Citrus Sinensis ID: 033120

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120------
MAAVSDDDDGVKNKELPGIEFKKSRRTKSLTGTSLASIESLSMPLVQEVVLSADIRCSECQKRVADMMSKLNETESVLVNVSEKKVTLTSRYPVVVEVSKRQITAVRRNPLQKIAIIKRIFGSSSR
cccccccccccccccccccEEccccccccccccccccccccccccEEEEEEEcccccHHHHHHHHHHHHHHcccEEEEEEEEccEEEEEEEEccEEEEEEEEEEEEcccccHHHHHHHHHHccccc
cccEEccccccccccccccccccccccccccccccccHHccccccEEEEEEEcccccHHHHHHHHHHHHHHccccEEEEEEEccEEEEEEEcccEEEEcccEEEEEEcccHHHHEEEEEEEccccc
maavsddddgvknkelpgiefkksrrtksltgtslasieslsmplVQEVVLSADIRCSECQKRVADMMSKLNETESVLVNVSEKKVTLTSRYPVVVEVSKRQITAVRRNPLQKIAIIKRIFGSSSR
maavsddddgvknkelpgiefkksrrtksltgtslasieslsmPLVQEVVLSADIRCSECQKRVADMMSKLNETesvlvnvsekkvtltsrypvvvevskrqitavrrnplqkiaiikrifgsssr
MAAVSDDDDGVKNKELPGIEFKKSRRTKSLTGTSLASIESLSMPLVQEVVLSADIRCSECQKRVADMMSKLNETESVLVNVSEKKVTLTSRYPVVVEVSKRQITAVRRNPLQKIAIIKRIFGSSSR
****************************************LSMPLVQEVVLSADIRCSECQKRVADMMSKLNETESVLVNVSEKKVTLTSRYPVVVEVSKRQITAVRRNPLQKIAIIKRIF*****
*************************************IESLSMPLVQEVVLSADIRCSECQKRVADMMSKLNETESVLVNVSEKKVTLTSRYP*****************LQKIAIIKRIFGS***
**********VKNKELPGIEFKKSRRTKSLTGTSLASIESLSMPLVQEVVLSADIRCSECQKRVADMMSKLNETESVLVNVSEKKVTLTSRYPVVVEVSKRQITAVRRNPLQKIAIIKRIFGSSSR
***************************************SLSMPLVQEVVLSADIRCSECQKRVADMMSKLNETESVLVNVSEKKVTLTSRYPVVVEVSKRQITAVRRNPLQKIAIIKRIFG****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAAVSDDDDGVKNKELPGIEFKKSRRTKSLTGTSLASIESLSMPLVQEVVLSADIRCSECQKRVADMMSKLNETESVLVNVSEKKVTLTSRYPVVVEVSKRQITAVRRNPLQKIAIIKRIFGSSSR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query126
255576465119 conserved hypothetical protein [Ricinus 0.865 0.915 0.693 5e-33
224108502119 predicted protein [Populus trichocarpa] 0.857 0.907 0.681 9e-31
22410170998 predicted protein [Populus trichocarpa] 0.753 0.969 0.687 2e-29
356495947126 PREDICTED: uncharacterized protein LOC10 0.928 0.928 0.568 3e-25
225423943113 PREDICTED: uncharacterized protein LOC10 0.849 0.946 0.555 1e-24
356534371115 PREDICTED: uncharacterized protein LOC10 0.873 0.956 0.564 3e-24
357488499121 hypothetical protein MTR_5g055200 [Medic 0.809 0.842 0.621 3e-24
356577656127 PREDICTED: uncharacterized protein LOC10 0.936 0.929 0.56 3e-23
18409069116 uncharacterized protein [Arabidopsis tha 0.793 0.862 0.527 2e-17
388499778124 unknown [Medicago truncatula] 0.753 0.766 0.616 2e-16
>gi|255576465|ref|XP_002529124.1| conserved hypothetical protein [Ricinus communis] gi|223531403|gb|EEF33237.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
 Score =  145 bits (366), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 77/111 (69%), Positives = 91/111 (81%), Gaps = 2/111 (1%)

Query: 14  KELPGIEFKKSRRTKSLTGTSLASIESLSMPLVQEVVLSADIRCSECQKRVADMMSKLNE 73
           KE     FKK + +  LTGTSLAS+ESLS+PLVQEVVLSADIRCSECQKRVA+ MSK+N+
Sbjct: 9   KETSKTGFKKPK-SMLLTGTSLASVESLSLPLVQEVVLSADIRCSECQKRVAEFMSKMND 67

Query: 74  TESVLVNVSEKKVTLTSRYPVVVEVSKRQITAVRRNPLQKIAIIKRIFGSS 124
           TESVLVNV EKKVTLT RYP  ++VS  Q+ AV RNPL+K+ +IKRIF S+
Sbjct: 68  TESVLVNVLEKKVTLTCRYP-ALKVSTSQVAAVYRNPLRKMTLIKRIFRSA 117

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224108502|ref|XP_002314871.1| predicted protein [Populus trichocarpa] gi|222863911|gb|EEF01042.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224101709|ref|XP_002312390.1| predicted protein [Populus trichocarpa] gi|222852210|gb|EEE89757.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356495947|ref|XP_003516832.1| PREDICTED: uncharacterized protein LOC100811739 [Glycine max] Back     alignment and taxonomy information
>gi|225423943|ref|XP_002282260.1| PREDICTED: uncharacterized protein LOC100266408 [Vitis vinifera] gi|147856928|emb|CAN78631.1| hypothetical protein VITISV_000032 [Vitis vinifera] gi|297737835|emb|CBI27036.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356534371|ref|XP_003535729.1| PREDICTED: uncharacterized protein LOC100783993 [Glycine max] Back     alignment and taxonomy information
>gi|357488499|ref|XP_003614537.1| hypothetical protein MTR_5g055200 [Medicago truncatula] gi|355515872|gb|AES97495.1| hypothetical protein MTR_5g055200 [Medicago truncatula] Back     alignment and taxonomy information
>gi|356577656|ref|XP_003556940.1| PREDICTED: uncharacterized protein LOC100817891 [Glycine max] Back     alignment and taxonomy information
>gi|18409069|ref|NP_564933.1| uncharacterized protein [Arabidopsis thaliana] gi|21536535|gb|AAM60867.1| unknown [Arabidopsis thaliana] gi|110739339|dbj|BAF01582.1| hypothetical protein [Arabidopsis thaliana] gi|114050551|gb|ABI49425.1| At1g68585 [Arabidopsis thaliana] gi|332196694|gb|AEE34815.1| uncharacterized protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|388499778|gb|AFK37955.1| unknown [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query126
TAIR|locus:505006208116 AT1G68585 "AT1G68585" [Arabido 0.817 0.887 0.541 7.2e-20
TAIR|locus:2058689115 AT2G35730 [Arabidopsis thalian 0.619 0.678 0.320 1.1e-05
TAIR|locus:505006208 AT1G68585 "AT1G68585" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 236 (88.1 bits), Expect = 7.2e-20, P = 7.2e-20
 Identities = 59/109 (54%), Positives = 77/109 (70%)

Query:    20 EFKKSRRTK-SLTG-TSLASIESLSMPLVQEVVLSADIRCSECQKRVADMMSKLNETESV 77
             E + S R+K S T  TSLAS+ SLSMPL+QE+VLSADIRCS+CQ++VAD+M+++ ET S+
Sbjct:    11 ELEPSLRSKLSRTSETSLASVASLSMPLIQEIVLSADIRCSDCQEKVADIMARMIETYSI 70

Query:    78 LVNVSEKKVTLTSRYPVVVEVSKRQITAVRRNPLQKIAIIKRIFGSSSR 126
             LV+V EKKVTLT  Y     VSK    A+    L KI+ IKR+   S +
Sbjct:    71 LVSVLEKKVTLTCTYSGDRRVSKSYGEAL----LCKISTIKRLICPSRK 115
GO:0003674 "molecular_function" evidence=ND
GO:0005575 "cellular_component" evidence=ND
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2058689 AT2G35730 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 126
KOG160373 consensus Copper chaperone [Inorganic ion transpor 99.46
PF0040362 HMA: Heavy-metal-associated domain; InterPro: IPR0 99.4
COG260871 CopZ Copper chaperone [Inorganic ion transport and 99.22
KOG4656 247 consensus Copper chaperone for superoxide dismutas 98.66
PLN02957 238 copper, zinc superoxide dismutase 97.96
PRK10671 834 copA copper exporting ATPase; Provisional 97.82
TIGR0000368 copper ion binding protein. This model describes a 97.23
COG2217 713 ZntA Cation transport ATPase [Inorganic ion transp 97.11
PRK11033 741 zntA zinc/cadmium/mercury/lead-transporting ATPase 95.84
KOG0207 951 consensus Cation transport ATPase [Inorganic ion t 95.52
PRK10671 834 copA copper exporting ATPase; Provisional 95.04
KOG0207 951 consensus Cation transport ATPase [Inorganic ion t 94.95
TIGR0205292 MerP mercuric transport protein periplasmic compon 94.7
cd0037163 HMA Heavy-metal-associated domain (HMA) is a conse 88.89
PF0188372 DUF59: Domain of unknown function DUF59; InterPro: 87.62
>KOG1603 consensus Copper chaperone [Inorganic ion transport and metabolism] Back     alignment and domain information 
Probab=99.46  E-value=2.2e-13  Score=91.30  Aligned_cols=52  Identities=31%  Similarity=0.616  Sum_probs=49.2

Q ss_pred             ceeeEEEEEecccChhHHHHHHHHHhcCCCceEEEEeccCCEEEEEeecCcc
Q 033120           44 PLVQEVVLSADIRCSECQKRVADMMSKLNETESVLVNVSEKKVTLTSRYPVV   95 (126)
Q Consensus        44 p~~Q~VvLkvgMsC~hC~krVkkaLskL~GVesV~VDLe~KkVtVtg~~~~d   95 (126)
                      |..++++++++|+|+||..+|++.|..++||+++.+|..+++|||.|+++++
T Consensus         2 ~~~~~~v~kv~~~C~gc~~kV~~~l~~~~GV~~v~id~~~~kvtV~g~~~p~   53 (73)
T KOG1603|consen    2 PPIKTVVLKVNMHCEGCARKVKRVLQKLKGVESVDIDIKKQKVTVKGNVDPV   53 (73)
T ss_pred             CCccEEEEEECcccccHHHHHHHHhhccCCeEEEEecCCCCEEEEEEecCHH
Confidence            5678999999999999999999999999999999999999999999997774

>PF00403 HMA: Heavy-metal-associated domain; InterPro: IPR006121 Proteins that transport heavy metals in micro-organisms and mammals share similarities in their sequences and structures Back     alignment and domain information
>COG2608 CopZ Copper chaperone [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG4656 consensus Copper chaperone for superoxide dismutase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PLN02957 copper, zinc superoxide dismutase Back     alignment and domain information
>PRK10671 copA copper exporting ATPase; Provisional Back     alignment and domain information
>TIGR00003 copper ion binding protein Back     alignment and domain information
>COG2217 ZntA Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11033 zntA zinc/cadmium/mercury/lead-transporting ATPase; Provisional Back     alignment and domain information
>KOG0207 consensus Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10671 copA copper exporting ATPase; Provisional Back     alignment and domain information
>KOG0207 consensus Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR02052 MerP mercuric transport protein periplasmic component Back     alignment and domain information
>cd00371 HMA Heavy-metal-associated domain (HMA) is a conserved domain of approximately 30 amino acid residues found in a number of proteins that transport or detoxify heavy metals, for example, the CPx-type heavy metal ATPases and copper chaperones Back     alignment and domain information
>PF01883 DUF59: Domain of unknown function DUF59; InterPro: IPR002744 This family includes prokaryotic proteins of unknown function Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query126
3iwl_A68 Copper transport protein ATOX1; beta-alpha-beta-BE 99.4
1cc8_A73 Protein (metallochaperone ATX1); copper transport, 99.35
4a4j_A69 Pacszia, cation-transporting ATPase PACS; hydrolas 99.26
3dxs_X74 Copper-transporting ATPase RAN1; CXXC motif, ferre 99.22
2crl_A98 Copper chaperone for superoxide dismutase; SOD1, f 99.19
2xmw_A71 PACS-N, cation-transporting ATPase PACS; hydrolase 99.12
3fry_A73 Probable copper-exporting P-type ATPase A; transpo 99.1
2xmm_A64 SSR2857 protein, ATX1; metal transport, copper hom 99.05
1yg0_A66 COP associated protein; open-faced beta-sandwich, 99.04
2kt2_A69 Mercuric reductase; nmera, MERA, HMA domain, mercu 99.0
3cjk_B75 Copper-transporting ATPase 1; HAH1, ATP7B, menkes 98.99
1osd_A72 MERP, hypothetical protein MERP; mercury resistanc 98.99
1aw0_A72 Menkes copper-transporting ATPase; copper-binding 98.97
2l3m_A71 Copper-ION-binding protein; structural genomics, c 98.96
2kyz_A67 Heavy metal binding protein; structural genomics, 98.95
1mwy_A73 ZNTA; open-faced beta-sandwich fold, beta-alpha-be 98.95
2aj0_A71 Probable cadmium-transporting ATPase; ferrodoxin-l 98.91
2roe_A66 Heavy metal binding protein; NMR {Thermus thermoph 98.91
1kvi_A79 Copper-transporting ATPase 1; menkes, Cu-protein, 98.91
1q8l_A84 Copper-transporting ATPase 1; metal binding protei 98.91
2ldi_A71 Zinc-transporting ATPase; metal homeostasis, metal 98.9
1cpz_A68 Protein (COPZ); copper chaperone, metal transport, 98.87
2qif_A69 Copper chaperone COPZ; tetranuclear Cu(I) cluster; 98.87
1fvq_A72 Copper-transporting ATPase; APO-CCC2A, hydrolase; 98.86
1y3j_A77 Copper-transporting ATPase 1; ferrodoxin-like fold 98.86
2k2p_A85 Uncharacterized protein ATU1203; putative metal-bi 98.85
2ew9_A149 Copper-transporting ATPase 2; copper trafficking, 98.85
2g9o_A90 Copper-transporting ATPase 1; menkes disease, solu 98.84
1opz_A76 Potential copper-transporting ATPase; mutation, fo 98.84
1yjr_A75 Copper-transporting ATPase 1; metallochaperone, pr 98.83
1p6t_A151 Potential copper-transporting ATPase; COPA, P-type 98.76
1qup_A 222 Superoxide dismutase 1 copper chaperone; two domai 98.75
2kkh_A95 Putative heavy metal transporter; zinc transport, 98.68
1jww_A80 Potential copper-transporting ATPase; beta-alpha-b 98.67
2ofg_X111 Zinc-transporting ATPase; ferredoxin-like fold, be 98.66
2ew9_A149 Copper-transporting ATPase 2; copper trafficking, 98.65
2rop_A202 Copper-transporting ATPase 2; wilson protein, mobi 98.63
1jk9_B 249 CCS, copper chaperone for superoxide dismutase; pr 98.59
2rop_A 202 Copper-transporting ATPase 2; wilson protein, mobi 98.52
1p6t_A151 Potential copper-transporting ATPase; COPA, P-type 98.22
3j09_A 723 COPA, copper-exporting P-type ATPase A; copper tra 98.13
2jsx_A95 Protein NAPD; TAT, proofreading, cytoplasm, chaper 84.87
3cq1_A103 Putative uncharacterized protein TTHB138; DTDP-4-k 83.29
3lno_A108 Putative uncharacterized protein; alpha-beta fold, 82.43
>3iwl_A Copper transport protein ATOX1; beta-alpha-beta-BETA-alpha-beta, cisplatin, platinum, chaperone, ION transport, metal-binding, metal transport; HET: TCE; 1.60A {Homo sapiens} SCOP: d.58.17.1 PDB: 1fe4_A* 1fee_A* 1tl4_A 1tl5_A 2k1r_B 1fe0_A* 3iwx_A 3cjk_A Back     alignment and structure
Probab=99.40  E-value=8.7e-13  Score=82.54  Aligned_cols=47  Identities=23%  Similarity=0.465  Sum_probs=42.8

Q ss_pred             eEEEEEecccChhHHHHHHHHHhcCCCceEEEEeccCCEEEEEeecCc
Q 033120           47 QEVVLSADIRCSECQKRVADMMSKLNETESVLVNVSEKKVTLTSRYPV   94 (126)
Q Consensus        47 Q~VvLkvgMsC~hC~krVkkaLskL~GVesV~VDLe~KkVtVtg~~~~   94 (126)
                      ++++|.+||+|.||+.+|+++|.+++|| ++.||+..++++|+++.+.
T Consensus         2 ~~~~~~vgm~C~~C~~~i~~~l~~~~gV-~v~v~~~~~~~~v~~~~~~   48 (68)
T 3iwl_A            2 PKHEFSVDMTCGGCAEAVSRVLNKLGGV-KYDIDLPNKKVCIESEHSM   48 (68)
T ss_dssp             CEEEEEECCCSHHHHHHHHHHHHHHCSE-EEEEETTTTEEEEEESSCH
T ss_pred             ceEEEEECcCcHHHHHHHHHHHHcCCCe-EEEEEcCCCEEEEEecCCH
Confidence            4677888999999999999999999999 9999999999999986543
>1cc8_A Protein (metallochaperone ATX1); copper transport, mercury coordination, metal transport; 1.02A {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1cc7_A 1fd8_A 1fes_A 2ggp_A 3k7r_A Back     alignment and structure
>4a4j_A Pacszia, cation-transporting ATPase PACS; hydrolase, copper homeostasis, zinc homeostasis, ATX1, metal-transporting atpases; 1.25A {Synechocystis} PDB: 4a48_A 2gcf_A 2xmw_A Back     alignment and structure
>3dxs_X Copper-transporting ATPase RAN1; CXXC motif, ferredoxin-like fold, ATP- binding, ethylene signaling pathway, hydrolase, ION transport; 1.70A {Arabidopsis thaliana} SCOP: d.58.17.0 Back     alignment and structure
>2crl_A Copper chaperone for superoxide dismutase; SOD1, familial ALS, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xmw_A PACS-N, cation-transporting ATPase PACS; hydrolase, Cu(I)-binding, trafficking; 1.80A {Synechocystis SP} PDB: 2gcf_A Back     alignment and structure
>3fry_A Probable copper-exporting P-type ATPase A; transport protein, metal binding domain, domain SWAP, ATP-BI cell membrane, copper transport; HET: CIT; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>2xmm_A SSR2857 protein, ATX1; metal transport, copper homeostasis, chaperone, P-type atpas; 1.65A {Synechocystis SP} PDB: 2xmv_A 1sb6_A 2xmj_A 2xmk_A 2xmt_A 2xmu_A Back     alignment and structure
>1yg0_A COP associated protein; open-faced beta-sandwich, missing C-terminal beta-sheet, Met transport; NMR {Helicobacter pylori} Back     alignment and structure
>2kt2_A Mercuric reductase; nmera, MERA, HMA domain, mercuric resist metal-binding, oxidoreductase; NMR {Pseudomonas aeruginosa} PDB: 2kt3_A Back     alignment and structure
>3cjk_B Copper-transporting ATPase 1; HAH1, ATP7B, menkes disease, metal homeostasis, chaperone, ION transport, metal- binding, alternative splicing; 1.80A {Homo sapiens} PDB: 2k1r_A Back     alignment and structure
>1osd_A MERP, hypothetical protein MERP; mercury resistance, metal binding protein, perisplasm, structural genomics; 2.00A {Cupriavidus metallidurans} SCOP: d.58.17.1 PDB: 1afi_A 1afj_A 2hqi_A Back     alignment and structure
>1aw0_A Menkes copper-transporting ATPase; copper-binding domain, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 2aw0_A Back     alignment and structure
>2l3m_A Copper-ION-binding protein; structural genomics, center for structural genomics of infec diseases, csgid, metal binding protein; NMR {Bacillus anthracis} Back     alignment and structure
>2kyz_A Heavy metal binding protein; structural genomics, PSI-biology, protein structure initiative, joint for structural genomics, JCSG; NMR {Thermotoga maritima} Back     alignment and structure
>1mwy_A ZNTA; open-faced beta-sandwich fold, beta-alpha-beta-BETA-alpha- beta, hydrolase; NMR {Escherichia coli} SCOP: d.58.17.1 PDB: 1mwz_A Back     alignment and structure
>2aj0_A Probable cadmium-transporting ATPase; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta, metal binding protein, hydrolase; NMR {Listeria monocytogenes} PDB: 2aj1_A Back     alignment and structure
>2roe_A Heavy metal binding protein; NMR {Thermus thermophilus} PDB: 2rog_A Back     alignment and structure
>1kvi_A Copper-transporting ATPase 1; menkes, Cu-protein, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1kvj_A Back     alignment and structure
>1q8l_A Copper-transporting ATPase 1; metal binding protein; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1s6o_A 1s6u_A Back     alignment and structure
>2ldi_A Zinc-transporting ATPase; metal homeostasis, metallochaperones, hydrolase; NMR {Synechocystis SP} Back     alignment and structure
>1cpz_A Protein (COPZ); copper chaperone, metal transport, gene regulation; NMR {Enterococcus hirae} SCOP: d.58.17.1 Back     alignment and structure
>2qif_A Copper chaperone COPZ; tetranuclear Cu(I) cluster; 1.50A {Bacillus subtilis} SCOP: d.58.17.1 PDB: 3i9z_A 1k0v_A 1p8g_A Back     alignment and structure
>1fvq_A Copper-transporting ATPase; APO-CCC2A, hydrolase; NMR {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1fvs_A 2ggp_B Back     alignment and structure
>1y3j_A Copper-transporting ATPase 1; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta structure, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1y3k_A Back     alignment and structure
>2k2p_A Uncharacterized protein ATU1203; putative metal-binding domain ATU1203, ontario centre for ST proteomics, structural genomics; NMR {Agrobacterium tumefaciens str} Back     alignment and structure
>2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} Back     alignment and structure
>2g9o_A Copper-transporting ATPase 1; menkes disease, solution structure, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} PDB: 2ga7_A Back     alignment and structure
>1opz_A Potential copper-transporting ATPase; mutation, folding, abbab fold, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 1oq3_A 1oq6_A Back     alignment and structure
>1yjr_A Copper-transporting ATPase 1; metallochaperone, protein-protein interaction, copper(I), metal homeostasis, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1yjt_A 1yju_A 1yjv_A Back     alignment and structure
>1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A Back     alignment and structure
>1qup_A Superoxide dismutase 1 copper chaperone; two domains, beta-alpha-beta-BETA-alpha-beta and beta barrel; 1.80A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Back     alignment and structure
>2kkh_A Putative heavy metal transporter; zinc transport, metal binding, metal selectivity, ferredoxin fold, ATP-binding, hydrolase; NMR {Arabidopsis thaliana} Back     alignment and structure
>1jww_A Potential copper-transporting ATPase; beta-alpha-beta-BETA-alpha-beta, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 2voy_A 1kqk_A Back     alignment and structure
>2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} Back     alignment and structure
>2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} Back     alignment and structure
>1jk9_B CCS, copper chaperone for superoxide dismutase; protein-protein complex, heterodimer, metallochaperone, amyotrophic lateral sclerosis; 2.90A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Back     alignment and structure
>2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} Back     alignment and structure
>1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A Back     alignment and structure
>3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} Back     alignment and structure
>2jsx_A Protein NAPD; TAT, proofreading, cytoplasm, chaperone; NMR {Escherichia coli K12} PDB: 2pq4_A Back     alignment and structure
>3cq1_A Putative uncharacterized protein TTHB138; DTDP-4-keto-L-rhamnose reductase, plasmid, oxidoreductase, structural genomics, NPPSFA; 1.90A {Thermus thermophilus} PDB: 2cu6_A 3cq2_A 3cq3_A* Back     alignment and structure
>3lno_A Putative uncharacterized protein; alpha-beta fold, structural genomics, center for structural genomics of infectious diseases, csgid; 2.10A {Bacillus anthracis} SCOP: d.52.8.0 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query126
d1cc8a_72 ATX1 metallochaperone protein (ATOX1) {Baker's yea 99.62
d1qupa272 Copper chaperone for superoxide dismutase, N-termi 99.57
d1fe0a_66 ATX1 metallochaperone protein (ATOX1) {Human (Homo 99.5
d2ggpb172 Copper transporter domain ccc2a {Baker's yeast (Sa 99.36
d1sb6a_64 Copper chaperone {Synechocystis sp. pcc 6803, Scat 99.35
d2qifa169 Copper chaperone {Bacillus subtilis, CopZ [TaxId: 99.35
d2aw0a_72 Menkes copper-transporting ATPase {Human (Homo sap 99.33
d1osda_72 Mercuric ion binding protein MerP {Ralstonia metal 99.32
d1p6ta172 Potential copper-translocating P-type ATPase CopA 99.27
d1cpza_68 Copper chaperone {Enterococcus hirae [TaxId: 1354] 99.25
d1q8la_84 Menkes copper-transporting ATPase {Human (Homo sap 99.23
d1mwza_73 Metal ion-transporting ATPase ZntA, N-terminal dom 99.2
d1kvja_79 Menkes copper-transporting ATPase {Human (Homo sap 99.12
d1p6ta279 Potential copper-translocating P-type ATPase CopA 99.09
d1uwda_102 Hypothetical protein TM0487 {Thermotoga maritima [ 87.27
d2cu6a191 Hypothetical protein TTHB138 {Thermus thermophilus 85.45
>d1cc8a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: HMA, heavy metal-associated domain
family: HMA, heavy metal-associated domain
domain: ATX1 metallochaperone protein (ATOX1)
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=99.62  E-value=8.4e-16  Score=100.79  Aligned_cols=51  Identities=16%  Similarity=0.389  Sum_probs=48.1

Q ss_pred             eeeEEEEEecccChhHHHHHHHHHhcCC-CceEEEEeccCCEEEEEeecCcc
Q 033120           45 LVQEVVLSADIRCSECQKRVADMMSKLN-ETESVLVNVSEKKVTLTSRYPVV   95 (126)
Q Consensus        45 ~~Q~VvLkvgMsC~hC~krVkkaLskL~-GVesV~VDLe~KkVtVtg~~~~d   95 (126)
                      ++|+.+++++|+|+||+++|+++|.+++ ||.+|+||+++++|+|+|+++++
T Consensus         2 ~~kt~~f~V~MtC~~C~~~Ie~~L~~l~~gV~~v~v~~~~~~v~V~~~~~~~   53 (72)
T d1cc8a_           2 EIKHYQFNVVMTCSGCSGAVNKVLTKLEPDVSKIDISLEKQLVDVYTTLPYD   53 (72)
T ss_dssp             CCEEEEEEECCCSHHHHHHHHHHHHTTTTSEEEEEEETTTTEEEEEESSCHH
T ss_pred             CcEEEEEEECcCcHHHHHHHHHHHHcCcCceEEEEEECCCCEEEEeecCCHH
Confidence            6899999999999999999999999995 99999999999999999997764
>d1qupa2 d.58.17.1 (A:2-73) Copper chaperone for superoxide dismutase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fe0a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1 [TaxId: 9606]} Back     information, alignment and structure
>d2ggpb1 d.58.17.1 (B:1-72) Copper transporter domain ccc2a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sb6a_ d.58.17.1 (A:) Copper chaperone {Synechocystis sp. pcc 6803, Scatx1 [TaxId: 1148]} Back     information, alignment and structure
>d2qifa1 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subtilis, CopZ [TaxId: 1423]} Back     information, alignment and structure
>d2aw0a_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1osda_ d.58.17.1 (A:) Mercuric ion binding protein MerP {Ralstonia metallidurans CH34 [TaxId: 266264]} Back     information, alignment and structure
>d1p6ta1 d.58.17.1 (A:1-72) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1cpza_ d.58.17.1 (A:) Copper chaperone {Enterococcus hirae [TaxId: 1354]} Back     information, alignment and structure
>d1q8la_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mwza_ d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kvja_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p6ta2 d.58.17.1 (A:73-151) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1uwda_ d.52.8.2 (A:) Hypothetical protein TM0487 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2cu6a1 d.52.8.2 (A:6-96) Hypothetical protein TTHB138 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure