor B; methods development, NESG, solution PSI-2, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>3au4_A Myosin-X; protein-protein complex, motor protein cargo transportation, protein-apoptosis complex; 1.90A {Homo sapiens} PDB: 3au5_A 3pzd_A Back     alignment and structure
>2al3_A TUG long isoform; TUG UBL1 insulin, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: d.15.1.2 Back     alignment and structure
>2bps_A YUKD protein; ubiquitin-like protein, ubiquitin; 2.7A {Bacillus subtilis} Back     alignment and structure
>2eke_C Ubiquitin-like protein SMT3; UBC9, SUMO binding motif, SBM, ligase/protein binding complex; 1.90A {Saccharomyces cerevisiae} SCOP: d.15.1.1 Back     alignment and structure
>4b6w_A Tubulin-specific chaperone; CAP-Gly, ubiquitin-like; HET: MSE; 2.35A {Trypanosoma brucei brucei strain 927} Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wz0_A Ubiquitin-like protein SMT3B; SUMO-2, ubiquitin-like molecule, structural genomics, sentrin2, NPPFSA; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>4ajy_B Transcription elongation factor B polypeptide 2; E3 ubiquitin ligase, transcription factor, hypoxic signaling transcription; 1.73A {Homo sapiens} PDB: 1lqb_A 1vcb_A 2c9w_B 2izv_B 2jz3_B 2xai_C 3dcg_A 3zrc_A* 3zrf_A 3ztc_A* 3ztd_A* 3zun_A* 1lm8_B 4b95_A* 2fnj_B 4b9k_A* 4awj_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 128
d1v2ya_105 d.15.1.1 (A:) Ubiquitin-like protein 3300001g02rik 4e-08
>d1v2ya_ d.15.1.1 (A:) Ubiquitin-like protein 3300001g02rik {Mouse (Mus musculus) [TaxId: 10090]} Length = 105 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-Grasp (ubiquitin-like)
superfamily: Ubiquitin-like
family: Ubiquitin-related
domain: Ubiquitin-like protein 3300001g02rik
species: Mouse (Mus musculus) [TaxId: 10090]
 Score = 45.8 bits (108), Expect = 4e-08
 Identities = 21/54 (38%), Positives = 31/54 (57%)

Query: 63  GSAMRISILKLDGTSFDVAVMNSATVKDLKLAIKKKVNDMEQSNLGHRHISWQV 116
            S M + + K+DG    V V+ +ATV DLK AI++ V   ++   G +HISW  
Sbjct: 5   SSGMTVRVCKMDGEVMPVVVVQNATVLDLKKAIQRYVQLKQEREGGVQHISWSY 58


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query128
d1v2ya_105 Ubiquitin-like protein 3300001g02rik {Mouse (Mus m 99.68
d1bt0a_73 Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxI 97.46
d1ttna180 Dendritic cell-derived ubiquitin-like protein {Hum 97.24
d1wx9a173 Large proline-rich protein BAT3 {Human (Homo sapie 97.24
d1z2ma276 Interferon-induced 15 kDa protein {Human (Homo sap 97.22
d1m94a_73 Ubiquitin-like modifier protein hub1 {Baker's yeas 97.21
d1v5oa_102 1700011n24rik protein {Mouse (Mus musculus) [TaxId 97.18
d1oqya477 Ubiquitin-like domain of Rad23 homolog A (Hhr23a) 97.15
d1ogwa_76 Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} 97.14
d1uela_95 Ubiquitin-like domain of Rad23 homolog B (Hhr23B) 97.13
d1wh3a_87 2'-5'-oligoadenylate synthetase-like protein, OASL 97.12
d2faza176 Ubiquitin-like PHD and RING finger domain-containi 97.09
d2zeqa178 Ubiquitin-like domain of parkin {Mouse (Mus muscul 97.07
d1wy8a176 Ubiquitin-like PHD and RING finger domain-containi 96.81
d1v86a_95 hypothetical D7wsu128e protein {Mouse (Mus musculu 96.64
d1z2ma176 Interferon-induced 15 kDa protein {Human (Homo sap 96.63
d1wxva181 Bag-family molecular chaperone regulator-1 {Human 96.3
d1zkha186 Splicing factor 3 subunit 1, C-terminal domain {Hu 96.26
d2bwfa173 DSK2 {Baker's yeast (Saccharomyces cerevisiae) [Ta 96.21
d1wgda_93 Homocysteine-responsive endoplasmic reticulum-resi 96.0
d1wiaa_95 Ubiquitin-like protein bab25500 (2010008E23Rik) {M 96.0
d1yqba184 Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} 95.91
d1se9a_101 Hypothetical protein At3g01050 {Thale cress (Arabi 95.55
d1uh6a_100 Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculu 95.54
d1wgga_96 Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (M 95.5
d1j8ca_103 Ubiquitin-like N-terminal domain of PLIC-2 {Human 95.42
d1wjna_97 Tubulin-folding protein TbcE {Mouse (Mus musculus) 94.92
d1v5ta_90 8430435i17rik protein {Mouse (Mus musculus) [TaxId 94.81
d1euvb_79 SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomy 94.78
d1wx8a183 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090] 94.76
d1wjua_100 NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens 94.48
d1wgha_116 Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculu 94.25
d2uyzb177 SUMO-1 (smt3 homologue) {Human (Homo sapiens) [Tax 94.11
d1we6a_111 Splicing factor 3 subunit 1, C-terminal domain {Th 92.35
d2c9wb1103 Elongin B {Human (Homo sapiens) [TaxId: 9606]} 89.79
d1ef1a384 Moesin {Human (Homo sapiens) [TaxId: 9606]} 88.8
d1v6ea_95 Ubiquitin-like domain of tubulin folding cofactor 88.78
d1wf9a194 NPL4-like protein 1 {Thale cress (Arabidopsis thal 87.53
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 86.06
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 85.97
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 85.35
d1gg3a381 Erythroid membrane protein 4.1R {Human (Homo sapie 84.81
d1t0ya_90 Ubiquitin-like domain of tubulin folding cofactor 84.76
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 84.22
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 82.95
d1h4ra384 Merlin {Human (Homo sapiens) [TaxId: 9606]} 82.71
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 82.5
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 82.19
d1wgya_104 Rap guanine nucleotide exchange factor 5, RapGEF5 81.85
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 81.69
d1vjka_88 Molybdopterin synthase subunit MoaD {Pyrococcus fu 81.39
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 81.26
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 80.88
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 80.65
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 80.28
>d1v2ya_ d.15.1.1 (A:) Ubiquitin-like protein 3300001g02rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-Grasp (ubiquitin-like)
superfamily: Ubiquitin-like
family: Ubiquitin-related
domain: Ubiquitin-like protein 3300001g02rik
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.68  E-value=2.8e-17  Score=114.92  Aligned_cols=65  Identities=32%  Similarity=0.455  Sum_probs=62.5

Q ss_pred             CCeeEEEEEcCCCceeeEEEeCCCcHHHHHHHHHHHHhhhhhhcCCceeeeccccccceeeecCC
Q 033077           63 GSAMRISILKLDGTSFDVAVMNSATVKDLKLAIKKKVNDMEQSNLGHRHISWQVFIAPSIQSCSS  127 (128)
Q Consensus        63 GqAm~l~V~k~Dgs~~~VvV~~~ATV~dLKkAI~~~~~~~~~r~~g~~~ISWk~VW~~fcL~f~~  127 (128)
                      ...|+|+|...||..|+|.|..++||+|||++|++.+...+.++.++++|||+|+|++|||.|.|
T Consensus         5 ss~M~v~Vk~~~G~~~~v~V~~~~TV~~LK~~I~~~~~ip~~~Qr~~~~~~~~~~~~~~~Li~~G   69 (105)
T d1v2ya_           5 SSGMTVRVCKMDGEVMPVVVVQNATVLDLKKAIQRYVQLKQEREGGVQHISWSYVWRTYHLTSAG   69 (105)
T ss_dssp             CCSEEEEEECSSSCEEEEEECTTCBHHHHHHHHHHHHHHHHHHTTCCCCCCHHHHHTTEEEESSS
T ss_pred             CCcEEEEEEeCCCCEEEEEECCCChHHHHHHHHHHHHCcCHHHhcccccccccccccceEEEECC
Confidence            46799999999999999999999999999999999999999999999999999999999999987



>d1bt0a_ d.15.1.1 (A:) Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ttna1 d.15.1.1 (A:21-100) Dendritic cell-derived ubiquitin-like protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wx9a1 d.15.1.1 (A:8-80) Large proline-rich protein BAT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z2ma2 d.15.1.1 (A:79-154) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m94a_ d.15.1.1 (A:) Ubiquitin-like modifier protein hub1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v5oa_ d.15.1.1 (A:) 1700011n24rik protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1oqya4 d.15.1.1 (A:1-77) Ubiquitin-like domain of Rad23 homolog A (Hhr23a) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogwa_ d.15.1.1 (A:) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uela_ d.15.1.1 (A:) Ubiquitin-like domain of Rad23 homolog B (Hhr23B) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh3a_ d.15.1.1 (A:) 2'-5'-oligoadenylate synthetase-like protein, OASL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2faza1 d.15.1.1 (A:1-76) Ubiquitin-like PHD and RING finger domain-containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2zeqa1 d.15.1.1 (A:1-78) Ubiquitin-like domain of parkin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wy8a1 d.15.1.1 (A:8-83) Ubiquitin-like PHD and RING finger domain-containing protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v86a_ d.15.1.1 (A:) hypothetical D7wsu128e protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z2ma1 d.15.1.1 (A:3-78) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wxva1 d.15.1.1 (A:7-87) Bag-family molecular chaperone regulator-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zkha1 d.15.1.1 (A:1-86) Splicing factor 3 subunit 1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bwfa1 d.15.1.1 (A:2-74) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wgda_ d.15.1.1 (A:) Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein, HERPUD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wiaa_ d.15.1.1 (A:) Ubiquitin-like protein bab25500 (2010008E23Rik) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yqba1 d.15.1.1 (A:15-98) Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1se9a_ d.15.1.1 (A:) Hypothetical protein At3g01050 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1uh6a_ d.15.1.1 (A:) Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wgga_ d.15.1.1 (A:) Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1j8ca_ d.15.1.1 (A:) Ubiquitin-like N-terminal domain of PLIC-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjna_ d.15.1.1 (A:) Tubulin-folding protein TbcE {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v5ta_ d.15.1.1 (A:) 8430435i17rik protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1euvb_ d.15.1.1 (B:) SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId: 4932]} Back     information, alignment and structure
>d1wx8a1 d.15.1.1 (A:8-90) 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wjua_ d.15.1.1 (A:) NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgha_ d.15.1.1 (A:) Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2uyzb1 d.15.1.1 (B:20-96) SUMO-1 (smt3 homologue) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1we6a_ d.15.1.1 (A:) Splicing factor 3 subunit 1, C-terminal domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2c9wb1 d.15.1.1 (B:2-104) Elongin B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ef1a3 d.15.1.4 (A:4-87) Moesin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v6ea_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wf9a1 d.15.1.1 (A:8-101) NPL4-like protein 1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gg3a3 d.15.1.4 (A:1-81) Erythroid membrane protein 4.1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t0ya_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h4ra3 d.15.1.4 (A:20-103) Merlin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1wgya_ d.15.1.5 (A:) Rap guanine nucleotide exchange factor 5, RapGEF5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vjka_ d.15.3.1 (A:) Molybdopterin synthase subunit MoaD {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure