Citrus Sinensis ID: 033158

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120------
MALLVPGGGCARLAISHPAQVSRRTAVVATLSPPKRDKVDYWVDATSSFFEPDSRPIMLYDGVCNLCNGGVKFVRDNDKNRRIRYEALQSESGKKLLRRSGRAPDDISSVVLVEKDRYADIIFSVF
ccccccccccccccccccHHHHHHHHHcccccccccccccccccccccccccccccEEEEcccccccHHHHHHHHHccccccEEEEEcccHHHHHHHHHHccccccccEEEEEEcccccccHHccc
cEEEEcccHHEEEEcccccccccccHHHHcccccccccccHHHcccHHHcccccccEEEEccccccccHcEEEEEEccccccEEEEHcccHHHHHHHHHcccccccccEEEEEEccccccEEEEEc
mallvpgggcarlaishpaqvsrRTAVvatlsppkrdkvdywvdatssffepdsrpimlyDGVCnlcnggvkfvrdndknRRIRYEALQSESGKKLLrrsgrapddissvvlvekdryadIIFSVF
MALLVPGGGCARLaishpaqvsrrtavvatlsppkrdkvdyWVDATSsffepdsrpIMLYDGVCNLCNGGvkfvrdndknRRIRYealqsesgkkllrrsgrapddissvvlvekdryADIIFSVF
MALLVPGGGCARLAISHPAQVSRRTAVVATLSPPKRDKVDYWVDATSSFFEPDSRPIMLYDGVCNLCNGGVKFVRDNDKNRRIRYEALQSESGKKLLRRSGRAPDDISSVVLVEKDRYADIIFSVF
******GGGCARLAISHPAQVSRRTAVVATLSPPKRDKVDYWVDATSSFFEPDSRPIMLYDGVCNLCNGGVKFVRDND******************************SVVLVEKDRYADIIFS**
************************************************FFEPDSRPIMLYDGVCNLCNGGVKFVRDNDKNRRIRYEALQSESGKKLLRRSGRAPDDISSVVLVEKDRYADIIFSVF
MALLVPGGGCARLAISHPAQVSRRTAVVATLSPPKRDKVDYWVDATSSFFEPDSRPIMLYDGVCNLCNGGVKFVRDNDKNRRIRYEALQSESGKKLLRRSGRAPDDISSVVLVEKDRYADIIFSVF
MALLVPGGGCARLAISHPAQVSRRTAVVATLSPPKRDKVDYWVDATSSFFEPDSRPIMLYDGVCNLCNGGVKFVRDNDKNRRIRYEALQSESGKKLLRRSGRAPDDISSVVLVEKDRYADIIFSVF
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MALLVPGGGCARLAISHPAQVSRRTAVVATLSPPKRDKVDYWVDATSSFFEPDSRPIMLYDGVCNLCNGGVKFVRDNDKNRRIRYEALQSESGKKLLRRSGRAPDDISSVVLVEKDRYADIIFSVF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query126 2.2.26 [Sep-21-2011]
Q9SSR1172 DCC family protein At1g52 yes no 0.912 0.668 0.683 5e-38
P40761137 Uncharacterized protein Y yes no 0.460 0.423 0.465 1e-10
>sp|Q9SSR1|Y1259_ARATH DCC family protein At1g52590, chloroplastic OS=Arabidopsis thaliana GN=At1g52590 PE=1 SV=1 Back     alignment and function desciption
 Score =  156 bits (394), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 90/117 (76%), Gaps = 2/117 (1%)

Query: 1   MALLVPGGGCARLAISHPAQVSRRTAVVATLSPPKRDKVDYWVDATSSFFEPDSRPIMLY 60
           MA+L+P     RL I+  AQV  R +  A     +RD VD WV  TSSFFE D RPIML+
Sbjct: 1   MAILIPAS-FGRLTITSRAQVRVRVSASANQRTIRRDSVD-WVKETSSFFEEDKRPIMLF 58

Query: 61  DGVCNLCNGGVKFVRDNDKNRRIRYEALQSESGKKLLRRSGRAPDDISSVVLVEKDR 117
           DGVCNLCNGGVKFVRD+D+NR IR+EALQSE+GKKLL RSGRAPDDISSVVLVE DR
Sbjct: 59  DGVCNLCNGGVKFVRDHDRNRSIRFEALQSEAGKKLLLRSGRAPDDISSVVLVENDR 115

Arabidopsis thaliana (taxid: 3702)
>sp|P40761|YUXK_BACSU Uncharacterized protein YuxK OS=Bacillus subtilis (strain 168) GN=yuxK PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query126
255553145180 nucleic acid binding protein, putative [ 0.912 0.638 0.717 4e-40
317106732178 JHL06P13.8 [Jatropha curcas] 0.920 0.651 0.705 7e-40
225443005176 PREDICTED: DCC family protein At1g52590, 0.912 0.653 0.717 1e-37
18404093172 Putative thiol-disulfide oxidoreductase 0.912 0.668 0.683 3e-36
297853016172 hypothetical protein ARALYDRAFT_474385 [ 0.912 0.668 0.675 2e-35
21593813172 unknown [Arabidopsis thaliana] 0.912 0.668 0.666 6e-35
217071310178 unknown [Medicago truncatula] 0.753 0.533 0.75 1e-34
357455201178 DCC family protein [Medicago truncatula] 0.753 0.533 0.75 1e-34
351720748172 uncharacterized protein LOC100305986 [Gl 0.896 0.656 0.647 5e-34
146454860151 putative thioldisulphide oxidoreductase 0.841 0.701 0.672 6e-34
>gi|255553145|ref|XP_002517615.1| nucleic acid binding protein, putative [Ricinus communis] gi|223543247|gb|EEF44779.1| nucleic acid binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  169 bits (427), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 84/117 (71%), Positives = 95/117 (81%), Gaps = 2/117 (1%)

Query: 1   MALLVPGGGCARLAISHPAQVSRRTAVVATLSPPKRDKVDYWVDATSSFFEPDSRPIMLY 60
           MAL+ P   C RL     A V  R AV AT+SPP    V+ WV+AT+ FFE D+RPIML+
Sbjct: 1   MALVTPSS-CVRLTAVPTAHVRHRMAVFATISPPSSGTVN-WVEATNGFFERDARPIMLF 58

Query: 61  DGVCNLCNGGVKFVRDNDKNRRIRYEALQSESGKKLLRRSGRAPDDISSVVLVEKDR 117
           DGVCNLCNGGV+FVRDND+NR+IRYEALQSE+GKKLLRRSGRAPDDISSVVLVEKDR
Sbjct: 59  DGVCNLCNGGVRFVRDNDRNRKIRYEALQSEAGKKLLRRSGRAPDDISSVVLVEKDR 115

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|317106732|dbj|BAJ53228.1| JHL06P13.8 [Jatropha curcas] Back     alignment and taxonomy information
>gi|225443005|ref|XP_002269416.1| PREDICTED: DCC family protein At1g52590, chloroplastic [Vitis vinifera] Back     alignment and taxonomy information
>gi|18404093|ref|NP_564611.1| Putative thiol-disulfide oxidoreductase DCC [Arabidopsis thaliana] gi|75207555|sp|Q9SSR1.1|Y1259_ARATH RecName: Full=DCC family protein At1g52590, chloroplastic; Flags: Precursor gi|5903046|gb|AAD55605.1|AC008016_15 F6D8.19 [Arabidopsis thaliana] gi|26450069|dbj|BAC42154.1| unknown protein [Arabidopsis thaliana] gi|28827528|gb|AAO50608.1| unknown protein [Arabidopsis thaliana] gi|332194706|gb|AEE32827.1| Putative thiol-disulfide oxidoreductase DCC [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297853016|ref|XP_002894389.1| hypothetical protein ARALYDRAFT_474385 [Arabidopsis lyrata subsp. lyrata] gi|297340231|gb|EFH70648.1| hypothetical protein ARALYDRAFT_474385 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|21593813|gb|AAM65780.1| unknown [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|217071310|gb|ACJ84015.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|357455201|ref|XP_003597881.1| DCC family protein [Medicago truncatula] gi|87162922|gb|ABD28717.1| Putative thiol-disulphide oxidoreductase DCC [Medicago truncatula] gi|355486929|gb|AES68132.1| DCC family protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|351720748|ref|NP_001235907.1| uncharacterized protein LOC100305986 [Glycine max] gi|255627201|gb|ACU13945.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|146454860|gb|ABQ42096.1| putative thioldisulphide oxidoreductase DCC [Sonneratia caseolaris] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query126
TAIR|locus:2035159172 AT1G52590 "AT1G52590" [Arabido 0.912 0.668 0.683 1.2e-35
UNIPROTKB|Q48N48122 PSPPH_0898 "Uncharacterized pr 0.539 0.557 0.405 1.5e-10
UNIPROTKB|Q87WV7150 PSPTO_4436 "Uncharacterized pr 0.484 0.406 0.409 2e-08
UNIPROTKB|Q481Y2148 CPS_2420 "Putative uncharacter 0.507 0.432 0.296 0.0001
TIGR_CMR|CPS_2420148 CPS_2420 "conserved hypothetic 0.507 0.432 0.296 0.0001
TAIR|locus:2035159 AT1G52590 "AT1G52590" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 385 (140.6 bits), Expect = 1.2e-35, P = 1.2e-35
 Identities = 80/117 (68%), Positives = 90/117 (76%)

Query:     1 MALLVPGGGCARLAISHPAQVSRRTAVVATLSPPKRDKVDYWVDATSSFFEPDSRPIMLY 60
             MA+L+P     RL I+  AQV  R +  A     +RD VD WV  TSSFFE D RPIML+
Sbjct:     1 MAILIPAS-FGRLTITSRAQVRVRVSASANQRTIRRDSVD-WVKETSSFFEEDKRPIMLF 58

Query:    61 DGVCNLCNGGVKFVRDNDKNRRIRYEALQSESGKKLLRRSGRAPDDISSVVLVEKDR 117
             DGVCNLCNGGVKFVRD+D+NR IR+EALQSE+GKKLL RSGRAPDDISSVVLVE DR
Sbjct:    59 DGVCNLCNGGVKFVRDHDRNRSIRFEALQSEAGKKLLLRSGRAPDDISSVVLVENDR 115
GO:0003674 "molecular_function" evidence=ND
GO:0008150 "biological_process" evidence=ND
GO:0010287 "plastoglobule" evidence=IDA
UNIPROTKB|Q48N48 PSPPH_0898 "Uncharacterized protein" [Pseudomonas syringae pv. phaseolicola 1448A (taxid:264730)] Back     alignment and assigned GO terms
UNIPROTKB|Q87WV7 PSPTO_4436 "Uncharacterized protein" [Pseudomonas syringae pv. tomato str. DC3000 (taxid:223283)] Back     alignment and assigned GO terms
UNIPROTKB|Q481Y2 CPS_2420 "Putative uncharacterized protein" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_2420 CPS_2420 "conserved hypothetical protein" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9SSR1Y1259_ARATHNo assigned EC number0.68370.91260.6686yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query126
pfam04134113 pfam04134, DUF393, Protein of unknown function, DU 7e-16
COG3011137 COG3011, COG3011, Predicted thiol-disulfide oxidor 6e-15
>gnl|CDD|217918 pfam04134, DUF393, Protein of unknown function, DUF393 Back     alignment and domain information 
 Score = 67.7 bits (166), Expect = 7e-16
 Identities = 24/59 (40%), Positives = 34/59 (57%)

Query: 59  LYDGVCNLCNGGVKFVRDNDKNRRIRYEALQSESGKKLLRRSGRAPDDISSVVLVEKDR 117
           LYDG C LCN  V+F+   D+  R+R+  +QS  G+ LL   G  P+D+ S + VE   
Sbjct: 2   LYDGECPLCNREVRFLERRDRGGRLRFVDIQSAEGQALLEAFGIDPEDLDSRLHVEDGG 60

Members of this family have two highly conserved cysteine residues near their N-terminus. The function of these proteins is unknown. Length = 113
>gnl|CDD|225556 COG3011, COG3011, Predicted thiol-disulfide oxidoreductase [General function prediction only] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 126
COG3011137 Predicted thiol-disulfide oxidoreductase [General 99.79
PF04134114 DUF393: Protein of unknown function, DUF393; Inter 99.66
cd02982103 PDI_b'_family Protein Disulfide Isomerase (PDIb') 94.06
TIGR01126102 pdi_dom protein disulfide-isomerase domain. This m 92.64
PTZ0005198 thioredoxin; Provisional 91.92
PF13728215 TraF: F plasmid transfer operon protein 91.38
cd0294997 TRX_NTR TRX domain, novel NADPH thioredoxin reduct 90.73
COG3019149 Predicted metal-binding protein [General function 90.68
PF00085103 Thioredoxin: Thioredoxin; InterPro: IPR013766 Thio 90.4
cd0297367 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)- 89.15
cd02961101 PDI_a_family Protein Disulfide Isomerase (PDIa) fa 89.03
TIGR0220077 GlrX_actino Glutaredoxin-like protein. This family 88.41
PRK11657251 dsbG disulfide isomerase/thiol-disulfide oxidase; 88.21
cd03004104 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfam 88.2
TIGR01068101 thioredoxin thioredoxin. Several proteins, such as 87.85
cd0294793 TRX_family TRX family; composed of two groups: Gro 87.42
cd03003101 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfam 87.34
PRK10877232 protein disulfide isomerase II DsbC; Provisional 86.66
TIGR0041182 redox_disulf_1 small redox-active disulfide protei 86.59
PRK13703248 conjugal pilus assembly protein TraF; Provisional 86.53
cd02966116 TlpA_like_family TlpA-like family; composed of Tlp 86.46
cd03020197 DsbA_DsbC_DsbG DsbA family, DsbC and DsbG subfamil 85.62
cd0298497 TRX_PICOT TRX domain, PICOT (for PKC-interacting c 85.4
cd02989113 Phd_like_TxnDC9 Phosducin (Phd)-like family, Thior 84.91
cd03001103 PDI_a_P5 PDIa family, P5 subfamily; composed of eu 84.41
TIGR02739256 TraF type-F conjugative transfer system pilin asse 84.14
cd02997104 PDI_a_PDIR PDIa family, PDIR subfamily; composed o 84.05
cd02975113 PfPDO_like_N Pyrococcus furiosus protein disulfide 83.67
cd0295696 ybbN ybbN protein family; ybbN is a hypothetical p 83.4
cd0165969 TRX_superfamily Thioredoxin (TRX) superfamily; a l 82.97
cd02995104 PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain 82.89
cd0297298 DsbA_family DsbA family; consists of DsbA and DsbA 82.56
cd03002109 PDI_a_MPD1_like PDI family, MPD1-like subfamily; c 82.29
cd0302689 AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxid 82.23
cd02996108 PDI_a_ERp44 PDIa family, endoplasmic reticulum pro 81.71
TIGR0218084 GRX_euk Glutaredoxin. This model represents eukary 81.67
cd02957113 Phd_like Phosducin (Phd)-like family; composed of 81.33
cd03023154 DsbA_Com1_like DsbA family, Com1-like subfamily; c 80.73
>COG3011 Predicted thiol-disulfide oxidoreductase [General function prediction only] Back     alignment and domain information 
Probab=99.79  E-value=2.3e-19  Score=134.36  Aligned_cols=74  Identities=43%  Similarity=0.805  Sum_probs=69.0

Q ss_pred             CCCccEEEEeCCCcchHHHHHHHHHhCCCCcEEEEeccchhHHHHHHhcCCCccCCcEEEEEECCch---hhhhhhh
Q 033158           52 PDSRPIMLYDGVCNLCNGGVKFVRDNDKNRRIRYEALQSESGKKLLRRSGRAPDDISSVVLVEKDRY---ADIIFSV  125 (126)
Q Consensus        52 ~~~~~iV~FDG~C~LC~~~V~fl~r~Dr~~~~~F~~lQS~~g~~lL~~~Gl~~e~~dsvllv~~Gr~---~~Af~ai  125 (126)
                      +....+|+|||+|+||+++|+|++++|+.++++|+++||+.|+++++.+|+++++.++++++++|+.   ++|+++|
T Consensus         6 ~~p~~vvlyDG~C~lC~~~vrfLi~~D~~~~i~f~~~q~e~g~~~l~~~~l~~~~~~s~~~~~~g~~~~~sdA~~~i   82 (137)
T COG3011           6 KKPDLVVLYDGVCPLCDGWVRFLIRRDQGGRIRFAALQSEPGQALLEAAGLDPEDVDSVLLVEAGQLLVGSDAAIRI   82 (137)
T ss_pred             CCCCEEEEECCcchhHHHHHHHHHHhccCCcEEEEeccCchhhhHHhhcCCChhhhheeeEecCCceEeccHHHHHH
Confidence            5567899999999999999999999999999999999999999999999999999999999999986   7777765

>PF04134 DUF393: Protein of unknown function, DUF393; InterPro: IPR007263 The DCC family, named after the conserved N-terminal DxxCxxC motif, encompasses COG3011 from COG Back     alignment and domain information
>cd02982 PDI_b'_family Protein Disulfide Isomerase (PDIb') family, redox inactive TRX-like domain b'; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants Back     alignment and domain information
>TIGR01126 pdi_dom protein disulfide-isomerase domain Back     alignment and domain information
>PTZ00051 thioredoxin; Provisional Back     alignment and domain information
>PF13728 TraF: F plasmid transfer operon protein Back     alignment and domain information
>cd02949 TRX_NTR TRX domain, novel NADPH thioredoxin reductase (NTR) family; composed of fusion proteins found only in oxygenic photosynthetic organisms containing both TRX and NTR domains Back     alignment and domain information
>COG3019 Predicted metal-binding protein [General function prediction only] Back     alignment and domain information
>PF00085 Thioredoxin: Thioredoxin; InterPro: IPR013766 Thioredoxins [, , , ] are small disulphide-containing redox proteins that have been found in all the kingdoms of living organisms Back     alignment and domain information
>cd02973 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)-like family; composed of archaeal and bacterial proteins that show similarity to both TRX and GRX, including the C-terminal TRX-fold subdomain of Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO) Back     alignment and domain information
>cd02961 PDI_a_family Protein Disulfide Isomerase (PDIa) family, redox active TRX domains; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants Back     alignment and domain information
>TIGR02200 GlrX_actino Glutaredoxin-like protein Back     alignment and domain information
>PRK11657 dsbG disulfide isomerase/thiol-disulfide oxidase; Provisional Back     alignment and domain information
>cd03004 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains Back     alignment and domain information
>TIGR01068 thioredoxin thioredoxin Back     alignment and domain information
>cd02947 TRX_family TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains Back     alignment and domain information
>cd03003 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains Back     alignment and domain information
>PRK10877 protein disulfide isomerase II DsbC; Provisional Back     alignment and domain information
>TIGR00411 redox_disulf_1 small redox-active disulfide protein 1 Back     alignment and domain information
>PRK13703 conjugal pilus assembly protein TraF; Provisional Back     alignment and domain information
>cd02966 TlpA_like_family TlpA-like family; composed of TlpA, ResA, DsbE and similar proteins Back     alignment and domain information
>cd03020 DsbA_DsbC_DsbG DsbA family, DsbC and DsbG subfamily; V-shaped homodimeric proteins containing a redox active CXXC motif imbedded in a TRX fold Back     alignment and domain information
>cd02984 TRX_PICOT TRX domain, PICOT (for PKC-interacting cousin of TRX) subfamily; PICOT is a protein that interacts with protein kinase C (PKC) theta, a calcium independent PKC isoform selectively expressed in skeletal muscle and T lymphocytes Back     alignment and domain information
>cd02989 Phd_like_TxnDC9 Phosducin (Phd)-like family, Thioredoxin (TRX) domain containing protein 9 (TxnDC9) subfamily; composed of predominantly uncharacterized eukaryotic proteins, containing a TRX-like domain without the redox active CXXC motif Back     alignment and domain information
>cd03001 PDI_a_P5 PDIa family, P5 subfamily; composed of eukaryotic proteins similar to human P5, a PDI-related protein with a domain structure of aa'b (where a and a' are redox active TRX domains and b is a redox inactive TRX-like domain) Back     alignment and domain information
>TIGR02739 TraF type-F conjugative transfer system pilin assembly protein TraF Back     alignment and domain information
>cd02997 PDI_a_PDIR PDIa family, PDIR subfamily; composed of proteins similar to human PDIR (for Protein Disulfide Isomerase Related) Back     alignment and domain information
>cd02975 PfPDO_like_N Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO)-like family, N-terminal TRX-fold subdomain; composed of proteins with similarity to PfPDO, a redox active thermostable protein believed to be the archaeal counterpart of bacterial DsbA and eukaryotic protein disulfide isomerase (PDI), which are both involved in oxidative protein folding Back     alignment and domain information
>cd02956 ybbN ybbN protein family; ybbN is a hypothetical protein containing a redox-inactive TRX-like domain Back     alignment and domain information
>cd01659 TRX_superfamily Thioredoxin (TRX) superfamily; a large, diverse group of proteins containing a TRX-fold Back     alignment and domain information
>cd02995 PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain (a') subfamily; composed of the C-terminal redox active a' domains of PDI, ERp72, ERp57 (or ERp60) and EFP1 Back     alignment and domain information
>cd02972 DsbA_family DsbA family; consists of DsbA and DsbA-like proteins, including DsbC, DsbG, glutathione (GSH) S-transferase kappa (GSTK), 2-hydroxychromene-2-carboxylate (HCCA) isomerase, an oxidoreductase (FrnE) presumed to be involved in frenolicin biosynthesis, a 27-kDa outer membrane protein, and similar proteins Back     alignment and domain information
>cd03002 PDI_a_MPD1_like PDI family, MPD1-like subfamily; composed of eukaryotic proteins similar to Saccharomyces cerevisiae MPD1 protein, which contains a single redox active TRX domain located at the N-terminus, and an ER retention signal at the C-terminus indicative of an ER-resident protein Back     alignment and domain information
>cd03026 AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxide reductase F subunit (AhpF) N-terminal domain (NTD) subfamily, C-terminal TRX-fold subdomain; AhpF is a homodimeric flavoenzyme which catalyzes the NADH-dependent reduction of the peroxiredoxin AhpC, which then reduces hydrogen peroxide and organic hydroperoxides Back     alignment and domain information
>cd02996 PDI_a_ERp44 PDIa family, endoplasmic reticulum protein 44 (ERp44) subfamily; ERp44 is an ER-resident protein, induced during stress, involved in thiol-mediated ER retention Back     alignment and domain information
>TIGR02180 GRX_euk Glutaredoxin Back     alignment and domain information
>cd02957 Phd_like Phosducin (Phd)-like family; composed of Phd and Phd-like proteins (PhLP), characterized as cytosolic regulators of G protein functions Back     alignment and domain information
>cd03023 DsbA_Com1_like DsbA family, Com1-like subfamily; composed of proteins similar to Com1, a 27-kDa outer membrane-associated immunoreactive protein originally found in both acute and chronic disease strains of the pathogenic bacteria Coxiella burnetti Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query126
2l57_A126 Uncharacterized protein; structural genomics, unkn 94.42
3uvt_A111 Thioredoxin domain-containing protein 5; thioredox 93.93
1thx_A115 Thioredoxin, thioredoxin 2; oxido-reductase, elect 92.91
2xc2_A117 Thioredoxinn; oxidoreductase, protein disulfide re 92.82
1t00_A112 Thioredoxin, TRX; redox regulation, multifunction 92.72
1fb6_A105 Thioredoxin M; electron transport; 2.10A {Spinacia 92.64
1w4v_A119 Thioredoxin, mitochondrial; antioxidant enzyme, mi 92.5
1nsw_A105 Thioredoxin, TRX; thermostability, electron transp 92.37
3d6i_A112 Monothiol glutaredoxin-3; thioredoxin-like, electr 92.34
1dby_A107 Chloroplast thioredoxin M CH2; thioredoxin CH2, ch 92.31
2i1u_A121 Thioredoxin, TRX, MPT46; redox protein, electron t 92.06
1fo5_A85 Thioredoxin; disulfide oxidoreductase, structural 92.05
2i4a_A107 Thioredoxin; acidophIle, disulfide exchange, oxido 92.04
3die_A106 Thioredoxin, TRX; electron transport, SWAP domain, 91.89
2l6c_A110 Thioredoxin; oxidoreductase; NMR {Desulfovibrio vu 91.88
3emx_A135 Thioredoxin; structural genomics, oxidoreductase, 91.85
1nho_A85 Probable thioredoxin; beta sheet, alpha helix, oxi 91.73
2trx_A108 Thioredoxin; electron transport; 1.68A {Escherichi 91.65
3tco_A109 Thioredoxin (TRXA-1); disulfide oxidoreductase, ox 91.61
2djk_A133 PDI, protein disulfide-isomerase; thioredoxin fold 91.56
2vim_A104 Thioredoxin, TRX; thioredoxin fold, oxidoreductase 91.44
3qfa_C116 Thioredoxin; protein-protein complex, rossmann fol 91.19
1x5d_A133 Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC 91.09
1xwb_A106 Thioredoxin; dimerization, redox regulation, THI X 91.07
3gnj_A111 Thioredoxin domain protein; APC92103, STR genomics 91.0
3m9j_A105 Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} 90.98
1gh2_A107 Thioredoxin-like protein; redox-active center, ele 90.79
1syr_A112 Thioredoxin; SGPP, structural genomics, PSI, prote 90.7
1ep7_A112 Thioredoxin CH1, H-type; electron transport; 2.10A 90.6
1ti3_A113 Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Popul 90.43
2vlu_A122 Thioredoxin, thioredoxin H isoform 2.; oxidoreduct 90.35
2e0q_A104 Thioredoxin; electron transport; 1.49A {Sulfolobus 90.32
3msz_A89 Glutaredoxin 1; alpha-beta sandwich, center for st 90.27
1wjk_A100 C330018D20RIK protein; glutaredoxin, thioredoxin f 90.25
2yzu_A109 Thioredoxin; redox protein, electron transport, st 90.17
2wz9_A153 Glutaredoxin-3; protein binding; 1.55A {Homo sapie 90.12
2vm1_A118 Thioredoxin, thioredoxin H isoform 1.; oxidoreduct 89.91
3f3q_A109 Thioredoxin-1; His TAG, electron transport, cytopl 89.87
3h79_A127 Thioredoxin-like protein; thioredoxin fold, cataly 89.86
2j23_A121 Thioredoxin; immune protein, autoreactivity, cross 89.83
1xfl_A124 Thioredoxin H1; AT3G51030, structural genomics, pr 89.73
2dj1_A140 Protein disulfide-isomerase A4; protein ERP-72, ER 89.71
3ul3_B128 Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; 89.66
2voc_A112 Thioredoxin; electron transport, homodimer, disulf 89.57
1kng_A156 Thiol:disulfide interchange protein CYCY; thioredo 88.99
2e7p_A116 Glutaredoxin; thioredoxin fold, poplar, electron t 88.74
3p2a_A148 Thioredoxin 2, putative thioredoxin-like protein; 88.47
3cxg_A133 Putative thioredoxin; malaria, structural GEN oxid 88.31
1v98_A140 Thioredoxin; oxidoreductase, structural genomics, 88.3
2o8v_B128 Thioredoxin 1; disulfide crosslinked complex, oxid 88.24
2ppt_A155 Thioredoxin-2; thiredoxin, zinc finger, oxidoreduc 88.21
4euy_A105 Uncharacterized protein; structural genomics, PSI- 88.05
1a8l_A 226 Protein disulfide oxidoreductase; PDI, thioredoxin 87.9
2l5l_A136 Thioredoxin; structural genomics, electron transpo 87.83
3gv1_A147 Disulfide interchange protein; neisseria gonorrhoe 87.54
1mek_A120 Protein disulfide isomerase; electron transport, r 87.53
2dml_A130 Protein disulfide-isomerase A6; thioredoxin domain 87.34
1r26_A125 Thioredoxin; redox-active disulfide, electron tran 87.33
3aps_A122 DNAJ homolog subfamily C member 10; thioredoxin fo 87.28
3l9s_A191 Thiol:disulfide interchange protein; thioredoxin-f 87.28
2oe3_A114 Thioredoxin-3; electron transport, alpha/beta sand 87.18
2lrn_A152 Thiol:disulfide interchange protein; structural ge 87.11
1x5e_A126 Thioredoxin domain containing protein 1; TMX, TXND 87.04
3hxs_A141 Thioredoxin, TRXP; electron transport; 2.00A {Bact 86.97
1zma_A118 Bacterocin transport accessory protein; alpha-beta 86.49
3uem_A 361 Protein disulfide-isomerase; thioredoxin-like doma 86.31
2k8s_A80 Thioredoxin; dimer, structural genomics, PSI-2, pr 85.84
1faa_A124 Thioredoxin F; electron transport; 1.85A {Spinacia 85.62
3hz4_A140 Thioredoxin; NYSGXRC, PSI-II, reduced form, protei 85.52
3zzx_A105 Thioredoxin; oxidoreductase; 1.88A {Litopenaeus va 85.2
2f51_A118 Thioredoxin; electron transport; 1.90A {Trichomona 85.15
3ga4_A178 Dolichyl-diphosphooligosaccharide-protein glycosyl 85.02
1h75_A81 Glutaredoxin-like protein NRDH; electron transport 84.78
2pu9_C111 TRX-F, thioredoxin F-type, chloroplast; protein-pr 84.69
3fkf_A148 Thiol-disulfide oxidoreductase; structural genomic 84.39
3tdg_A273 DSBG, putative uncharacterized protein; thioredoxi 84.34
1a8l_A226 Protein disulfide oxidoreductase; PDI, thioredoxin 84.1
3d22_A139 TRXH4, thioredoxin H-type; electron transport, cyt 83.87
2yj7_A106 LPBCA thioredoxin; oxidoreductase; 1.65A {Syntheti 84.16
1v58_A241 Thiol:disulfide interchange protein DSBG; reduced 83.64
2rem_A193 Disulfide oxidoreductase; disulfide oxidoreductase 83.62
3raz_A151 Thioredoxin-related protein; structural genomics, 83.51
3ha9_A165 Uncharacterized thioredoxin-like protein; PSI, MCS 83.12
1lu4_A136 Soluble secreted antigen MPT53; thioredoxin-like f 82.82
2es7_A142 Q8ZP25_salty, putative thiol-disulfide isomerase a 82.75
2dj3_A133 Protein disulfide-isomerase A4; protein ERP-72, ER 82.39
3ipz_A109 Monothiol glutaredoxin-S14, chloroplastic; electro 82.21
2fgx_A107 Putative thioredoxin; NET3, NESG, GFT-glutaredoxin 82.12
1r7h_A75 NRDH-redoxin; thioredoxin, glutaredoxin, redox pro 82.04
3ia1_A154 THIO-disulfide isomerase/thioredoxin; oxidoreducta 81.48
2lja_A152 Putative thiol-disulfide oxidoreductase; structura 81.37
2ju5_A154 Thioredoxin disulfide isomerase; protein, oxidored 80.78
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 80.74
2dj0_A137 Thioredoxin-related transmembrane protein 2; AVLA2 80.67
1zzo_A136 RV1677; thioredoxin fold, structural genomics, PSI 80.43
1aba_A87 Glutaredoxin; electron transport; HET: MES; 1.45A 80.31
>2l57_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, PSI protein structure initiative; NMR {Clostridium perfringens} Back     alignment and structure
Probab=94.42  E-value=0.21  Score=32.96  Aligned_cols=62  Identities=15%  Similarity=0.175  Sum_probs=44.0

Q ss_pred             ccEEEEeCCCcchHHHHHHHHHhCC--CCcEEEEecc--chhHHHHHHhcCCCccCCcEEEEEE-CCch
Q 033158           55 RPIMLYDGVCNLCNGGVKFVRDNDK--NRRIRYEALQ--SESGKKLLRRSGRAPDDISSVVLVE-KDRY  118 (126)
Q Consensus        55 ~~iV~FDG~C~LC~~~V~fl~r~Dr--~~~~~F~~lQ--S~~g~~lL~~~Gl~~e~~dsvllv~-~Gr~  118 (126)
                      -.+.||.-.|+.|......+.+.-.  .+.+.|+.+.  .....++.+.+|+.  .+=++++++ +|+.
T Consensus        29 ~lv~f~a~wC~~C~~~~~~l~~~~~~~~~~v~~~~v~~~~d~~~~~~~~~~v~--~~Pt~~~~~~~G~~   95 (126)
T 2l57_A           29 TIIMFKTDTCPYCVEMQKELSYVSKEREGKFNIYYARLEEEKNIDLAYKYDAN--IVPTTVFLDKEGNK   95 (126)
T ss_dssp             EEEEEECSSCHHHHHHHHHHHHHHHHSSSSCEEEEEETTSSHHHHHHHHTTCC--SSSEEEEECTTCCE
T ss_pred             EEEEEECCCCccHHHHHHHHHHHHHHhcCCeEEEEEeCCCCchHHHHHHcCCc--ceeEEEEECCCCCE
Confidence            4566889999999998887755432  2568888877  66666778888863  334777776 6764
>3uvt_A Thioredoxin domain-containing protein 5; thioredoxin-like fold, isomerase; 2.00A {Homo sapiens} PDB: 2diz_A 3uj1_A Back     alignment and structure
>1thx_A Thioredoxin, thioredoxin 2; oxido-reductase, electron transport; 1.60A {Nostoc SP} SCOP: c.47.1.1 Back     alignment and structure
>2xc2_A Thioredoxinn; oxidoreductase, protein disulfide reductase; 1.56A {Schistosoma mansoni} PDB: 2xbq_A 2xbi_A Back     alignment and structure
>1t00_A Thioredoxin, TRX; redox regulation, multifunction macromolecule, electron transport; 1.51A {Streptomyces coelicolor} Back     alignment and structure
>1fb6_A Thioredoxin M; electron transport; 2.10A {Spinacia oleracea} SCOP: c.47.1.1 PDB: 1fb0_A 1gl8_A 2puk_C Back     alignment and structure
>1w4v_A Thioredoxin, mitochondrial; antioxidant enzyme, mitochondrion, electron TRA oxidoreductase; 1.80A {Homo sapiens} PDB: 1uvz_A 1w89_A Back     alignment and structure
>1nsw_A Thioredoxin, TRX; thermostability, electron transport; 1.90A {Alicyclobacillus acidocaldarius} SCOP: c.47.1.1 PDB: 1rqm_A 1quw_A 1nw2_A Back     alignment and structure
>3d6i_A Monothiol glutaredoxin-3; thioredoxin-like, electron transport, redox- active center, transport, oxidoreductase; HET: CME; 1.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1dby_A Chloroplast thioredoxin M CH2; thioredoxin CH2, chloroplastic thioredoxin, oxidoreductase; NMR {Chlamydomonas reinhardtii} SCOP: c.47.1.1 Back     alignment and structure
>2i1u_A Thioredoxin, TRX, MPT46; redox protein, electron transport; 1.30A {Mycobacterium tuberculosis} PDB: 3nof_A 3o6t_A* 2l4q_A 2l59_A Back     alignment and structure
>1fo5_A Thioredoxin; disulfide oxidoreductase, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; NMR {Methanocaldococcus jannaschii} SCOP: c.47.1.1 Back     alignment and structure
>2i4a_A Thioredoxin; acidophIle, disulfide exchange, oxidoreductase; 1.00A {Acetobacter aceti} Back     alignment and structure
>3die_A Thioredoxin, TRX; electron transport, SWAP domain, redox enzymology, oxidoreductase, redox-active center, transport; 1.85A {Staphylococcus aureus} SCOP: c.47.1.1 PDB: 2o7k_A 2o85_A 2o89_A 2o87_A Back     alignment and structure
>2l6c_A Thioredoxin; oxidoreductase; NMR {Desulfovibrio vulgaris} PDB: 2l6d_A Back     alignment and structure
>3emx_A Thioredoxin; structural genomics, oxidoreductase, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.25A {Aeropyrum pernix} Back     alignment and structure
>1nho_A Probable thioredoxin; beta sheet, alpha helix, oxidoreductase; NMR {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.47.1.1 Back     alignment and structure
>2trx_A Thioredoxin; electron transport; 1.68A {Escherichia coli} SCOP: c.47.1.1 PDB: 1skr_B* 1skw_B* 1sl0_B* 1sks_B* 1sl2_B* 1t7p_B* 1t8e_B* 1tk0_B* 1tk5_B* 1tk8_B* 1tkd_B* 1sl1_B* 1x9s_B* 1x9w_B* 1xoa_A 1xob_A 1zyq_B* 2ajq_B* 2bto_T* 2h6x_A ... Back     alignment and structure
>3tco_A Thioredoxin (TRXA-1); disulfide oxidoreductase, oxidoreductase; 1.90A {Sulfolobus solfataricus} SCOP: c.47.1.0 Back     alignment and structure
>2djk_A PDI, protein disulfide-isomerase; thioredoxin fold; NMR {Humicola insolens} SCOP: c.47.1.2 PDB: 2kp2_A Back     alignment and structure
>2vim_A Thioredoxin, TRX; thioredoxin fold, oxidoreductase; 1.38A {Fasciola hepatica} Back     alignment and structure
>3qfa_C Thioredoxin; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_C* Back     alignment and structure
>1x5d_A Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC7, thioredoxin like domain, redox, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1xwb_A Thioredoxin; dimerization, redox regulation, THI X-RAY electron transport; 2.20A {Drosophila melanogaster} SCOP: c.47.1.1 PDB: 1xw9_A 1xwc_A 1xwa_A Back     alignment and structure
>3gnj_A Thioredoxin domain protein; APC92103, STR genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.99A {Desulfitobacterium hafniense dcb-2} SCOP: c.47.1.0 Back     alignment and structure
>3m9j_A Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} SCOP: c.47.1.1 PDB: 3m9k_A 2hsh_A 1erv_A 2ifq_A 2ifq_B 1auc_A 1eru_A 1ert_A 3kd0_A 1aiu_A 3trx_A 4trx_A 1trs_A 1tru_A 1trv_A 1trw_A 3e3e_A* 1cqg_A 1cqh_A 1mdi_A ... Back     alignment and structure
>1gh2_A Thioredoxin-like protein; redox-active center, electron transport; 2.22A {Homo sapiens} SCOP: c.47.1.1 Back     alignment and structure
>1syr_A Thioredoxin; SGPP, structural genomics, PSI, protein structure initiative structural genomics of pathogenic protozoa consortium; 2.95A {Plasmodium falciparum} SCOP: c.47.1.1 Back     alignment and structure
>1ep7_A Thioredoxin CH1, H-type; electron transport; 2.10A {Chlamydomonas reinhardtii} SCOP: c.47.1.1 PDB: 1tof_A 1ep8_A Back     alignment and structure
>1ti3_A Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Populus tremula} SCOP: c.47.1.1 Back     alignment and structure
>2vlu_A Thioredoxin, thioredoxin H isoform 2.; oxidoreductase, thioredoxin-fold, protein disulfide reductase; 1.70A {Hordeum vulgare var} PDB: 2vlt_A 2vlv_A 2iwt_A* Back     alignment and structure
>2e0q_A Thioredoxin; electron transport; 1.49A {Sulfolobus tokodaii} PDB: 3hhv_A Back     alignment and structure
>3msz_A Glutaredoxin 1; alpha-beta sandwich, center for structural genomics of infec diseases, csgid, oxidoreductase; HET: GSH; 2.05A {Francisella tularensis subsp} PDB: 3lgc_A* Back     alignment and structure
>1wjk_A C330018D20RIK protein; glutaredoxin, thioredoxin fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 Back     alignment and structure
>2yzu_A Thioredoxin; redox protein, electron transport, structural genomics; 1.90A {Thermus thermophilus} PDB: 2cvk_A Back     alignment and structure
>2wz9_A Glutaredoxin-3; protein binding; 1.55A {Homo sapiens} PDB: 2diy_A Back     alignment and structure
>2vm1_A Thioredoxin, thioredoxin H isoform 1.; oxidoreductase, protein disulfide reductase, thioredoxin-FOL; 1.7A {Hordeum vulgare var} PDB: 2vm2_A Back     alignment and structure
>3f3q_A Thioredoxin-1; His TAG, electron transport, cytoplasm, deoxyribonucleotide synthesis, golgi apparatus, membrane, nucleus; 1.76A {Saccharomyces cerevisiae} PDB: 3f3r_A* 2i9h_A 2fa4_A 2hsy_A 3pin_A 4dss_B Back     alignment and structure
>3h79_A Thioredoxin-like protein; thioredoxin fold, catalytic cysteines missing, unknown funct; 1.50A {Trypanosoma cruzi} SCOP: c.47.1.0 Back     alignment and structure
>2j23_A Thioredoxin; immune protein, autoreactivity, cross-reactivity, IGE, fungi, epitope, allergen; 1.41A {Malassezia sympodialis} Back     alignment and structure
>1xfl_A Thioredoxin H1; AT3G51030, structural genomics, protein structure initiative, CESG, center for eukaryotic structural genomics; NMR {Arabidopsis thaliana} SCOP: c.47.1.1 Back     alignment and structure
>2dj1_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3ul3_B Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; 2.90A {Plasmodium falciparum} Back     alignment and structure
>2voc_A Thioredoxin; electron transport, homodimer, disulfide, transport, redox-active center; 1.50A {Bacillus subtilis} PDB: 2ipa_A 2gzy_A 2gzz_A Back     alignment and structure
>1kng_A Thiol:disulfide interchange protein CYCY; thioredoxin fold, cytochrome C maturation, atomic resolution oxidoreductase; 1.14A {Bradyrhizobium japonicum} SCOP: c.47.1.10 Back     alignment and structure
>2e7p_A Glutaredoxin; thioredoxin fold, poplar, electron transport; HET: GSH; 2.10A {Populus tremula x populus tremuloides} PDB: 1z7p_A 1z7r_A Back     alignment and structure
>3p2a_A Thioredoxin 2, putative thioredoxin-like protein; structural genomics, center for structural genomics of infec diseases, csgid; 2.19A {Yersinia pestis} Back     alignment and structure
>3cxg_A Putative thioredoxin; malaria, structural GEN oxidoreductase, structural genomics consortium, SGC; 2.00A {Plasmodium falciparum} Back     alignment and structure
>1v98_A Thioredoxin; oxidoreductase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.82A {Thermus thermophilus} Back     alignment and structure
>2o8v_B Thioredoxin 1; disulfide crosslinked complex, oxidoreductase; 3.00A {Escherichia coli} Back     alignment and structure
>2ppt_A Thioredoxin-2; thiredoxin, zinc finger, oxidoreductase; 1.92A {Rhodobacter capsulatus} Back     alignment and structure
>4euy_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; 2.90A {Bacillus cereus} Back     alignment and structure
>1a8l_A Protein disulfide oxidoreductase; PDI, thioredoxin fold; 1.90A {Pyrococcus furiosus} SCOP: c.47.1.2 c.47.1.2 PDB: 1j08_A Back     alignment and structure
>2l5l_A Thioredoxin; structural genomics, electron transport, PSI-2, protein STRU initiative; NMR {Bacteroides vulgatus} Back     alignment and structure
>3gv1_A Disulfide interchange protein; neisseria gonorrhoeae (strain 700825 / FA 1090), DSBC, structural genomics, unknown funct 2; 2.00A {Neisseria gonorrhoeae} Back     alignment and structure
>1mek_A Protein disulfide isomerase; electron transport, redox-active center, endoplasmic reticulum; NMR {Homo sapiens} SCOP: c.47.1.2 Back     alignment and structure
>2dml_A Protein disulfide-isomerase A6; thioredoxin domain-containing protein 7, endoplasmic reticulum, redox-active center, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1r26_A Thioredoxin; redox-active disulfide, electron transport; 1.40A {Trypanosoma} SCOP: c.47.1.1 Back     alignment and structure
>3aps_A DNAJ homolog subfamily C member 10; thioredoxin fold, CXXC motif, endoplasmic reticulum, oxidore; 1.90A {Mus musculus} Back     alignment and structure
>3l9s_A Thiol:disulfide interchange protein; thioredoxin-fold, DSBA, thiol-disulfide oxidoreductase, DISU bond, redox-active center; 1.58A {Salmonella enterica subsp} SCOP: c.47.1.13 PDB: 1a23_A 1a24_A 1a2j_A 1a2l_A 1a2m_A 1dsb_A 1fvk_A 3dks_A 1bq7_A 1fvj_A 1acv_A 1u3a_A* 1ti1_A* 2hi7_A* 2leg_A* 2zup_A* 3e9j_B* 1ac1_A 2b6m_A 2b3s_A Back     alignment and structure
>2oe3_A Thioredoxin-3; electron transport, alpha/beta sandwich, oxidized, dimer; 1.80A {Saccharomyces cerevisiae} PDB: 2oe1_A 2oe0_A Back     alignment and structure
>2lrn_A Thiol:disulfide interchange protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, oxidoreductase; NMR {Bacteroides SP} Back     alignment and structure
>1x5e_A Thioredoxin domain containing protein 1; TMX, TXNDC1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3hxs_A Thioredoxin, TRXP; electron transport; 2.00A {Bacteroides fragilis} PDB: 3hyp_A Back     alignment and structure
>1zma_A Bacterocin transport accessory protein; alpha-beta-alpha-sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.25A {Streptococcus pneumoniae} SCOP: c.47.1.1 Back     alignment and structure
>3uem_A Protein disulfide-isomerase; thioredoxin-like domain, chaper; 2.29A {Homo sapiens} PDB: 2k18_A 1x5c_A 1bjx_A 2bjx_A Back     alignment and structure
>2k8s_A Thioredoxin; dimer, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Nitrosomonas europaea} Back     alignment and structure
>1faa_A Thioredoxin F; electron transport; 1.85A {Spinacia oleracea} SCOP: c.47.1.1 Back     alignment and structure
>3hz4_A Thioredoxin; NYSGXRC, PSI-II, reduced form, protein structure initiative, structural genomics; 2.30A {Methanosarcina mazei} Back     alignment and structure
>3zzx_A Thioredoxin; oxidoreductase; 1.88A {Litopenaeus vannamei} Back     alignment and structure
>2f51_A Thioredoxin; electron transport; 1.90A {Trichomonas vaginalis} Back     alignment and structure
>3ga4_A Dolichyl-diphosphooligosaccharide-protein glycosyltransferase subunit OST6; oxidoreductase, active site loop, redox state, membrane; HET: PG4; 1.30A {Saccharomyces cerevisiae} PDB: 3g7y_A 3g9b_A* Back     alignment and structure
>1h75_A Glutaredoxin-like protein NRDH; electron transport, thioredoxin, redox protein; 1.7A {Escherichia coli} SCOP: c.47.1.1 Back     alignment and structure
>2pu9_C TRX-F, thioredoxin F-type, chloroplast; protein-protein complex, iron-sulfur, electron transport; 1.65A {Spinacia oleracea} PDB: 2pvo_C 1f9m_A Back     alignment and structure
>3fkf_A Thiol-disulfide oxidoreductase; structural genomics, PSI-2, structure initiative, midwest center for structural genomic oxidoreductase; 2.20A {Bacteroides fragilis} Back     alignment and structure
>3tdg_A DSBG, putative uncharacterized protein; thioredoxin fold, reductase, oxidoreductase; HET: P6G; 2.10A {Helicobacter pylori} Back     alignment and structure
>1a8l_A Protein disulfide oxidoreductase; PDI, thioredoxin fold; 1.90A {Pyrococcus furiosus} SCOP: c.47.1.2 c.47.1.2 PDB: 1j08_A Back     alignment and structure
>3d22_A TRXH4, thioredoxin H-type; electron transport, cytoplasm, redox-active center, transport, oxidoreductase; 1.60A {Populus trichocarpa x populusdeltoides} PDB: 3d21_A Back     alignment and structure
>2yj7_A LPBCA thioredoxin; oxidoreductase; 1.65A {Synthetic construct} Back     alignment and structure
>1v58_A Thiol:disulfide interchange protein DSBG; reduced DSBG, redox protein, protein disulfide isomerase, thioredoxin fold; 1.70A {Escherichia coli} SCOP: c.47.1.9 d.17.3.1 PDB: 1v57_A 2h0i_A 2h0h_A 2h0g_A 2iy2_A Back     alignment and structure
>2rem_A Disulfide oxidoreductase; disulfide oxidoreductase, DSBA, thioredoxin fold, redox- active center; 1.90A {Xylella fastidiosa} Back     alignment and structure
>3raz_A Thioredoxin-related protein; structural genomics, PSI-2, protein structure initiative; 2.00A {Neisseria meningitidis serogroup B} Back     alignment and structure
>3ha9_A Uncharacterized thioredoxin-like protein; PSI, MCSG, structural G midwest center for structural genomics, protein structure initiative; 1.70A {Aeropyrum pernix} Back     alignment and structure
>1lu4_A Soluble secreted antigen MPT53; thioredoxin-like fold, structural genomics, PSI, protein structure initiative; 1.12A {Mycobacterium tuberculosis} SCOP: c.47.1.10 Back     alignment and structure
>2es7_A Q8ZP25_salty, putative thiol-disulfide isomerase and thioredoxi; structural genomics, PSI, protein structure initiative; 2.80A {Salmonella typhimurium} SCOP: c.47.1.20 PDB: 2gzp_A 2jzt_A Back     alignment and structure
>2dj3_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3ipz_A Monothiol glutaredoxin-S14, chloroplastic; electron transport, PL redox-active center, transit peptide, transport, oxidoreduc; 2.40A {Arabidopsis thaliana} PDB: 2lku_A Back     alignment and structure
>2fgx_A Putative thioredoxin; NET3, NESG, GFT-glutaredoxin-like, structural genomics, PSI, protein structure initiative; NMR {Nitrosomonas europaea} Back     alignment and structure
>1r7h_A NRDH-redoxin; thioredoxin, glutaredoxin, redox protein, domain swapping, electron transport; 2.69A {Corynebacterium ammoniagenes} SCOP: c.47.1.1 Back     alignment and structure
>3ia1_A THIO-disulfide isomerase/thioredoxin; oxidoreductase, PSI-2, NYSGXRC, structu genomics, protein structure initiative; 1.76A {Thermus thermophilus} Back     alignment and structure
>2lja_A Putative thiol-disulfide oxidoreductase; structural genomics, unknown function, thioredoxin-like; NMR {Bacteroides vulgatus} Back     alignment and structure
>2ju5_A Thioredoxin disulfide isomerase; protein, oxidoreductase; NMR {Chlamydophila pneumoniae} Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Back     alignment and structure
>2dj0_A Thioredoxin-related transmembrane protein 2; AVLA237, CGI-31 protein, TXNDC14, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1zzo_A RV1677; thioredoxin fold, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 1.60A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 3ios_A Back     alignment and structure
>1aba_A Glutaredoxin; electron transport; HET: MES; 1.45A {Enterobacteria phage T4} SCOP: c.47.1.1 PDB: 1aaz_A 1de1_A 1de2_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query126
d1thxa_108 Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} 91.53
d1xwaa_111 Thioredoxin {Fruit fly (Drosophila melanogaster) [ 91.0
d1v58a1169 Thiol:disulfide interchange protein DsbG, C-termin 90.27
d1a8la2107 Protein disulfide isomerase, PDI {Archaeon Pyrococ 89.78
d1dbya_107 Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305 89.43
d1xfla_114 Thioredoxin {Thale cress (Arabidopsis thaliana) [T 87.5
d1wjka_100 Thioredoxin-like structure containing protein C330 87.22
d1hyua496 Alkyl hydroperoxide reductase subunit F (AhpF), N- 86.97
d1fb6a_104 Thioredoxin {Spinach (Spinacia oleracea), thioredo 86.87
d2es7a1119 Hydrogenase-1 operon protein HyaE {Salmonella typh 86.62
d1nw2a_105 Thioredoxin {Alicyclobacillus acidocaldarius, form 86.57
d2hfda1132 Hydrogenase-1 operon protein HyaE {Escherichia col 85.61
d1ti3a_113 Thioredoxin {European aspen (Populus tremula), thi 85.14
d1zmaa1115 Bacterocin transport accessory protein Bta {Strept 83.93
d1gh2a_107 Thioredoxin-like protein, N-terminal domain {Human 83.24
d1abaa_87 Glutaredoxin (Grx, thioltransferase) {Bacteriophag 83.19
d2ifqa1105 Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} 83.13
d2b5ea4119 Protein disulfide isomerase, PDI {Baker's yeast (S 82.69
d1eeja1156 Disulfide bond isomerase, DsbC, C-terminal domain 82.64
d1nhoa_85 MTH807, thioredoxin/glutaredoxin-like protein {Arc 81.96
>d1thxa_ c.47.1.1 (A:) Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Thioredoxin fold
superfamily: Thioredoxin-like
family: Thioltransferase
domain: Thioredoxin
species: Anabaena sp., pcc 7120 [TaxId: 1167]

Probab=91.53  E-value=0.4  Score=29.90  Aligned_cols=60  Identities=10%  Similarity=0.271  Sum_probs=45.1

Q ss_pred             EEEEeCCCcchHHHHHHHHHh--CCCCcEEEEeccchhHHHHHHhcCCCccCCcEEEEEECCch
Q 033158           57 IMLYDGVCNLCNGGVKFVRDN--DKNRRIRYEALQSESGKKLLRRSGRAPDDISSVVLVEKDRY  118 (126)
Q Consensus        57 iV~FDG~C~LC~~~V~fl~r~--Dr~~~~~F~~lQS~~g~~lL~~~Gl~~e~~dsvllv~~Gr~  118 (126)
                      +.||--.|+-|......+.+.  ...+++.|+.+..+....+.+++++.  .+=+++++.+|+.
T Consensus        25 v~f~a~wC~~C~~~~~~~~~~~~~~~~~~~~~~vd~d~~~~l~~~~~I~--~~Pt~~~~~~g~~   86 (108)
T d1thxa_          25 VYFWASWCGPCQLMSPLINLAANTYSDRLKVVKLEIDPNPTTVKKYKVE--GVPALRLVKGEQI   86 (108)
T ss_dssp             EEEECTTCTTHHHHHHHHHHHHHHTTTTCEEEEEESTTCHHHHHHTTCC--SSSEEEEEETTEE
T ss_pred             EEEECCCCCCccccchHHHHHHHhcCCcceeceecccccHHHHHHhccc--CCCEEEEEECCEE
Confidence            457999999999998888554  34567888888777677788898874  3447877777764
>d1xwaa_ c.47.1.1 (A:) Thioredoxin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1v58a1 c.47.1.9 (A:62-230) Thiol:disulfide interchange protein DsbG, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a8la2 c.47.1.2 (A:120-226) Protein disulfide isomerase, PDI {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1dbya_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} Back     information, alignment and structure
>d1xfla_ c.47.1.1 (A:) Thioredoxin {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wjka_ c.47.1.1 (A:) Thioredoxin-like structure containing protein C330018D20Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hyua4 c.47.1.2 (A:103-198) Alkyl hydroperoxide reductase subunit F (AhpF), N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1fb6a_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin M [TaxId: 3562]} Back     information, alignment and structure
>d2es7a1 c.47.1.20 (A:7-125) Hydrogenase-1 operon protein HyaE {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1nw2a_ c.47.1.1 (A:) Thioredoxin {Alicyclobacillus acidocaldarius, formerly Bacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d2hfda1 c.47.1.20 (A:1-132) Hydrogenase-1 operon protein HyaE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ti3a_ c.47.1.1 (A:) Thioredoxin {European aspen (Populus tremula), thioredoxin H [TaxId: 113636]} Back     information, alignment and structure
>d1zmaa1 c.47.1.1 (A:1-115) Bacterocin transport accessory protein Bta {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1gh2a_ c.47.1.1 (A:) Thioredoxin-like protein, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1abaa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2ifqa1 c.47.1.1 (A:1-105) Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b5ea4 c.47.1.2 (A:23-141) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1eeja1 c.47.1.9 (A:61-216) Disulfide bond isomerase, DsbC, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nhoa_ c.47.1.1 (A:) MTH807, thioredoxin/glutaredoxin-like protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure