Citrus Sinensis ID: 033165
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 126 | ||||||
| 449459550 | 243 | PREDICTED: putative glutamine amidotrans | 0.825 | 0.427 | 0.75 | 5e-41 | |
| 356521239 | 245 | PREDICTED: putative glutamine amidotrans | 0.801 | 0.412 | 0.752 | 6e-41 | |
| 296088793 | 299 | unnamed protein product [Vitis vinifera] | 0.825 | 0.347 | 0.730 | 2e-40 | |
| 449521611 | 243 | PREDICTED: LOW QUALITY PROTEIN: putative | 0.825 | 0.427 | 0.740 | 3e-40 | |
| 225464061 | 246 | PREDICTED: putative glutamine amidotrans | 0.825 | 0.422 | 0.730 | 4e-40 | |
| 356524794 | 244 | PREDICTED: putative glutamine amidotrans | 0.825 | 0.426 | 0.730 | 9e-40 | |
| 255584025 | 243 | GMP synthase, putative [Ricinus communis | 0.841 | 0.436 | 0.820 | 1e-37 | |
| 357476183 | 261 | GMP synthase [Medicago truncatula] gi|35 | 0.833 | 0.402 | 0.728 | 6e-37 | |
| 357492799 | 245 | GMP synthase [Medicago truncatula] gi|35 | 0.825 | 0.424 | 0.634 | 4e-35 | |
| 224103849 | 241 | predicted protein [Populus trichocarpa] | 0.825 | 0.431 | 0.788 | 1e-34 |
| >gi|449459550|ref|XP_004147509.1| PREDICTED: putative glutamine amidotransferase YLR126C-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Score = 172 bits (435), Expect = 5e-41, Method: Compositional matrix adjust.
Identities = 78/104 (75%), Positives = 89/104 (85%)
Query: 1 MGGKKFAVLLCAEDSEYVKKKYGGYFGVFVRMLAEEGETWDVFHVARGEFPDDDDFGSYD 60
MG K+FA+LLCAEDSEYVK KYGGYFGVFVRML EEGE WD F VA GEFP DD YD
Sbjct: 1 MGMKRFALLLCAEDSEYVKMKYGGYFGVFVRMLGEEGEAWDRFRVAAGEFPADDQIADYD 60
Query: 61 GYVITGSCNDAHGNDVWICKLIALLKQLDSLRKKVLGICFGHQV 104
G+VI+GSCNDAHG+D WIC+LIALL++L SL K++LGICFGHQ+
Sbjct: 61 GFVISGSCNDAHGDDPWICRLIALLQRLASLNKRILGICFGHQI 104
|
Source: Cucumis sativus Species: Cucumis sativus Genus: Cucumis Family: Cucurbitaceae Order: Cucurbitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|356521239|ref|XP_003529264.1| PREDICTED: putative glutamine amidotransferase YLR126C-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|296088793|emb|CBI38243.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449521611|ref|XP_004167823.1| PREDICTED: LOW QUALITY PROTEIN: putative glutamine amidotransferase YLR126C-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|225464061|ref|XP_002269193.1| PREDICTED: putative glutamine amidotransferase YLR126C [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356524794|ref|XP_003531013.1| PREDICTED: putative glutamine amidotransferase YLR126C-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|255584025|ref|XP_002532757.1| GMP synthase, putative [Ricinus communis] gi|223527486|gb|EEF29614.1| GMP synthase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|357476183|ref|XP_003608377.1| GMP synthase [Medicago truncatula] gi|355509432|gb|AES90574.1| GMP synthase [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|357492799|ref|XP_003616688.1| GMP synthase [Medicago truncatula] gi|355518023|gb|AES99646.1| GMP synthase [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|224103849|ref|XP_002313218.1| predicted protein [Populus trichocarpa] gi|222849626|gb|EEE87173.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 126 | ||||||
| TAIR|locus:2061496 | 251 | AT2G23970 [Arabidopsis thalian | 0.801 | 0.402 | 0.603 | 2e-31 | |
| TAIR|locus:2118831 | 249 | GGP3 "AT4G30550" [Arabidopsis | 0.801 | 0.405 | 0.574 | 3.4e-29 | |
| TAIR|locus:2118821 | 250 | GGP1 "AT4G30530" [Arabidopsis | 0.817 | 0.412 | 0.553 | 5.6e-29 | |
| TAIR|locus:2061481 | 251 | AT2G23960 [Arabidopsis thalian | 0.817 | 0.410 | 0.533 | 3.5e-27 | |
| TAIR|locus:2118826 | 248 | AT4G30540 "AT4G30540" [Arabido | 0.801 | 0.407 | 0.504 | 1.2e-26 | |
| ASPGD|ASPL0000041723 | 284 | AN8975 [Emericella nidulans (t | 0.547 | 0.242 | 0.493 | 1.3e-11 | |
| TIGR_CMR|SPO_1301 | 226 | SPO_1301 "glutamine amidotrans | 0.793 | 0.442 | 0.323 | 2.2e-11 | |
| SGD|S000004116 | 251 | YLR126C "Putative glutamine am | 0.857 | 0.430 | 0.349 | 3.3e-11 | |
| UNIPROTKB|Q884M5 | 242 | PSPTO_2063 "Uncharacterized pr | 0.682 | 0.355 | 0.366 | 3.5e-11 | |
| ASPGD|ASPL0000054958 | 252 | AN0200 [Emericella nidulans (t | 0.833 | 0.416 | 0.35 | 6.8e-10 |
| TAIR|locus:2061496 AT2G23970 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 345 (126.5 bits), Expect = 2.0e-31, P = 2.0e-31
Identities = 61/101 (60%), Positives = 75/101 (74%)
Query: 4 KKFAVLLCAEDSEYVKKKYGGYFGVFVRMLAEEGETWDVFHVARGEFPDDDDFGSYDGYV 63
K+FA+ L DS +VKK YGGYF VFV E+GE WD+F V GEFPDD D YDG+V
Sbjct: 6 KRFALFLATSDSTFVKKAYGGYFNVFVSTFGEDGEQWDLFRVIDGEFPDDKDLDKYDGFV 65
Query: 64 ITGSCNDAHGNDVWICKLIALLKQLDSLRKKVLGICFGHQV 104
I+GS NDA G+D WI KL +L ++LD ++KKVLGICFGHQ+
Sbjct: 66 ISGSLNDAFGDDDWIVKLCSLCQKLDDMKKKVLGICFGHQI 106
|
|
| TAIR|locus:2118831 GGP3 "AT4G30550" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2118821 GGP1 "AT4G30530" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2061481 AT2G23960 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2118826 AT4G30540 "AT4G30540" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| ASPGD|ASPL0000041723 AN8975 [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|SPO_1301 SPO_1301 "glutamine amidotransferase, class I" [Ruegeria pomeroyi DSS-3 (taxid:246200)] | Back alignment and assigned GO terms |
|---|
| SGD|S000004116 YLR126C "Putative glutamine amidotransferase" [Saccharomyces cerevisiae (taxid:4932)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q884M5 PSPTO_2063 "Uncharacterized protein" [Pseudomonas syringae pv. tomato str. DC3000 (taxid:223283)] | Back alignment and assigned GO terms |
|---|
| ASPGD|ASPL0000054958 AN0200 [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 126 | |||
| cd01741 | 188 | cd01741, GATase1_1, Subgroup of proteins having th | 3e-18 | |
| PRK05665 | 240 | PRK05665, PRK05665, amidotransferase; Provisional | 1e-17 | |
| COG0518 | 198 | COG0518, GuaA, GMP synthase - Glutamine amidotrans | 7e-11 | |
| cd01653 | 115 | cd01653, GATase1, Type 1 glutamine amidotransferas | 3e-10 | |
| cd03128 | 92 | cd03128, GAT_1, Type 1 glutamine amidotransferase | 1e-09 | |
| PRK09065 | 237 | PRK09065, PRK09065, glutamine amidotransferase; Pr | 0.001 |
| >gnl|CDD|153212 cd01741, GATase1_1, Subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain | Back alignment and domain information |
|---|
Score = 75.7 bits (187), Expect = 3e-18
Identities = 33/101 (32%), Positives = 42/101 (41%), Gaps = 9/101 (8%)
Query: 5 KFAVLLCAEDSEYVKKKYGGYFGVFVRMLAEEGETWDVFHVARGEFPDDDDFGSYDGYVI 64
+ +L G F +R E DV V GE D D YDG VI
Sbjct: 1 RILILQHDTPEG------PGLFEDLLREAGAETIEIDVVDVYAGELLPDLD--DYDGLVI 52
Query: 65 TGSCNDAHGNDV-WICKLIALLKQLDSLRKKVLGICFGHQV 104
G +D W+ KL L++Q + K VLGIC GHQ+
Sbjct: 53 LGGPMSVDEDDYPWLKKLKELIRQALAAGKPVLGICLGHQL 93
|
This group contains a subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain. GATase activity catalyses the transfer of ammonia from the amide side chain of glutamine to an acceptor substrate. Glutamine amidotransferases (GATase) includes the triad family of amidotransferases which have a conserved Cys-His-Glu catalytic triad in the glutaminase active site. In this subgroup this triad is conserved. GATase activity can be found in a range of biosynthetic enzymes, including: glutamine amidotransferase, formylglycinamide ribonucleotide, GMP synthetase , anthranilate synthase component II, glutamine-dependent carbamoyl phosphate synthase, cytidine triphosphate synthetase, gamma-glutamyl hydrolase, imidazole glycerol phosphate synthase and, cobyric acid synthase. Glutamine amidotransferase (GATase) domains can occur either as single polypeptides, as in glutamine amidotransferases, or as domains in a much larger multifunctional synthase protein, such as CPSase. Length = 188 |
| >gnl|CDD|168162 PRK05665, PRK05665, amidotransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223592 COG0518, GuaA, GMP synthase - Glutamine amidotransferase domain [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|153210 cd01653, GATase1, Type 1 glutamine amidotransferase (GATase1)-like domain | Back alignment and domain information |
|---|
| >gnl|CDD|153222 cd03128, GAT_1, Type 1 glutamine amidotransferase (GATase1)-like domain | Back alignment and domain information |
|---|
| >gnl|CDD|181635 PRK09065, PRK09065, glutamine amidotransferase; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 126 | |||
| PRK05665 | 240 | amidotransferase; Provisional | 99.97 | |
| KOG3179 | 245 | consensus Predicted glutamine synthetase [Nucleoti | 99.96 | |
| PRK09065 | 237 | glutamine amidotransferase; Provisional | 99.96 | |
| PRK06490 | 239 | glutamine amidotransferase; Provisional | 99.93 | |
| PRK07053 | 234 | glutamine amidotransferase; Provisional | 99.91 | |
| COG0518 | 198 | GuaA GMP synthase - Glutamine amidotransferase dom | 99.89 | |
| PRK07567 | 242 | glutamine amidotransferase; Provisional | 99.89 | |
| COG0512 | 191 | PabA Anthranilate/para-aminobenzoate synthases com | 99.88 | |
| PRK06895 | 190 | putative anthranilate synthase component II; Provi | 99.87 | |
| PRK08250 | 235 | glutamine amidotransferase; Provisional | 99.87 | |
| cd01741 | 188 | GATase1_1 Subgroup of proteins having the Type 1 g | 99.85 | |
| PRK08007 | 187 | para-aminobenzoate synthase component II; Provisio | 99.84 | |
| PRK06774 | 191 | para-aminobenzoate synthase component II; Provisio | 99.83 | |
| PRK07649 | 195 | para-aminobenzoate/anthranilate synthase glutamine | 99.82 | |
| PF00117 | 192 | GATase: Glutamine amidotransferase class-I; InterP | 99.82 | |
| PRK08857 | 193 | para-aminobenzoate synthase component II; Provisio | 99.81 | |
| PRK07765 | 214 | para-aminobenzoate synthase component II; Provisio | 99.81 | |
| PRK05637 | 208 | anthranilate synthase component II; Provisional | 99.81 | |
| PRK05670 | 189 | anthranilate synthase component II; Provisional | 99.81 | |
| TIGR00566 | 188 | trpG_papA glutamine amidotransferase of anthranila | 99.81 | |
| CHL00101 | 190 | trpG anthranilate synthase component 2 | 99.8 | |
| cd01743 | 184 | GATase1_Anthranilate_Synthase Type 1 glutamine ami | 99.8 | |
| PLN02335 | 222 | anthranilate synthase | 99.78 | |
| cd01742 | 181 | GATase1_GMP_Synthase Type 1 glutamine amidotransfe | 99.76 | |
| PRK13527 | 200 | glutamine amidotransferase subunit PdxT; Provision | 99.76 | |
| PRK09522 | 531 | bifunctional glutamine amidotransferase/anthranila | 99.75 | |
| TIGR00888 | 188 | guaA_Nterm GMP synthase (glutamine-hydrolyzing), N | 99.75 | |
| PRK00758 | 184 | GMP synthase subunit A; Validated | 99.75 | |
| PLN02889 | 918 | oxo-acid-lyase/anthranilate synthase | 99.74 | |
| cd01744 | 178 | GATase1_CPSase Small chain of the glutamine-depend | 99.72 | |
| PLN02347 | 536 | GMP synthetase | 99.71 | |
| TIGR01823 | 742 | PabB-fungal aminodeoxychorismate synthase, fungal | 99.71 | |
| PRK05368 | 302 | homoserine O-succinyltransferase; Provisional | 99.7 | |
| PRK13525 | 189 | glutamine amidotransferase subunit PdxT; Provision | 99.69 | |
| TIGR01815 | 717 | TrpE-clade3 anthranilate synthase, alpha proteobac | 99.69 | |
| PRK13566 | 720 | anthranilate synthase; Provisional | 99.68 | |
| cd01745 | 189 | GATase1_2 Subgroup of proteins having the Type 1 g | 99.68 | |
| PRK00074 | 511 | guaA GMP synthase; Reviewed | 99.68 | |
| CHL00197 | 382 | carA carbamoyl-phosphate synthase arginine-specifi | 99.67 | |
| PRK14607 | 534 | bifunctional glutamine amidotransferase/anthranila | 99.66 | |
| PRK13143 | 200 | hisH imidazole glycerol phosphate synthase subunit | 99.65 | |
| cd01746 | 235 | GATase1_CTP_Synthase Type 1 glutamine amidotransfe | 99.64 | |
| PRK12564 | 360 | carbamoyl phosphate synthase small subunit; Review | 99.64 | |
| TIGR03800 | 184 | PLP_synth_Pdx2 pyridoxal 5'-phosphate synthase, gl | 99.62 | |
| PRK12838 | 354 | carbamoyl phosphate synthase small subunit; Review | 99.62 | |
| cd01748 | 198 | GATase1_IGP_Synthase Type 1 glutamine amidotransfe | 99.62 | |
| PRK13146 | 209 | hisH imidazole glycerol phosphate synthase subunit | 99.62 | |
| TIGR01368 | 358 | CPSaseIIsmall carbamoyl-phosphate synthase, small | 99.61 | |
| PLN02771 | 415 | carbamoyl-phosphate synthase (glutamine-hydrolyzin | 99.6 | |
| PRK13141 | 205 | hisH imidazole glycerol phosphate synthase subunit | 99.59 | |
| COG0505 | 368 | CarA Carbamoylphosphate synthase small subunit [Am | 99.58 | |
| PRK11366 | 254 | puuD gamma-glutamyl-gamma-aminobutyrate hydrolase; | 99.58 | |
| cd01749 | 183 | GATase1_PB Glutamine Amidotransferase (GATase_I) i | 99.56 | |
| PRK13181 | 199 | hisH imidazole glycerol phosphate synthase subunit | 99.55 | |
| PRK13170 | 196 | hisH imidazole glycerol phosphate synthase subunit | 99.55 | |
| PRK01175 | 261 | phosphoribosylformylglycinamidine synthase I; Prov | 99.55 | |
| CHL00188 | 210 | hisH imidazole glycerol phosphate synthase subunit | 99.53 | |
| TIGR01855 | 196 | IMP_synth_hisH imidazole glycerol phosphate syntha | 99.52 | |
| COG0118 | 204 | HisH Glutamine amidotransferase [Amino acid transp | 99.5 | |
| PLN02832 | 248 | glutamine amidotransferase subunit of pyridoxal 5' | 99.47 | |
| KOG0026 | 223 | consensus Anthranilate synthase, beta chain [Amino | 99.47 | |
| TIGR01737 | 227 | FGAM_synth_I phosphoribosylformylglycinamidine syn | 99.46 | |
| cd01747 | 273 | GATase1_Glutamyl_Hydrolase Type 1 glutamine amidot | 99.45 | |
| PRK05380 | 533 | pyrG CTP synthetase; Validated | 99.43 | |
| PRK13152 | 201 | hisH imidazole glycerol phosphate synthase subunit | 99.43 | |
| cd03131 | 175 | GATase1_HTS Type 1 glutamine amidotransferase (GAT | 99.42 | |
| cd01740 | 238 | GATase1_FGAR_AT Type 1 glutamine amidotransferase | 99.42 | |
| KOG1622 | 552 | consensus GMP synthase [Nucleotide transport and m | 99.42 | |
| COG0047 | 231 | PurL Phosphoribosylformylglycinamidine (FGAM) synt | 99.4 | |
| PRK03619 | 219 | phosphoribosylformylglycinamidine synthase I; Prov | 99.39 | |
| PRK13526 | 179 | glutamine amidotransferase subunit PdxT; Provision | 99.38 | |
| PRK06186 | 229 | hypothetical protein; Validated | 99.38 | |
| PLN02617 | 538 | imidazole glycerol phosphate synthase hisHF | 99.36 | |
| PRK13142 | 192 | hisH imidazole glycerol phosphate synthase subunit | 99.36 | |
| KOG1224 | 767 | consensus Para-aminobenzoate (PABA) synthase ABZ1 | 99.35 | |
| COG2071 | 243 | Predicted glutamine amidotransferases [General fun | 99.35 | |
| PRK14004 | 210 | hisH imidazole glycerol phosphate synthase subunit | 99.33 | |
| KOG0370 | 1435 | consensus Multifunctional pyrimidine synthesis pro | 99.32 | |
| TIGR00337 | 525 | PyrG CTP synthase. CTP synthase is involved in pyr | 99.3 | |
| cd01750 | 194 | GATase1_CobQ Type 1 glutamine amidotransferase (GA | 99.3 | |
| PF07722 | 217 | Peptidase_C26: Peptidase C26; InterPro: IPR011697 | 99.26 | |
| PLN02327 | 557 | CTP synthase | 99.22 | |
| cd03130 | 198 | GATase1_CobB Type 1 glutamine amidotransferase (GA | 99.21 | |
| PF13507 | 259 | GATase_5: CobB/CobQ-like glutamine amidotransferas | 99.03 | |
| PRK00784 | 488 | cobyric acid synthase; Provisional | 99.02 | |
| PRK11780 | 217 | isoprenoid biosynthesis protein with amidotransfer | 98.98 | |
| COG0504 | 533 | PyrG CTP synthase (UTP-ammonia lyase) [Nucleotide | 98.95 | |
| PRK06278 | 476 | cobyrinic acid a,c-diamide synthase; Validated | 98.93 | |
| cd03146 | 212 | GAT1_Peptidase_E Type 1 glutamine amidotransferase | 98.89 | |
| cd01653 | 115 | GATase1 Type 1 glutamine amidotransferase (GATase1 | 98.88 | |
| PF04204 | 298 | HTS: Homoserine O-succinyltransferase ; InterPro: | 98.85 | |
| PRK01077 | 451 | cobyrinic acid a,c-diamide synthase; Validated | 98.85 | |
| TIGR00379 | 449 | cobB cobyrinic acid a,c-diamide synthase. This mod | 98.81 | |
| TIGR01857 | 1239 | FGAM-synthase phosphoribosylformylglycinamidine sy | 98.8 | |
| TIGR01001 | 300 | metA homoserine O-succinyltransferase. The apparen | 98.8 | |
| COG0311 | 194 | PDX2 Predicted glutamine amidotransferase involved | 98.8 | |
| PLN03206 | 1307 | phosphoribosylformylglycinamidine synthase; Provis | 98.79 | |
| TIGR01735 | 1310 | FGAM_synt phosphoribosylformylglycinamidine syntha | 98.78 | |
| PRK05297 | 1290 | phosphoribosylformylglycinamidine synthase; Provis | 98.75 | |
| cd03169 | 180 | GATase1_PfpI_1 Type 1 glutamine amidotransferase ( | 98.73 | |
| PF07685 | 158 | GATase_3: CobB/CobQ-like glutamine amidotransferas | 98.73 | |
| cd03128 | 92 | GAT_1 Type 1 glutamine amidotransferase (GATase1)- | 98.7 | |
| TIGR00313 | 475 | cobQ cobyric acid synthase CobQ. | 98.7 | |
| cd03134 | 165 | GATase1_PfpI_like A type 1 glutamine amidotransfer | 98.68 | |
| cd03147 | 231 | GATase1_Ydr533c_like Type 1 glutamine amidotransfe | 98.67 | |
| TIGR01382 | 166 | PfpI intracellular protease, PfpI family. The memb | 98.66 | |
| PRK13896 | 433 | cobyrinic acid a,c-diamide synthase; Provisional | 98.66 | |
| COG0693 | 188 | ThiJ Putative intracellular protease/amidase [Gene | 98.64 | |
| cd03133 | 213 | GATase1_ES1 Type 1 glutamine amidotransferase (GAT | 98.63 | |
| KOG2387 | 585 | consensus CTP synthase (UTP-ammonia lyase) [Nucleo | 98.62 | |
| PF01174 | 188 | SNO: SNO glutamine amidotransferase family; InterP | 98.61 | |
| cd03132 | 142 | GATase1_catalase Type 1 glutamine amidotransferase | 98.59 | |
| PRK04155 | 287 | chaperone protein HchA; Provisional | 98.58 | |
| TIGR01739 | 1202 | tegu_FGAM_synt herpesvirus tegument protein/v-FGAM | 98.55 | |
| PHA03366 | 1304 | FGAM-synthase; Provisional | 98.47 | |
| PRK11574 | 196 | oxidative-stress-resistance chaperone; Provisional | 98.41 | |
| COG1492 | 486 | CobQ Cobyric acid synthase [Coenzyme metabolism] | 98.4 | |
| cd03144 | 114 | GATase1_ScBLP_like Type 1 glutamine amidotransfera | 98.28 | |
| PRK05282 | 233 | (alpha)-aspartyl dipeptidase; Validated | 98.28 | |
| KOG0623 | 541 | consensus Glutamine amidotransferase/cyclase [Amin | 98.27 | |
| cd03140 | 170 | GATase1_PfpI_3 Type 1 glutamine amidotransferase ( | 98.26 | |
| cd03137 | 187 | GATase1_AraC_1 AraC transcriptional regulators hav | 98.24 | |
| cd03135 | 163 | GATase1_DJ-1 Type 1 glutamine amidotransferase (GA | 98.22 | |
| TIGR01383 | 179 | not_thiJ DJ-1 family protein. This model represent | 98.14 | |
| cd03148 | 232 | GATase1_EcHsp31_like Type 1 glutamine amidotransfe | 98.13 | |
| PF01965 | 147 | DJ-1_PfpI: DJ-1/PfpI family; InterPro: IPR002818 T | 98.1 | |
| COG3442 | 250 | Predicted glutamine amidotransferase [General func | 98.09 | |
| PRK11249 | 752 | katE hydroperoxidase II; Provisional | 98.05 | |
| COG1897 | 307 | MetA Homoserine trans-succinylase [Amino acid tran | 98.03 | |
| KOG3210 | 226 | consensus Imidazoleglycerol-phosphate synthase sub | 98.0 | |
| cd03138 | 195 | GATase1_AraC_2 AraC transcriptional regulators hav | 97.97 | |
| cd03141 | 221 | GATase1_Hsp31_like Type 1 glutamine amidotransfera | 97.95 | |
| PRK09393 | 322 | ftrA transcriptional activator FtrA; Provisional | 97.94 | |
| cd03139 | 183 | GATase1_PfpI_2 Type 1 glutamine amidotransferase ( | 97.9 | |
| cd03129 | 210 | GAT1_Peptidase_E_like Type 1 glutamine amidotransf | 97.83 | |
| cd03136 | 185 | GATase1_AraC_ArgR_like AraC transcriptional regula | 97.63 | |
| COG1797 | 451 | CobB Cobyrinic acid a,c-diamide synthase [Coenzyme | 97.61 | |
| PF13278 | 166 | DUF4066: Putative amidotransferase; PDB: 3BHN_A 3M | 97.56 | |
| KOG2764 | 247 | consensus Putative transcriptional regulator DJ-1 | 97.39 | |
| COG3340 | 224 | PepE Peptidase E [Amino acid transport and metabol | 97.16 | |
| KOG1907 | 1320 | consensus Phosphoribosylformylglycinamidine syntha | 97.1 | |
| PF09825 | 367 | BPL_N: Biotin-protein ligase, N terminal; InterPro | 97.02 | |
| TIGR02069 | 250 | cyanophycinase cyanophycinase. This model describe | 96.84 | |
| cd03145 | 217 | GAT1_cyanophycinase Type 1 glutamine amidotransfer | 96.64 | |
| COG3155 | 217 | ElbB Uncharacterized protein involved in an early | 96.62 | |
| PRK03372 | 306 | ppnK inorganic polyphosphate/ATP-NAD kinase; Provi | 96.5 | |
| PF03575 | 154 | Peptidase_S51: Peptidase family S51; InterPro: IPR | 96.37 | |
| PRK02645 | 305 | ppnK inorganic polyphosphate/ATP-NAD kinase; Provi | 96.36 | |
| KOG1559 | 340 | consensus Gamma-glutamyl hydrolase [Coenzyme trans | 96.27 | |
| COG4635 | 175 | HemG Flavodoxin [Energy production and conversion | 95.61 | |
| PRK11104 | 177 | hemG protoporphyrinogen oxidase; Provisional | 95.57 | |
| PRK03378 | 292 | ppnK inorganic polyphosphate/ATP-NAD kinase; Provi | 95.5 | |
| PRK02155 | 291 | ppnK NAD(+)/NADH kinase family protein; Provisiona | 95.11 | |
| PRK02649 | 305 | ppnK inorganic polyphosphate/ATP-NAD kinase; Provi | 95.01 | |
| COG4090 | 154 | Uncharacterized protein conserved in archaea [Func | 94.99 | |
| PRK06756 | 148 | flavodoxin; Provisional | 94.92 | |
| PRK01231 | 295 | ppnK inorganic polyphosphate/ATP-NAD kinase; Provi | 94.89 | |
| PRK01911 | 292 | ppnK inorganic polyphosphate/ATP-NAD kinase; Provi | 94.8 | |
| COG4977 | 328 | Transcriptional regulator containing an amidase do | 94.74 | |
| PRK03708 | 277 | ppnK inorganic polyphosphate/ATP-NAD kinase; Provi | 94.71 | |
| PRK14077 | 287 | pnk inorganic polyphosphate/ATP-NAD kinase; Provis | 94.5 | |
| PRK04539 | 296 | ppnK inorganic polyphosphate/ATP-NAD kinase; Provi | 94.45 | |
| TIGR02667 | 163 | moaB_proteo molybdenum cofactor biosynthesis prote | 94.15 | |
| PF06283 | 217 | ThuA: Trehalose utilisation; PDB: 4E5V_A 1T0B_A. | 93.96 | |
| PF00885 | 144 | DMRL_synthase: 6,7-dimethyl-8-ribityllumazine synt | 93.78 | |
| PRK01215 | 264 | competence damage-inducible protein A; Provisional | 93.67 | |
| PRK09271 | 160 | flavodoxin; Provisional | 93.54 | |
| COG4285 | 253 | Uncharacterized conserved protein [Function unknow | 93.34 | |
| PRK06703 | 151 | flavodoxin; Provisional | 93.01 | |
| PLN02929 | 301 | NADH kinase | 92.99 | |
| cd00886 | 152 | MogA_MoaB MogA_MoaB family. Members of this family | 92.76 | |
| PF03698 | 80 | UPF0180: Uncharacterised protein family (UPF0180); | 92.48 | |
| PRK14076 | 569 | pnk inorganic polyphosphate/ATP-NAD kinase; Provis | 92.39 | |
| PRK14569 | 296 | D-alanyl-alanine synthetase A; Provisional | 91.53 | |
| PRK03767 | 200 | NAD(P)H:quinone oxidoreductase; Provisional | 91.5 | |
| PRK05569 | 141 | flavodoxin; Provisional | 91.5 | |
| cd03142 | 215 | GATase1_ThuA Type 1 glutamine amidotransferase (GA | 91.13 | |
| PRK07308 | 146 | flavodoxin; Validated | 90.99 | |
| TIGR00853 | 95 | pts-lac PTS system, lactose/cellobiose family IIB | 90.86 | |
| PRK09417 | 193 | mogA molybdenum cofactor biosynthesis protein MogA | 90.7 | |
| PF09897 | 147 | DUF2124: Uncharacterized protein conserved in arch | 90.56 | |
| PRK09267 | 169 | flavodoxin FldA; Validated | 90.51 | |
| PF03358 | 152 | FMN_red: NADPH-dependent FMN reductase; InterPro: | 90.37 | |
| PRK03094 | 80 | hypothetical protein; Provisional | 89.97 | |
| PRK03673 | 396 | hypothetical protein; Provisional | 89.96 | |
| cd05014 | 128 | SIS_Kpsf KpsF-like protein. KpsF is an arabinose-5 | 89.77 | |
| PRK06455 | 155 | riboflavin synthase; Provisional | 89.76 | |
| PRK01372 | 304 | ddl D-alanine--D-alanine ligase; Reviewed | 89.75 | |
| TIGR00177 | 144 | molyb_syn molybdenum cofactor synthesis domain. Th | 89.69 | |
| PRK04885 | 265 | ppnK inorganic polyphosphate/ATP-NAD kinase; Provi | 89.55 | |
| PRK11914 | 306 | diacylglycerol kinase; Reviewed | 89.52 | |
| COG5426 | 254 | Uncharacterized membrane protein [Function unknown | 88.76 | |
| cd00885 | 170 | cinA Competence-damaged protein. CinA is the first | 88.33 | |
| PRK09739 | 199 | hypothetical protein; Provisional | 87.98 | |
| PRK01185 | 271 | ppnK inorganic polyphosphate/ATP-NAD kinase; Provi | 87.84 | |
| PRK05568 | 142 | flavodoxin; Provisional | 87.62 | |
| PRK14075 | 256 | pnk inorganic polyphosphate/ATP-NAD kinase; Provis | 87.5 | |
| TIGR01754 | 140 | flav_RNR ribonucleotide reductase-associated flavo | 87.0 | |
| PRK00561 | 259 | ppnK inorganic polyphosphate/ATP-NAD kinase; Provi | 86.78 | |
| PRK13054 | 300 | lipid kinase; Reviewed | 86.77 | |
| PRK00061 | 154 | ribH 6,7-dimethyl-8-ribityllumazine synthase; Prov | 86.63 | |
| TIGR00200 | 413 | cinA_nterm competence/damage-inducible protein Cin | 86.23 | |
| PRK12419 | 158 | riboflavin synthase subunit beta; Provisional | 85.25 | |
| PLN02935 | 508 | Bifunctional NADH kinase/NAD(+) kinase | 84.94 | |
| PF09822 | 271 | ABC_transp_aux: ABC-type uncharacterized transport | 84.88 | |
| PRK03501 | 264 | ppnK inorganic polyphosphate/ATP-NAD kinase; Provi | 84.81 | |
| PRK14690 | 419 | molybdopterin biosynthesis protein MoeA; Provision | 84.69 | |
| cd00758 | 133 | MoCF_BD MoCF_BD: molybdenum cofactor (MoCF) bindin | 84.68 | |
| TIGR01755 | 197 | flav_wrbA NAD(P)H:quinone oxidoreductase, type IV. | 84.67 | |
| PRK03670 | 252 | competence damage-inducible protein A; Provisional | 84.63 | |
| PRK00549 | 414 | competence damage-inducible protein A; Provisional | 84.19 | |
| PRK13055 | 334 | putative lipid kinase; Reviewed | 83.61 | |
| cd03522 | 312 | MoeA_like MoeA_like. This domain is similar to a d | 83.54 | |
| COG1058 | 255 | CinA Predicted nucleotide-utilizing enzyme related | 82.35 | |
| smart00852 | 135 | MoCF_biosynth Probable molybdopterin binding domai | 82.01 | |
| PRK10680 | 411 | molybdopterin biosynthesis protein MoeA; Provision | 81.64 | |
| COG0054 | 152 | RibH Riboflavin synthase beta-chain [Coenzyme meta | 81.1 | |
| PRK10499 | 106 | PTS system N,N'-diacetylchitobiose-specific transp | 81.02 | |
| PF09075 | 48 | STb_secrete: Heat-stable enterotoxin B, secretory; | 80.47 | |
| PLN02404 | 141 | 6,7-dimethyl-8-ribityllumazine synthase | 80.41 | |
| PRK02231 | 272 | ppnK inorganic polyphosphate/ATP-NAD kinase; Provi | 80.07 | |
| TIGR00147 | 293 | lipid kinase, YegS/Rv2252/BmrU family. The E. coli | 80.06 |
| >PRK05665 amidotransferase; Provisional | Back alignment and domain information |
|---|
Probab=99.97 E-value=2.7e-29 Score=187.93 Aligned_cols=115 Identities=31% Similarity=0.553 Sum_probs=103.5
Q ss_pred CCCCeEEEEEcCCCchHHHHhhCCHHHHHHHHHhhCC--CeEEEEEccCCCCCCCCCCCCcCEEEEcCCCCCCCCCchHH
Q 033165 1 MGGKKFAVLLCAEDSEYVKKKYGGYFGVFVRMLAEEG--ETWDVFHVARGEFPDDDDFGSYDGYVITGSCNDAHGNDVWI 78 (126)
Q Consensus 1 M~~~ki~Il~~~~~~~~~~~~~~~~~~~~~~~l~~~g--~~~~~~~~~~~~~p~~~~~~~~d~iii~G~~~~~~~~~~~~ 78 (126)
|+| ||+||+++.+.+.+.+.||+|.++|.++|...+ .+++++++..+++|. ++++|||+||+||+++++++.+|+
T Consensus 1 ~~m-ki~IL~~~~~~~~~~~~~g~~~~~~~~ll~~~~~~~~~~~~~~~~~~~p~--~~~~~dgiiitGs~~~v~~~~pwi 77 (240)
T PRK05665 1 MSL-RICILETDVLRPELVAQYQGYGRMFEQLFARQPIAAEFVVYNVVQGDYPA--DDEKFDAYLVTGSKADSFGTDPWI 77 (240)
T ss_pred Cce-EEEEEECCCCCHHHHHHhCCHHHHHHHHHHhCCCCceEEEEeccCCCCCC--CcccCCEEEECCCCCCccccchHH
Confidence 666 699999999999999999999999999998876 457777877766664 578899999999999999988999
Q ss_pred HHHHHHHHHHHhcCCcEEEEchHHHHHHHHhCCccccCCc
Q 033165 79 CKLIALLKQLDSLRKKVLGICFGHQVRAITVFSSHINASK 118 (126)
Q Consensus 79 ~~~~~~i~~~~~~~~PvlGIC~G~Q~la~~~Gg~v~~~~~ 118 (126)
.++.++|++++++++|+||||||||+||+++||+|.++++
T Consensus 78 ~~l~~~i~~~~~~~~PilGIC~GhQlla~AlGG~V~~~~~ 117 (240)
T PRK05665 78 QTLKTYLLKLYERGDKLLGVCFGHQLLALLLGGKAERASQ 117 (240)
T ss_pred HHHHHHHHHHHhcCCCEEEEeHHHHHHHHHhCCEEEeCCC
Confidence 9999999999999999999999999999999999998763
|
|
| >KOG3179 consensus Predicted glutamine synthetase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK09065 glutamine amidotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06490 glutamine amidotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK07053 glutamine amidotransferase; Provisional | Back alignment and domain information |
|---|
| >COG0518 GuaA GMP synthase - Glutamine amidotransferase domain [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK07567 glutamine amidotransferase; Provisional | Back alignment and domain information |
|---|
| >COG0512 PabA Anthranilate/para-aminobenzoate synthases component II [Amino acid transport and metabolism / Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK06895 putative anthranilate synthase component II; Provisional | Back alignment and domain information |
|---|
| >PRK08250 glutamine amidotransferase; Provisional | Back alignment and domain information |
|---|
| >cd01741 GATase1_1 Subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain | Back alignment and domain information |
|---|
| >PRK08007 para-aminobenzoate synthase component II; Provisional | Back alignment and domain information |
|---|
| >PRK06774 para-aminobenzoate synthase component II; Provisional | Back alignment and domain information |
|---|
| >PRK07649 para-aminobenzoate/anthranilate synthase glutamine amidotransferase component II; Validated | Back alignment and domain information |
|---|
| >PF00117 GATase: Glutamine amidotransferase class-I; InterPro: IPR017926 Glutamine amidotransferase (GATase) enzymes catalyse the removal of the ammonia group from glutamine and then transfer this group to a substrate to form a new carbon-nitrogen group [] | Back alignment and domain information |
|---|
| >PRK08857 para-aminobenzoate synthase component II; Provisional | Back alignment and domain information |
|---|
| >PRK07765 para-aminobenzoate synthase component II; Provisional | Back alignment and domain information |
|---|
| >PRK05637 anthranilate synthase component II; Provisional | Back alignment and domain information |
|---|
| >PRK05670 anthranilate synthase component II; Provisional | Back alignment and domain information |
|---|
| >TIGR00566 trpG_papA glutamine amidotransferase of anthranilate synthase or aminodeoxychorismate synthase | Back alignment and domain information |
|---|
| >CHL00101 trpG anthranilate synthase component 2 | Back alignment and domain information |
|---|
| >cd01743 GATase1_Anthranilate_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in Anthranilate synthase | Back alignment and domain information |
|---|
| >PLN02335 anthranilate synthase | Back alignment and domain information |
|---|
| >cd01742 GATase1_GMP_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in GMP synthetase | Back alignment and domain information |
|---|
| >PRK13527 glutamine amidotransferase subunit PdxT; Provisional | Back alignment and domain information |
|---|
| >PRK09522 bifunctional glutamine amidotransferase/anthranilate phosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR00888 guaA_Nterm GMP synthase (glutamine-hydrolyzing), N-terminal domain or A subunit | Back alignment and domain information |
|---|
| >PRK00758 GMP synthase subunit A; Validated | Back alignment and domain information |
|---|
| >PLN02889 oxo-acid-lyase/anthranilate synthase | Back alignment and domain information |
|---|
| >cd01744 GATase1_CPSase Small chain of the glutamine-dependent form of carbamoyl phosphate synthase, CPSase II | Back alignment and domain information |
|---|
| >PLN02347 GMP synthetase | Back alignment and domain information |
|---|
| >TIGR01823 PabB-fungal aminodeoxychorismate synthase, fungal clade | Back alignment and domain information |
|---|
| >PRK05368 homoserine O-succinyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK13525 glutamine amidotransferase subunit PdxT; Provisional | Back alignment and domain information |
|---|
| >TIGR01815 TrpE-clade3 anthranilate synthase, alpha proteobacterial clade | Back alignment and domain information |
|---|
| >PRK13566 anthranilate synthase; Provisional | Back alignment and domain information |
|---|
| >cd01745 GATase1_2 Subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain | Back alignment and domain information |
|---|
| >PRK00074 guaA GMP synthase; Reviewed | Back alignment and domain information |
|---|
| >CHL00197 carA carbamoyl-phosphate synthase arginine-specific small subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14607 bifunctional glutamine amidotransferase/anthranilate phosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK13143 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional | Back alignment and domain information |
|---|
| >cd01746 GATase1_CTP_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in Cytidine Triphosphate Synthetase | Back alignment and domain information |
|---|
| >PRK12564 carbamoyl phosphate synthase small subunit; Reviewed | Back alignment and domain information |
|---|
| >TIGR03800 PLP_synth_Pdx2 pyridoxal 5'-phosphate synthase, glutaminase subunit Pdx2 | Back alignment and domain information |
|---|
| >PRK12838 carbamoyl phosphate synthase small subunit; Reviewed | Back alignment and domain information |
|---|
| >cd01748 GATase1_IGP_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in imidazole glycerol phosphate synthase (IGPS) | Back alignment and domain information |
|---|
| >PRK13146 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional | Back alignment and domain information |
|---|
| >TIGR01368 CPSaseIIsmall carbamoyl-phosphate synthase, small subunit | Back alignment and domain information |
|---|
| >PLN02771 carbamoyl-phosphate synthase (glutamine-hydrolyzing) | Back alignment and domain information |
|---|
| >PRK13141 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional | Back alignment and domain information |
|---|
| >COG0505 CarA Carbamoylphosphate synthase small subunit [Amino acid transport and metabolism / Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK11366 puuD gamma-glutamyl-gamma-aminobutyrate hydrolase; Provisional | Back alignment and domain information |
|---|
| >cd01749 GATase1_PB Glutamine Amidotransferase (GATase_I) involved in pyridoxine biosynthesis | Back alignment and domain information |
|---|
| >PRK13181 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional | Back alignment and domain information |
|---|
| >PRK13170 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional | Back alignment and domain information |
|---|
| >PRK01175 phosphoribosylformylglycinamidine synthase I; Provisional | Back alignment and domain information |
|---|
| >CHL00188 hisH imidazole glycerol phosphate synthase subunit hisH; Provisional | Back alignment and domain information |
|---|
| >TIGR01855 IMP_synth_hisH imidazole glycerol phosphate synthase, glutamine amidotransferase subunit | Back alignment and domain information |
|---|
| >COG0118 HisH Glutamine amidotransferase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02832 glutamine amidotransferase subunit of pyridoxal 5'-phosphate synthase complex | Back alignment and domain information |
|---|
| >KOG0026 consensus Anthranilate synthase, beta chain [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01737 FGAM_synth_I phosphoribosylformylglycinamidine synthase I | Back alignment and domain information |
|---|
| >cd01747 GATase1_Glutamyl_Hydrolase Type 1 glutamine amidotransferase (GATase1) domain found in gamma-Glutamyl Hydrolase | Back alignment and domain information |
|---|
| >PRK05380 pyrG CTP synthetase; Validated | Back alignment and domain information |
|---|
| >PRK13152 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional | Back alignment and domain information |
|---|
| >cd03131 GATase1_HTS Type 1 glutamine amidotransferase (GATase1)-like domain found in homoserine trans-succinylase (HTS) | Back alignment and domain information |
|---|
| >cd01740 GATase1_FGAR_AT Type 1 glutamine amidotransferase (GATase1)-like domain found in Formylglycinamide ribonucleotide amidotransferase | Back alignment and domain information |
|---|
| >KOG1622 consensus GMP synthase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >COG0047 PurL Phosphoribosylformylglycinamidine (FGAM) synthase, glutamine amidotransferase domain [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK03619 phosphoribosylformylglycinamidine synthase I; Provisional | Back alignment and domain information |
|---|
| >PRK13526 glutamine amidotransferase subunit PdxT; Provisional | Back alignment and domain information |
|---|
| >PRK06186 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PLN02617 imidazole glycerol phosphate synthase hisHF | Back alignment and domain information |
|---|
| >PRK13142 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional | Back alignment and domain information |
|---|
| >KOG1224 consensus Para-aminobenzoate (PABA) synthase ABZ1 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG2071 Predicted glutamine amidotransferases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14004 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional | Back alignment and domain information |
|---|
| >KOG0370 consensus Multifunctional pyrimidine synthesis protein CAD (includes carbamoyl-phophate synthetase, aspartate transcarbamylase, and glutamine amidotransferase) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00337 PyrG CTP synthase | Back alignment and domain information |
|---|
| >cd01750 GATase1_CobQ Type 1 glutamine amidotransferase (GATase1) domain found in Cobyric Acid Synthase (CobQ) | Back alignment and domain information |
|---|
| >PF07722 Peptidase_C26: Peptidase C26; InterPro: IPR011697 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >PLN02327 CTP synthase | Back alignment and domain information |
|---|
| >cd03130 GATase1_CobB Type 1 glutamine amidotransferase (GATase1) domain found in Cobyrinic Acid a,c-Diamide Synthase | Back alignment and domain information |
|---|
| >PF13507 GATase_5: CobB/CobQ-like glutamine amidotransferase domain; PDB: 3D54_L 3UMM_A 3UJN_A 3UGJ_A 1T3T_A | Back alignment and domain information |
|---|
| >PRK00784 cobyric acid synthase; Provisional | Back alignment and domain information |
|---|
| >PRK11780 isoprenoid biosynthesis protein with amidotransferase-like domain; Provisional | Back alignment and domain information |
|---|
| >COG0504 PyrG CTP synthase (UTP-ammonia lyase) [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK06278 cobyrinic acid a,c-diamide synthase; Validated | Back alignment and domain information |
|---|
| >cd03146 GAT1_Peptidase_E Type 1 glutamine amidotransferase (GATase1)-like domain found in peptidase E | Back alignment and domain information |
|---|
| >cd01653 GATase1 Type 1 glutamine amidotransferase (GATase1)-like domain | Back alignment and domain information |
|---|
| >PF04204 HTS: Homoserine O-succinyltransferase ; InterPro: IPR005697 This family of enzymes, homoserine O-succinyltransferase, catalyses the first step in the biosynthesis of methionine: |
Back alignment and domain information |
|---|
| >PRK01077 cobyrinic acid a,c-diamide synthase; Validated | Back alignment and domain information |
|---|
| >TIGR00379 cobB cobyrinic acid a,c-diamide synthase | Back alignment and domain information |
|---|
| >TIGR01857 FGAM-synthase phosphoribosylformylglycinamidine synthase, clade II | Back alignment and domain information |
|---|
| >TIGR01001 metA homoserine O-succinyltransferase | Back alignment and domain information |
|---|
| >COG0311 PDX2 Predicted glutamine amidotransferase involved in pyridoxine biosynthesis [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PLN03206 phosphoribosylformylglycinamidine synthase; Provisional | Back alignment and domain information |
|---|
| >TIGR01735 FGAM_synt phosphoribosylformylglycinamidine synthase, single chain form | Back alignment and domain information |
|---|
| >PRK05297 phosphoribosylformylglycinamidine synthase; Provisional | Back alignment and domain information |
|---|
| >cd03169 GATase1_PfpI_1 Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus | Back alignment and domain information |
|---|
| >PF07685 GATase_3: CobB/CobQ-like glutamine amidotransferase domain; InterPro: IPR011698 This group of enzymes was suggested to be related to the MinD family of ATPases involved in regulation of cell division in bacteria and archaea [] | Back alignment and domain information |
|---|
| >cd03128 GAT_1 Type 1 glutamine amidotransferase (GATase1)-like domain | Back alignment and domain information |
|---|
| >TIGR00313 cobQ cobyric acid synthase CobQ | Back alignment and domain information |
|---|
| >cd03134 GATase1_PfpI_like A type 1 glutamine amidotransferase (GATase1)-like domain found in PfpI from Pyrococcus furiosus | Back alignment and domain information |
|---|
| >cd03147 GATase1_Ydr533c_like Type 1 glutamine amidotransferase (GATase1)-like domain found in Saccharomyces cerevisiae Ydr533c protein | Back alignment and domain information |
|---|
| >TIGR01382 PfpI intracellular protease, PfpI family | Back alignment and domain information |
|---|
| >PRK13896 cobyrinic acid a,c-diamide synthase; Provisional | Back alignment and domain information |
|---|
| >COG0693 ThiJ Putative intracellular protease/amidase [General function prediction only] | Back alignment and domain information |
|---|
| >cd03133 GATase1_ES1 Type 1 glutamine amidotransferase (GATase1)-like domain found in zebrafish ES1 | Back alignment and domain information |
|---|
| >KOG2387 consensus CTP synthase (UTP-ammonia lyase) [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PF01174 SNO: SNO glutamine amidotransferase family; InterPro: IPR002161 Members of this family are involved in the pyridoxine biosynthetic pathway [, ] | Back alignment and domain information |
|---|
| >cd03132 GATase1_catalase Type 1 glutamine amidotransferase (GATase1)-like domain found in at the C-terminal of several large catalases | Back alignment and domain information |
|---|
| >PRK04155 chaperone protein HchA; Provisional | Back alignment and domain information |
|---|
| >TIGR01739 tegu_FGAM_synt herpesvirus tegument protein/v-FGAM-synthase | Back alignment and domain information |
|---|
| >PHA03366 FGAM-synthase; Provisional | Back alignment and domain information |
|---|
| >PRK11574 oxidative-stress-resistance chaperone; Provisional | Back alignment and domain information |
|---|
| >COG1492 CobQ Cobyric acid synthase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >cd03144 GATase1_ScBLP_like Type 1 glutamine amidotransferase (GATase1)-like domain found in proteins similar to Saccharomyces cerevisiae biotin-apoprotein ligase (ScBLP) | Back alignment and domain information |
|---|
| >PRK05282 (alpha)-aspartyl dipeptidase; Validated | Back alignment and domain information |
|---|
| >KOG0623 consensus Glutamine amidotransferase/cyclase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd03140 GATase1_PfpI_3 Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus | Back alignment and domain information |
|---|
| >cd03137 GATase1_AraC_1 AraC transcriptional regulators having a Type 1 glutamine amidotransferase (GATase1)-like domain | Back alignment and domain information |
|---|
| >cd03135 GATase1_DJ-1 Type 1 glutamine amidotransferase (GATase1)-like domain found in Human DJ-1 | Back alignment and domain information |
|---|
| >TIGR01383 not_thiJ DJ-1 family protein | Back alignment and domain information |
|---|
| >cd03148 GATase1_EcHsp31_like Type 1 glutamine amidotransferase (GATase1)-like domain found in Escherichia coli Hsp31 protein (EcHsp31) | Back alignment and domain information |
|---|
| >PF01965 DJ-1_PfpI: DJ-1/PfpI family; InterPro: IPR002818 This signature defines a diverse group of protein families which include proteins involved in RNA-protein interaction regulation, thiamine biosynthesis, Ras-related signal transduction, and those with protease activity | Back alignment and domain information |
|---|
| >COG3442 Predicted glutamine amidotransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11249 katE hydroperoxidase II; Provisional | Back alignment and domain information |
|---|
| >COG1897 MetA Homoserine trans-succinylase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG3210 consensus Imidazoleglycerol-phosphate synthase subunit H-like [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >cd03138 GATase1_AraC_2 AraC transcriptional regulators having a Type 1 glutamine amidotransferase (GATase1)-like domain | Back alignment and domain information |
|---|
| >cd03141 GATase1_Hsp31_like Type 1 glutamine amidotransferase (GATase1)-like domain found in proteins similar to Escherichia coli Hsp31 protein | Back alignment and domain information |
|---|
| >PRK09393 ftrA transcriptional activator FtrA; Provisional | Back alignment and domain information |
|---|
| >cd03139 GATase1_PfpI_2 Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus | Back alignment and domain information |
|---|
| >cd03129 GAT1_Peptidase_E_like Type 1 glutamine amidotransferase (GATase1)-like domain found in peptidase E_like proteins | Back alignment and domain information |
|---|
| >cd03136 GATase1_AraC_ArgR_like AraC transcriptional regulators having an N-terminal Type 1 glutamine amidotransferase (GATase1)-like domain | Back alignment and domain information |
|---|
| >COG1797 CobB Cobyrinic acid a,c-diamide synthase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PF13278 DUF4066: Putative amidotransferase; PDB: 3BHN_A 3MGK_B 3NOV_A 3NON_B 3NOO_B 3NOQ_A 3NOR_A 3GRA_A 3EWN_A 3ER6_C | Back alignment and domain information |
|---|
| >KOG2764 consensus Putative transcriptional regulator DJ-1 [General function prediction only; Defense mechanisms] | Back alignment and domain information |
|---|
| >COG3340 PepE Peptidase E [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1907 consensus Phosphoribosylformylglycinamidine synthase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PF09825 BPL_N: Biotin-protein ligase, N terminal; InterPro: IPR019197 The function of this structural domain is unknown | Back alignment and domain information |
|---|
| >TIGR02069 cyanophycinase cyanophycinase | Back alignment and domain information |
|---|
| >cd03145 GAT1_cyanophycinase Type 1 glutamine amidotransferase (GATase1)-like domain found in cyanophycinase | Back alignment and domain information |
|---|
| >COG3155 ElbB Uncharacterized protein involved in an early stage of isoprenoid biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PRK03372 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional | Back alignment and domain information |
|---|
| >PF03575 Peptidase_S51: Peptidase family S51; InterPro: IPR005320 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >PRK02645 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional | Back alignment and domain information |
|---|
| >KOG1559 consensus Gamma-glutamyl hydrolase [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >COG4635 HemG Flavodoxin [Energy production and conversion / Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK11104 hemG protoporphyrinogen oxidase; Provisional | Back alignment and domain information |
|---|
| >PRK03378 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional | Back alignment and domain information |
|---|
| >PRK02155 ppnK NAD(+)/NADH kinase family protein; Provisional | Back alignment and domain information |
|---|
| >PRK02649 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional | Back alignment and domain information |
|---|
| >COG4090 Uncharacterized protein conserved in archaea [Function unknown] | Back alignment and domain information |
|---|
| >PRK06756 flavodoxin; Provisional | Back alignment and domain information |
|---|
| >PRK01231 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional | Back alignment and domain information |
|---|
| >PRK01911 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional | Back alignment and domain information |
|---|
| >COG4977 Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain [Transcription] | Back alignment and domain information |
|---|
| >PRK03708 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14077 pnk inorganic polyphosphate/ATP-NAD kinase; Provisional | Back alignment and domain information |
|---|
| >PRK04539 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02667 moaB_proteo molybdenum cofactor biosynthesis protein B, proteobacterial | Back alignment and domain information |
|---|
| >PF06283 ThuA: Trehalose utilisation; PDB: 4E5V_A 1T0B_A | Back alignment and domain information |
|---|
| >PF00885 DMRL_synthase: 6,7-dimethyl-8-ribityllumazine synthase; InterPro: IPR002180 6,7-dimethyl-8-ribityllumazine synthase (riboflavin synthase) catalyses the biosynthesis of riboflavin according to the reaction: |
Back alignment and domain information |
|---|
| >PRK01215 competence damage-inducible protein A; Provisional | Back alignment and domain information |
|---|
| >PRK09271 flavodoxin; Provisional | Back alignment and domain information |
|---|
| >COG4285 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK06703 flavodoxin; Provisional | Back alignment and domain information |
|---|
| >PLN02929 NADH kinase | Back alignment and domain information |
|---|
| >cd00886 MogA_MoaB MogA_MoaB family | Back alignment and domain information |
|---|
| >PF03698 UPF0180: Uncharacterised protein family (UPF0180); InterPro: IPR005370 The members of this family are small uncharacterised proteins | Back alignment and domain information |
|---|
| >PRK14076 pnk inorganic polyphosphate/ATP-NAD kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14569 D-alanyl-alanine synthetase A; Provisional | Back alignment and domain information |
|---|
| >PRK03767 NAD(P)H:quinone oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK05569 flavodoxin; Provisional | Back alignment and domain information |
|---|
| >cd03142 GATase1_ThuA Type 1 glutamine amidotransferase (GATase1)-like domain found in Sinorhizobium meliloti Rm1021 ThuA (SmThuA) | Back alignment and domain information |
|---|
| >PRK07308 flavodoxin; Validated | Back alignment and domain information |
|---|
| >TIGR00853 pts-lac PTS system, lactose/cellobiose family IIB component | Back alignment and domain information |
|---|
| >PRK09417 mogA molybdenum cofactor biosynthesis protein MogA; Provisional | Back alignment and domain information |
|---|
| >PF09897 DUF2124: Uncharacterized protein conserved in archaea (DUF2124); InterPro: IPR009183 There are currently no experimental data for members of this group of archaeal proteins, nor do they exhibit features indicative of any function | Back alignment and domain information |
|---|
| >PRK09267 flavodoxin FldA; Validated | Back alignment and domain information |
|---|
| >PF03358 FMN_red: NADPH-dependent FMN reductase; InterPro: IPR005025 NADPH-dependent FMN reductase (1 | Back alignment and domain information |
|---|
| >PRK03094 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK03673 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd05014 SIS_Kpsf KpsF-like protein | Back alignment and domain information |
|---|
| >PRK06455 riboflavin synthase; Provisional | Back alignment and domain information |
|---|
| >PRK01372 ddl D-alanine--D-alanine ligase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00177 molyb_syn molybdenum cofactor synthesis domain | Back alignment and domain information |
|---|
| >PRK04885 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional | Back alignment and domain information |
|---|
| >PRK11914 diacylglycerol kinase; Reviewed | Back alignment and domain information |
|---|
| >COG5426 Uncharacterized membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >cd00885 cinA Competence-damaged protein | Back alignment and domain information |
|---|
| >PRK09739 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK01185 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional | Back alignment and domain information |
|---|
| >PRK05568 flavodoxin; Provisional | Back alignment and domain information |
|---|
| >PRK14075 pnk inorganic polyphosphate/ATP-NAD kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR01754 flav_RNR ribonucleotide reductase-associated flavodoxin, putative | Back alignment and domain information |
|---|
| >PRK00561 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional | Back alignment and domain information |
|---|
| >PRK13054 lipid kinase; Reviewed | Back alignment and domain information |
|---|
| >PRK00061 ribH 6,7-dimethyl-8-ribityllumazine synthase; Provisional | Back alignment and domain information |
|---|
| >TIGR00200 cinA_nterm competence/damage-inducible protein CinA N-terminal domain | Back alignment and domain information |
|---|
| >PRK12419 riboflavin synthase subunit beta; Provisional | Back alignment and domain information |
|---|
| >PLN02935 Bifunctional NADH kinase/NAD(+) kinase | Back alignment and domain information |
|---|
| >PF09822 ABC_transp_aux: ABC-type uncharacterized transport system; InterPro: IPR019196 This domain is found in various eukaryotic and prokaryotic intra-flagellar transport proteins involved in gliding motility, as well as in several hypothetical proteins | Back alignment and domain information |
|---|
| >PRK03501 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14690 molybdopterin biosynthesis protein MoeA; Provisional | Back alignment and domain information |
|---|
| >cd00758 MoCF_BD MoCF_BD: molybdenum cofactor (MoCF) binding domain (BD) | Back alignment and domain information |
|---|
| >TIGR01755 flav_wrbA NAD(P)H:quinone oxidoreductase, type IV | Back alignment and domain information |
|---|
| >PRK03670 competence damage-inducible protein A; Provisional | Back alignment and domain information |
|---|
| >PRK00549 competence damage-inducible protein A; Provisional | Back alignment and domain information |
|---|
| >PRK13055 putative lipid kinase; Reviewed | Back alignment and domain information |
|---|
| >cd03522 MoeA_like MoeA_like | Back alignment and domain information |
|---|
| >COG1058 CinA Predicted nucleotide-utilizing enzyme related to molybdopterin-biosynthesis enzyme MoeA [General function prediction only] | Back alignment and domain information |
|---|
| >smart00852 MoCF_biosynth Probable molybdopterin binding domain | Back alignment and domain information |
|---|
| >PRK10680 molybdopterin biosynthesis protein MoeA; Provisional | Back alignment and domain information |
|---|
| >COG0054 RibH Riboflavin synthase beta-chain [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK10499 PTS system N,N'-diacetylchitobiose-specific transporter subunit IIB; Provisional | Back alignment and domain information |
|---|
| >PF09075 STb_secrete: Heat-stable enterotoxin B, secretory; InterPro: IPR015160 Members of this family assume a helical secondary structure, with two alpha helices forming a disulphide cross-linked alpha-helical hairpin | Back alignment and domain information |
|---|
| >PLN02404 6,7-dimethyl-8-ribityllumazine synthase | Back alignment and domain information |
|---|
| >PRK02231 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR00147 lipid kinase, YegS/Rv2252/BmrU family | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 126 | |||
| 3m3p_A | 250 | Glutamine amido transferase; structural genomics, | 3e-19 | |
| 1o1y_A | 239 | Conserved hypothetical protein TM1158; flavodoxin- | 3e-16 | |
| 3l7n_A | 236 | Putative uncharacterized protein; glutamine amidot | 9e-14 |
| >3m3p_A Glutamine amido transferase; structural genomics, nysgrc, PSI-2; HET: MSE; 1.30A {Methylobacillus flagellatus} PDB: 3l83_A* Length = 250 | Back alignment and structure |
|---|
Score = 79.1 bits (195), Expect = 3e-19
Identities = 24/107 (22%), Positives = 41/107 (38%), Gaps = 12/107 (11%)
Query: 1 MGGKKFAVLLCAEDSEYVKKKYGGYFGVFVRMLAEEGETWDVFHVARGE-FPDDDDFGSY 59
M K ++ + G F LA E + V + R + P +
Sbjct: 1 MSLKPVMIIQFSASE---------GPGHFGDFLAGEHIPFQVLRMDRSDPLPAEIR--DC 49
Query: 60 DGYVITGSCNDAHGNDVWICKLIALLKQLDSLRKKVLGICFGHQVRA 106
G + G A+ + W+ L+AL++ + R V+G C G Q+ A
Sbjct: 50 SGLAMMGGPMSANDDLPWMPTLLALIRDAVAQRVPVIGHCLGGQLLA 96
|
| >1o1y_A Conserved hypothetical protein TM1158; flavodoxin-like fold, structural genomics, joint center for structural genomics, JCSG; 1.70A {Thermotoga maritima} SCOP: c.23.16.1 Length = 239 | Back alignment and structure |
|---|
| >3l7n_A Putative uncharacterized protein; glutamine amidotransferase, transferas; 2.70A {Streptococcus mutans} Length = 236 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 126 | |||
| 3m3p_A | 250 | Glutamine amido transferase; structural genomics, | 99.91 | |
| 3l7n_A | 236 | Putative uncharacterized protein; glutamine amidot | 99.88 | |
| 1o1y_A | 239 | Conserved hypothetical protein TM1158; flavodoxin- | 99.84 | |
| 3r75_A | 645 | Anthranilate/para-aminobenzoate synthases compone; | 99.8 | |
| 2h2w_A | 312 | Homoserine O-succinyltransferase; TM0881, (EC 2.3. | 99.79 | |
| 2vdj_A | 301 | Homoserine O-succinyltransferase; methionine biosy | 99.78 | |
| 1qdl_B | 195 | Protein (anthranilate synthase (TRPG-SUBUNIT)); tr | 99.78 | |
| 2a9v_A | 212 | GMP synthase; structural genomics, joint center fo | 99.77 | |
| 1wl8_A | 189 | GMP synthase [glutamine-hydrolyzing] subunit A; tr | 99.75 | |
| 3uow_A | 556 | GMP synthetase; structural genomics consortium, SG | 99.73 | |
| 2nv0_A | 196 | Glutamine amidotransferase subunit PDXT; 3-layer(A | 99.72 | |
| 1q7r_A | 219 | Predicted amidotransferase; structural genomics, Y | 99.72 | |
| 1i1q_B | 192 | Anthranilate synthase component II; tryptophan bio | 99.72 | |
| 3tqi_A | 527 | GMP synthase [glutamine-hydrolyzing]; ligase; 2.84 | 99.72 | |
| 4gud_A | 211 | Imidazole glycerol phosphate synthase subunit His; | 99.7 | |
| 1a9x_B | 379 | Carbamoyl phosphate synthetase (small chain); amid | 99.69 | |
| 2ywj_A | 186 | Glutamine amidotransferase subunit PDXT; uncharact | 99.69 | |
| 1gpm_A | 525 | GMP synthetase, XMP aminase; class I glutamine ami | 99.68 | |
| 2w7t_A | 273 | CTP synthetase, putative cytidine triphosphate syn | 99.68 | |
| 2vpi_A | 218 | GMP synthase; guanine monophosphate synthetase, ph | 99.67 | |
| 2abw_A | 227 | PDX2 protein, glutaminase; PLP-synthase, vitamin B | 99.66 | |
| 3fij_A | 254 | LIN1909 protein; 11172J, uncharacterized protein, | 99.65 | |
| 3d54_D | 213 | Phosphoribosylformylglycinamidine synthase 1; alph | 99.65 | |
| 2ywd_A | 191 | Glutamine amidotransferase subunit PDXT; pyridoxin | 99.63 | |
| 2ywb_A | 503 | GMP synthase [glutamine-hydrolyzing]; GMP syntheta | 99.61 | |
| 1ka9_H | 200 | Imidazole glycerol phosphtate synthase; riken stru | 99.61 | |
| 2iss_D | 208 | Glutamine amidotransferase subunit PDXT; (beta/alp | 99.61 | |
| 1gpw_B | 201 | Amidotransferase HISH; lyase/transferase, complex | 99.6 | |
| 1l9x_A | 315 | Gamma-glutamyl hydrolase; 1.60A {Homo sapiens} SCO | 99.58 | |
| 2vxo_A | 697 | GMP synthase [glutamine-hydrolyzing]; proto-oncoge | 99.57 | |
| 3nva_A | 535 | CTP synthase; rossman fold, nucleotide binding, LI | 99.54 | |
| 2v4u_A | 289 | CTP synthase 2; pyrimidine biosynthesis, glutamine | 99.52 | |
| 1vco_A | 550 | CTP synthetase; tetramer, riken structural genomic | 99.52 | |
| 1s1m_A | 545 | CTP synthase; CTP synthetase, UTP:ammonia ligase ( | 99.47 | |
| 1jvn_A | 555 | Glutamine, bifunctional histidine biosynthesis pro | 99.46 | |
| 1oi4_A | 193 | Hypothetical protein YHBO; PFPI/THIJ family, compl | 99.07 | |
| 3l4e_A | 206 | Uncharacterized peptidase LMO0363; hypothetical pr | 99.03 | |
| 2rk3_A | 197 | Protein DJ-1; parkinson'S disease, THIJ, PFPI, cha | 99.0 | |
| 2vrn_A | 190 | Protease I, DR1199; cysteine sulfenic acid, DJ-1/T | 98.96 | |
| 3ugj_A | 1303 | Phosphoribosylformylglycinamidine synthase; amidot | 98.96 | |
| 1vhq_A | 232 | Enhancing lycopene biosynthesis protein 2; structu | 98.96 | |
| 1fy2_A | 229 | Aspartyl dipeptidase; serine protease, catalytic t | 98.96 | |
| 3efe_A | 212 | THIJ/PFPI family protein; structural GEN csgid, ce | 98.92 | |
| 3f5d_A | 206 | Protein YDEA; unknow protein, PSI-II, nysgrc, stru | 98.89 | |
| 3l18_A | 168 | Intracellular protease I; gatase1_PFPI_LIKE, hydro | 98.87 | |
| 2ab0_A | 205 | YAJL; DJ-1/THIJ superfamily, alpha-beta hydrolase | 98.84 | |
| 3kkl_A | 244 | Probable chaperone protein HSP33; peptidase, heat | 98.77 | |
| 1rw7_A | 243 | YDR533CP; alpha-beta sandwich, DJ-1/THIJ/PFPI supe | 98.75 | |
| 4e08_A | 190 | DJ-1 beta; flavodoxin-like fold, stress response, | 98.75 | |
| 4hcj_A | 177 | THIJ/PFPI domain protein; structural genomics, PSI | 98.75 | |
| 3gra_A | 202 | Transcriptional regulator, ARAC family; transcript | 98.69 | |
| 3l3b_A | 242 | ES1 family protein; ssgcid, NIH, niaid, SBRI, UW, | 98.67 | |
| 3er6_A | 209 | Putative transcriptional regulator protein; struct | 98.66 | |
| 2fex_A | 188 | Conserved hypothetical protein; structural genomic | 98.65 | |
| 3cne_A | 175 | Putative protease I; structural genomics, PSI-2, M | 98.63 | |
| 3ej6_A | 688 | Catalase-3; heme, hydrogen iron, metal-binding, ox | 98.59 | |
| 1u9c_A | 224 | APC35852; structural genomics, protein structure i | 98.59 | |
| 3n7t_A | 247 | Macrophage binding protein; seattle structural gen | 98.55 | |
| 3uk7_A | 396 | Class I glutamine amidotransferase-like domain-CO | 98.52 | |
| 2iuf_A | 688 | Catalase; oxidoreductase; HET: HDD NAG; 1.71A {Pen | 98.44 | |
| 1sy7_A | 715 | Catalase 1; heme oxidation, singlet oxygen, oxidor | 98.43 | |
| 3noq_A | 231 | THIJ/PFPI family protein; DJ-1 superfamily, isocya | 98.41 | |
| 3ttv_A | 753 | Catalase HPII; heme orientation, oxidoreductase; H | 98.41 | |
| 3ot1_A | 208 | 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate | 98.41 | |
| 3uk7_A | 396 | Class I glutamine amidotransferase-like domain-CO | 98.4 | |
| 3fse_A | 365 | Two-domain protein containing DJ-1/THIJ/PFPI-like | 98.39 | |
| 3mgk_A | 211 | Intracellular protease/amidase related enzyme (THI | 98.31 | |
| 1n57_A | 291 | Chaperone HSP31, protein YEDU; alpha-beta sandwich | 98.3 | |
| 3ewn_A | 253 | THIJ/PFPI family protein; monomer, PSI nysgrc, str | 98.21 | |
| 4gdh_A | 194 | DJ-1, uncharacterized protein C22E12.03C; unknown | 98.2 | |
| 3bhn_A | 236 | THIJ/PFPI domain protein; structural genomics, joi | 97.7 | |
| 3en0_A | 291 | Cyanophycinase; serine protease, beta peptide spec | 97.41 | |
| 2a5l_A | 200 | Trp repressor binding protein WRBA; APC5760, PA094 | 95.61 | |
| 1u0t_A | 307 | Inorganic polyphosphate/ATP-NAD kinase; alpha-beta | 95.52 | |
| 2zki_A | 199 | 199AA long hypothetical Trp repressor binding prot | 95.03 | |
| 3rht_A | 259 | (gatase1)-like protein; structural genomics, PSI-b | 94.99 | |
| 3pzy_A | 164 | MOG; ssgcid, seattle structural genomics center fo | 94.34 | |
| 1di6_A | 195 | MOGA, molybdenum cofactor biosynthetic enzyme; MOC | 93.91 | |
| 2r47_A | 157 | Uncharacterized protein MTH_862; unknown function, | 93.89 | |
| 4e5v_A | 281 | Putative THUA-like protein; THUA-like proteins, tr | 93.63 | |
| 3f6r_A | 148 | Flavodoxin; FMN binding, oxidized, electron transp | 93.51 | |
| 2gk3_A | 256 | Putative cytoplasmic protein; STM3548, structural | 93.34 | |
| 2i2c_A | 272 | Probable inorganic polyphosphate/ATP-NAD kinase 1; | 93.29 | |
| 2qv7_A | 337 | Diacylglycerol kinase DGKB; alpha-beta domain 1, b | 92.62 | |
| 1eiw_A | 111 | Hypothetical protein MTH538; CHEY-like fold, flavo | 92.59 | |
| 3rfq_A | 185 | Pterin-4-alpha-carbinolamine dehydratase MOAB2; st | 92.51 | |
| 3kbq_A | 172 | Protein TA0487; structural genomics, CINA, protein | 92.49 | |
| 2pjk_A | 178 | 178AA long hypothetical molybdenum cofactor biosyn | 92.36 | |
| 1z0s_A | 278 | Probable inorganic polyphosphate/ATP-NAD kinase; A | 92.22 | |
| 3ff4_A | 122 | Uncharacterized protein; structural genomics, PSI- | 92.16 | |
| 2an1_A | 292 | Putative kinase; structural genomics, PSI, protein | 92.11 | |
| 1y5e_A | 169 | Molybdenum cofactor biosynthesis protein B; struct | 92.01 | |
| 1e2b_A | 106 | Enzyme IIB-cellobiose; phosphotransferase system, | 91.99 | |
| 1t0b_A | 252 | THUA-like protein; trehalose metabolism, NCS symme | 91.94 | |
| 2ark_A | 188 | Flavodoxin; FMN, structural genomics, PSI, structu | 91.54 | |
| 1mkz_A | 172 | Molybdenum cofactor biosynthesis protein B; MAD, W | 91.51 | |
| 4gi5_A | 280 | Quinone reductase; protein structure initiative, F | 90.88 | |
| 1ydg_A | 211 | Trp repressor binding protein WRBA; tetramer, stru | 90.75 | |
| 3b6i_A | 198 | Flavoprotein WRBA; flavoproteins, NADH:quinone oxi | 90.59 | |
| 1t5b_A | 201 | Acyl carrier protein phosphodiesterase; structural | 90.56 | |
| 2g2c_A | 167 | Putative molybdenum cofactor biosynthesis protein; | 90.43 | |
| 2vzf_A | 197 | NADH-dependent FMN reductase; oxidoreductase; 2.50 | 90.38 | |
| 3iwt_A | 178 | 178AA long hypothetical molybdenum cofactor biosy | 89.86 | |
| 3klb_A | 162 | Putative flavoprotein; structural genomi center fo | 89.76 | |
| 2is8_A | 164 | Molybdopterin biosynthesis enzyme, MOAB; globular | 89.14 | |
| 2q62_A | 247 | ARSH; alpha/beta, flavoprotein; 1.80A {Sinorhizobi | 89.09 | |
| 2zuv_A | 759 | Lacto-N-biose phosphorylase; beta-alpha-barrel, TI | 89.06 | |
| 2hna_A | 147 | Protein MIOC, flavodoxin; alpha-beta sandwich, fla | 88.38 | |
| 1f4p_A | 147 | Flavodoxin; electron transport, flavoprotein, FMN, | 88.11 | |
| 1rtt_A | 193 | Conserved hypothetical protein; protein structure | 87.06 | |
| 3h75_A | 350 | Periplasmic sugar-binding domain protein; protein | 86.99 | |
| 4hs4_A | 199 | Chromate reductase; triple-layered, A/B/A structur | 86.84 | |
| 1rli_A | 184 | Trp repressor binding protein; structural genomics | 86.83 | |
| 3rot_A | 297 | ABC sugar transporter, periplasmic sugar binding; | 86.8 | |
| 4ici_A | 171 | Putative flavoprotein; PF12682 family protein, fla | 86.75 | |
| 1di0_A | 158 | Lumazine synthase; transferase; 2.70A {Brucella ab | 85.31 | |
| 3g1w_A | 305 | Sugar ABC transporter; sugar-binding protein, baci | 84.86 | |
| 3f2v_A | 192 | General stress protein 14; alpha-beta protein., st | 84.48 | |
| 1uuy_A | 167 | CNX1, molybdopterin biosynthesis CNX1; chelatase, | 84.41 | |
| 2hpv_A | 208 | FMN-dependent NADH-azoreductase; structural genomi | 84.11 | |
| 2pbq_A | 178 | Molybdenum cofactor biosynthesis MOG; molybdopteri | 83.2 | |
| 3qvl_A | 245 | Putative hydantoin racemase; isomerase; HET: 5HY; | 83.13 | |
| 3l6u_A | 293 | ABC-type sugar transport system periplasmic compo; | 82.82 | |
| 3edo_A | 151 | Flavoprotein, putative Trp repressor binding prote | 82.77 | |
| 2i0f_A | 157 | 6,7-dimethyl-8-ribityllumazine synthase 1; lumazin | 82.76 | |
| 1jlj_A | 189 | Gephyrin; globular alpha/beta fold, structural pro | 81.34 | |
| 2q9u_A | 414 | A-type flavoprotein; flavodoxin like, beta lactama | 80.99 | |
| 3cs3_A | 277 | Sugar-binding transcriptional regulator, LACI FAM; | 80.77 | |
| 3s2y_A | 199 | Chromate reductase; uranium reductase, oxidoreduct | 81.76 | |
| 2c92_A | 160 | 6,7-dimethyl-8-ribityllumazine synthase; transfera | 80.48 | |
| 1ehs_A | 48 | STB, heat-stable enterotoxin B; disulfide; NMR {Es | 80.32 |
| >3m3p_A Glutamine amido transferase; structural genomics, nysgrc, PSI-2; HET: MSE; 1.30A {Methylobacillus flagellatus} PDB: 3l83_A* | Back alignment and structure |
|---|
Probab=99.91 E-value=1.8e-24 Score=161.63 Aligned_cols=111 Identities=23% Similarity=0.367 Sum_probs=94.1
Q ss_pred CCCCeEEEEEcCCCchHHHHhhCCHHHHHHHHHhhCCCeEEEEEccCCC-CCCCCCCCCcCEEEEcCCCCCCCCCchHHH
Q 033165 1 MGGKKFAVLLCAEDSEYVKKKYGGYFGVFVRMLAEEGETWDVFHVARGE-FPDDDDFGSYDGYVITGSCNDAHGNDVWIC 79 (126)
Q Consensus 1 M~~~ki~Il~~~~~~~~~~~~~~~~~~~~~~~l~~~g~~~~~~~~~~~~-~p~~~~~~~~d~iii~G~~~~~~~~~~~~~ 79 (126)
|+++||+||++..... ...+.++|++.|.+++++++..++ +| ++++++|+|||+|||.+++++.+|+.
T Consensus 1 m~~~~vliiqh~~~e~---------~~~i~~~l~~~G~~v~v~~~~~~~~~p--~~~~~~d~lIl~GGp~~~~d~~~~~~ 69 (250)
T 3m3p_A 1 MSLKPVMIIQFSASEG---------PGHFGDFLAGEHIPFQVLRMDRSDPLP--AEIRDCSGLAMMGGPMSANDDLPWMP 69 (250)
T ss_dssp -CCCCEEEEESSSSCC---------CHHHHHHHHHTTCCEEEEEGGGTCCCC--SCGGGSSEEEECCCSSCTTSCCTTHH
T ss_pred CCCCeEEEEECCCCCC---------HHHHHHHHHHCCCeEEEEeccCCCcCc--CccccCCEEEECCCCCcccccchHHH
Confidence 8899999999976532 345778889999999999987654 33 35789999999999999888789999
Q ss_pred HHHHHHHHHHhcCCcEEEEchHHHHHHHHhCCccccCC-ccccc
Q 033165 80 KLIALLKQLDSLRKKVLGICFGHQVRAITVFSSHINAS-KIAGT 122 (126)
Q Consensus 80 ~~~~~i~~~~~~~~PvlGIC~G~Q~la~~~Gg~v~~~~-~~~g~ 122 (126)
.+.++|+++++.++|+||||+|+|+|+.++||+|.+.+ +.+||
T Consensus 70 ~~~~~i~~~~~~~~PvlGIC~G~Qll~~~lGG~V~~~~~~e~G~ 113 (250)
T 3m3p_A 70 TLLALIRDAVAQRVPVIGHCLGGQLLAKAMGGEVTDSPHAEIGW 113 (250)
T ss_dssp HHHHHHHHHHHHTCCEEEETHHHHHHHHHTTCCEEEEEEEEEEE
T ss_pred HHHHHHHHHHHcCCCEEEECHHHHHHHHHhCCEEEeCCCCceee
Confidence 99999999999999999999999999999999999764 56666
|
| >3l7n_A Putative uncharacterized protein; glutamine amidotransferase, transferas; 2.70A {Streptococcus mutans} | Back alignment and structure |
|---|
| >1o1y_A Conserved hypothetical protein TM1158; flavodoxin-like fold, structural genomics, joint center for structural genomics, JCSG; 1.70A {Thermotoga maritima} SCOP: c.23.16.1 | Back alignment and structure |
|---|
| >3r75_A Anthranilate/para-aminobenzoate synthases compone; ammonia channel, chorismate, type 1 glutamine amidotransfera phenazine biosynthesis, lyase; HET: CYG; 2.10A {Burkholderia SP} PDB: 3r74_A* 3r76_A* | Back alignment and structure |
|---|
| >2h2w_A Homoserine O-succinyltransferase; TM0881, (EC 2.3.1.46), HOM O-transsuccinylase, HTS, (TM0881), structural genomics; 2.52A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2vdj_A Homoserine O-succinyltransferase; methionine biosynthesis, amino-acid biosynthesis, homoserine transacetylase, homoserine transsuccinylase; 2.00A {Bacillus cereus} PDB: 2ghr_A | Back alignment and structure |
|---|
| >1qdl_B Protein (anthranilate synthase (TRPG-SUBUNIT)); tryptophan biosynthesis, glutamine amidotransferase, allosteric interaction, lyase; 2.50A {Sulfolobus solfataricus} SCOP: c.23.16.1 | Back alignment and structure |
|---|
| >2a9v_A GMP synthase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, ligase; 2.24A {Thermoplasma acidophilum} SCOP: c.23.16.1 | Back alignment and structure |
|---|
| >1wl8_A GMP synthase [glutamine-hydrolyzing] subunit A; transferase, gatases, riken structural genomics/proteomics initiative, RSGI; 1.45A {Pyrococcus horikoshii} SCOP: c.23.16.1 PDB: 2d7j_A | Back alignment and structure |
|---|
| >3uow_A GMP synthetase; structural genomics consortium, SGC, purine nucleotide biosy process, ligase; HET: XMP; 2.72A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2nv0_A Glutamine amidotransferase subunit PDXT; 3-layer(ABA) sandwich, rossmann fold, glutaminase; 1.73A {Bacillus subtilis} SCOP: c.23.16.1 PDB: 1r9g_A 2nv2_B* | Back alignment and structure |
|---|
| >1q7r_A Predicted amidotransferase; structural genomics, YAAE, PDX2, predicted glutamine amidotransferase, PSI; HET: MSE; 1.90A {Geobacillus stearothermophilus} SCOP: c.23.16.1 | Back alignment and structure |
|---|
| >1i1q_B Anthranilate synthase component II; tryptophan biosynthesis, lyase; HET: TRP; 1.90A {Salmonella typhimurium} SCOP: c.23.16.1 PDB: 1i7q_B 1i7s_B* | Back alignment and structure |
|---|
| >3tqi_A GMP synthase [glutamine-hydrolyzing]; ligase; 2.84A {Coxiella burnetii} | Back alignment and structure |
|---|
| >4gud_A Imidazole glycerol phosphate synthase subunit His; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE 1PE; 1.91A {Vibrio cholerae} | Back alignment and structure |
|---|
| >1a9x_B Carbamoyl phosphate synthetase (small chain); amidotransferase, thioester; HET: CYG ADP; 1.80A {Escherichia coli} SCOP: c.8.3.1 c.23.16.1 PDB: 1bxr_B* 1ce8_B* 1jdb_C* 1cs0_B* 1m6v_B* 1c30_B* 1c3o_B* 1kee_B* 1t36_B* | Back alignment and structure |
|---|
| >2ywj_A Glutamine amidotransferase subunit PDXT; uncharacterized conserved protein, structural genomics; 1.90A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >1gpm_A GMP synthetase, XMP aminase; class I glutamine amidotransferase, N-type ATP pyrophosphata transferase (glutamine amidotransferase); HET: AMP CIT; 2.20A {Escherichia coli} SCOP: c.23.16.1 c.26.2.1 d.52.2.1 | Back alignment and structure |
|---|
| >2w7t_A CTP synthetase, putative cytidine triphosphate synthase; glutaminase domain, trypsanosoma brucei, ligase, acivicin; HET: 5CS; 2.10A {Trypanosoma brucei} | Back alignment and structure |
|---|
| >2vpi_A GMP synthase; guanine monophosphate synthetase, phosphoprotein, GMP synthetase, GMP biosynthesis, glutamine amidotransferase, ligase, cytoplasm; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2abw_A PDX2 protein, glutaminase; PLP-synthase, vitamin B6, malaria, transferase; HET: PG4; 1.62A {Plasmodium falciparum} SCOP: c.23.16.1 PDB: 4ads_G | Back alignment and structure |
|---|
| >3fij_A LIN1909 protein; 11172J, uncharacterized protein, nysgrc, PSI-II, structural genomics, protein structure initiative; 2.30A {Listeria innocua} | Back alignment and structure |
|---|
| >3d54_D Phosphoribosylformylglycinamidine synthase 1; alpha-beta structure, ATP-binding, cytoplasm, ligase, nucleotide-binding, purine biosynthesis; HET: CYG ADP; 3.50A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2ywd_A Glutamine amidotransferase subunit PDXT; pyridoxine biosynthesis, structural genomics, NPPSFA; 1.90A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2ywb_A GMP synthase [glutamine-hydrolyzing]; GMP synthetase, XMP binding, ATP binding, purine nucleotide biosynthetic pathway, structural genomics; 2.10A {Thermus thermophilus} PDB: 2ywc_A* | Back alignment and structure |
|---|
| >1ka9_H Imidazole glycerol phosphtate synthase; riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; 2.30A {Thermus thermophilus} SCOP: c.23.16.1 | Back alignment and structure |
|---|
| >2iss_D Glutamine amidotransferase subunit PDXT; (beta/alpha)8-barrel, alpha/beta three layer sandwich, lyase transferase; HET: 5RP; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1gpw_B Amidotransferase HISH; lyase/transferase, complex (lyase/transferase), histidine biosynthesis, glutaminase, glutamine amidotransferase; 2.4A {Thermotoga maritima} SCOP: c.23.16.1 PDB: 1k9v_F 1kxj_A 2wjz_B | Back alignment and structure |
|---|
| >1l9x_A Gamma-glutamyl hydrolase; 1.60A {Homo sapiens} SCOP: c.23.16.1 | Back alignment and structure |
|---|
| >2vxo_A GMP synthase [glutamine-hydrolyzing]; proto-oncogene, phosphoprotein, GMP synthetase, guanine monophosphate synthetase, chromosomal rearrangement; HET: XMP; 2.5A {Homo sapiens} | Back alignment and structure |
|---|
| >3nva_A CTP synthase; rossman fold, nucleotide binding, LIG; 2.50A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2v4u_A CTP synthase 2; pyrimidine biosynthesis, glutamine amidotransferase, glutaminase domain, 5-OXO-L-norleucine, DON, ligase, phosphoprotein; HET: CYD; 2.3A {Homo sapiens} PDB: 2vkt_A | Back alignment and structure |
|---|
| >1vco_A CTP synthetase; tetramer, riken structural genomics/proteomics initiative, RSGI, structural genomics, ligase; HET: GLN; 2.15A {Thermus thermophilus} SCOP: c.23.16.1 c.37.1.10 PDB: 1vcn_A 1vcm_A | Back alignment and structure |
|---|
| >1s1m_A CTP synthase; CTP synthetase, UTP:ammonia ligase (ADP-forming), cytidine 5 triphosphate synthase, ammonia lyase; 2.30A {Escherichia coli} SCOP: c.23.16.1 c.37.1.10 PDB: 2ad5_A* | Back alignment and structure |
|---|
| >1jvn_A Glutamine, bifunctional histidine biosynthesis protein hishf; substrate channeling, amidotransferase, TIM-barrel AS A SUBS tunnel; HET: 143; 2.10A {Saccharomyces cerevisiae} SCOP: c.1.2.1 c.23.16.1 PDB: 1ox4_B* 1ox5_A* 1ox6_A 1ox4_A | Back alignment and structure |
|---|
| >1oi4_A Hypothetical protein YHBO; PFPI/THIJ family, complete proteome, PFPI, THIJ, bacterial targets at IGS-CNRS, france, BIGS, structural genomics; 2.03A {Escherichia coli} SCOP: c.23.16.2 | Back alignment and structure |
|---|
| >3l4e_A Uncharacterized peptidase LMO0363; hypothetical protein LMO0363, csgid, similar to peptidase E, hydrolase, protease, serine protease; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2rk3_A Protein DJ-1; parkinson'S disease, THIJ, PFPI, chaperone, cytoplasm, disease mutation, nucleus, oncogene, oxidation, parkinson disease; 1.05A {Homo sapiens} PDB: 1pdv_A 1pdw_A 3cy6_A 1pe0_A 3cza_A 3cyf_A 2rk4_A 3cz9_A* 3ezg_A 3f71_A 3sf8_A 1p5f_A 1ps4_A 1q2u_A 1soa_A 1ucf_A 2or3_A 3bwe_A 3b38_A 3b36_A ... | Back alignment and structure |
|---|
| >2vrn_A Protease I, DR1199; cysteine sulfenic acid, DJ-1/THIJ/PFPI superfamily, protease hydrolase, stress response; 2.15A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3ugj_A Phosphoribosylformylglycinamidine synthase; amidotransferase, glutaminase, thioester intermediate, ligas; HET: ADP; 1.78A {Salmonella enterica subsp} PDB: 1t3t_A* 3ujn_A* 3umm_A* | Back alignment and structure |
|---|
| >1vhq_A Enhancing lycopene biosynthesis protein 2; structural genomics, unknown function; 1.65A {Escherichia coli} SCOP: c.23.16.2 PDB: 1oy1_A | Back alignment and structure |
|---|
| >1fy2_A Aspartyl dipeptidase; serine protease, catalytic triad, strand-helix MO hydrolase; 1.20A {Salmonella typhimurium} SCOP: c.23.16.4 PDB: 1fye_A | Back alignment and structure |
|---|
| >3efe_A THIJ/PFPI family protein; structural GEN csgid, center for structural genomics of infectious disease chaperone; 2.30A {Bacillus anthracis} | Back alignment and structure |
|---|
| >3f5d_A Protein YDEA; unknow protein, PSI-II, nysgrc, structural genomics, protein structure initiative; 2.06A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3l18_A Intracellular protease I; gatase1_PFPI_LIKE, hydrolase; 1.78A {Thermococcus onnurineus} SCOP: c.23.16.2 PDB: 1g2i_A | Back alignment and structure |
|---|
| >2ab0_A YAJL; DJ-1/THIJ superfamily, alpha-beta hydrolase fold, unknown function; 1.10A {Escherichia coli} SCOP: c.23.16.2 | Back alignment and structure |
|---|
| >3kkl_A Probable chaperone protein HSP33; peptidase, heat shock protein, hydrolase, protease, stress response; 2.03A {Saccharomyces cerevisiae} PDB: 3mii_A* | Back alignment and structure |
|---|
| >1rw7_A YDR533CP; alpha-beta sandwich, DJ-1/THIJ/PFPI superfamily, unknown function; 1.80A {Saccharomyces cerevisiae} SCOP: c.23.16.2 PDB: 1qvv_A* 1qvz_A 1qvw_A | Back alignment and structure |
|---|
| >4e08_A DJ-1 beta; flavodoxin-like fold, stress response, motor protein; 2.00A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >4hcj_A THIJ/PFPI domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta-alpha sandwich; HET: MSE; 1.12A {Brachyspira murdochii} | Back alignment and structure |
|---|
| >3gra_A Transcriptional regulator, ARAC family; transcription regulator, PSI-II, structural genomics structure initiative; 2.30A {Pseudomonas putida} | Back alignment and structure |
|---|
| >3l3b_A ES1 family protein; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography, isopr biosynthesis; 1.90A {Ehrlichia chaffeensis} | Back alignment and structure |
|---|
| >3er6_A Putative transcriptional regulator protein; structural genomics, unknown function, DNA-binding, transcription regulation, PSI-2; 1.90A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >2fex_A Conserved hypothetical protein; structural genomics, protein structure initiative, PSI, MIDW center for structural genomics, MCSG; 1.70A {Agrobacterium tumefaciens} SCOP: c.23.16.2 | Back alignment and structure |
|---|
| >3cne_A Putative protease I; structural genomics, PSI-2, MCSG, protein struct initiative, midwest center for structural genomics; HET: FMN; 1.99A {Bacteroides thetaiotaomicron vpi-5482} | Back alignment and structure |
|---|
| >3ej6_A Catalase-3; heme, hydrogen iron, metal-binding, oxidoreductase, peroxidase; HET: NAG HEM; 2.30A {Neurospora crassa} | Back alignment and structure |
|---|
| >1u9c_A APC35852; structural genomics, protein structure initiative, MCSG, PAR disease, chaperone, cysteine protease, PSI; 1.35A {Geobacillus stearothermophilus} SCOP: c.23.16.2 | Back alignment and structure |
|---|
| >3n7t_A Macrophage binding protein; seattle structural genomics center for infectious disease, S macrophage, pathogenic fungus, coccidioidomycosis; 2.10A {Coccidioides immitis} SCOP: c.23.16.0 | Back alignment and structure |
|---|
| >3uk7_A Class I glutamine amidotransferase-like domain-CO protein; rossmann fold, cytosol; 2.05A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2iuf_A Catalase; oxidoreductase; HET: HDD NAG; 1.71A {Penicillium janthinellum} PDB: 2xf2_A* | Back alignment and structure |
|---|
| >1sy7_A Catalase 1; heme oxidation, singlet oxygen, oxidoreductase; HET: HDD HEM; 1.75A {Neurospora crassa} SCOP: c.23.16.3 | Back alignment and structure |
|---|
| >3noq_A THIJ/PFPI family protein; DJ-1 superfamily, isocyanide hydratase, isonitrIle hydratase; HET: NHE; 1.00A {Pseudomonas fluorescens} PDB: 3noo_A 3non_A 3nor_A* 3nov_A | Back alignment and structure |
|---|
| >3ttv_A Catalase HPII; heme orientation, oxidoreductase; HET: HEM; 1.45A {Escherichia coli} PDB: 3ttt_A* 1gge_A* 1iph_A* 4ens_A* 3ttu_A* 3p9p_A* 4enq_A* 1p81_A* 3ttx_A* 4enw_A* 3ttw_A* 4ent_A* 1qws_A* 1cf9_A* 1p80_A* 1qf7_A* 4enu_A* 4enp_A* 1gg9_A* 1ggf_A* ... | Back alignment and structure |
|---|
| >3ot1_A 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme; csgid, structural genomics; HET: MSE CSX; 1.16A {Vibrio cholerae o1 biovar el tor} SCOP: c.23.16.0 | Back alignment and structure |
|---|
| >3uk7_A Class I glutamine amidotransferase-like domain-CO protein; rossmann fold, cytosol; 2.05A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3fse_A Two-domain protein containing DJ-1/THIJ/PFPI-like ferritin-like domains; structural genomics; HET: MSE CSX; 1.90A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >3mgk_A Intracellular protease/amidase related enzyme (THIJ family); amidotranferase-like, structural genomics, PSI; 2.00A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >1n57_A Chaperone HSP31, protein YEDU; alpha-beta sandwich; 1.60A {Escherichia coli} SCOP: c.23.16.2 PDB: 1pv2_A 1izy_A 1ons_A 1izz_A | Back alignment and structure |
|---|
| >3ewn_A THIJ/PFPI family protein; monomer, PSI nysgrc, structural genomics, protein structure initiative; 1.65A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >4gdh_A DJ-1, uncharacterized protein C22E12.03C; unknown function, cysteine oxidation; 1.05A {Schizosaccharomyces pombe} PDB: 4ge3_A 4ge0_A | Back alignment and structure |
|---|
| >3bhn_A THIJ/PFPI domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 1.76A {Shewanella loihica pv-4} | Back alignment and structure |
|---|
| >3en0_A Cyanophycinase; serine protease, beta peptide specific, hydrolase, protease; 1.50A {Synechocystis SP} | Back alignment and structure |
|---|
| >2a5l_A Trp repressor binding protein WRBA; APC5760, PA0949, protein structure initiative, PSI, structural genomics; 1.70A {Pseudomonas aeruginosa} SCOP: c.23.5.8 PDB: 1zwk_A 1zwl_A* | Back alignment and structure |
|---|
| >1u0t_A Inorganic polyphosphate/ATP-NAD kinase; alpha-beta, beta sandwich, structural genomics, PSI, protein structure initiative; 2.30A {Mycobacterium tuberculosis} SCOP: e.52.1.1 PDB: 1u0r_A 1y3i_A* 1y3h_A | Back alignment and structure |
|---|
| >2zki_A 199AA long hypothetical Trp repressor binding protein; alpha/beta structure, transcription; 2.90A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >3rht_A (gatase1)-like protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 1.83A {Planctomyces limnophilus} | Back alignment and structure |
|---|
| >3pzy_A MOG; ssgcid, seattle structural genomics center for infectious DI biosynthetic protein; 1.80A {Mycobacterium avium subsp} PDB: 3oi9_A 2g4r_A | Back alignment and structure |
|---|
| >1di6_A MOGA, molybdenum cofactor biosynthetic enzyme; MOCO, MOCO biosynthesis, gephyrin function; 1.45A {Escherichia coli} SCOP: c.57.1.1 PDB: 1di7_A | Back alignment and structure |
|---|
| >2r47_A Uncharacterized protein MTH_862; unknown function, structural genomics, APC5901, PSI-2; 1.88A {Methanothermobacter thermautotrophicusorganism_taxid} | Back alignment and structure |
|---|
| >4e5v_A Putative THUA-like protein; THUA-like proteins, trehalose utilisation, structural genomi center for structural genomics, JCSG; 1.75A {Parabacteroides merdae} | Back alignment and structure |
|---|
| >3f6r_A Flavodoxin; FMN binding, oxidized, electron transport, flavoprotein, FMN, transport; HET: FMN; 2.00A {Desulfovibrio desulfuricans} SCOP: c.23.5.0 PDB: 3f6s_A* 3f90_A* 3kap_A* 3kaq_A* | Back alignment and structure |
|---|
| >2gk3_A Putative cytoplasmic protein; STM3548, structural genomics, PSI, P structure initiative; 2.25A {Salmonella typhimurium} SCOP: c.23.16.9 | Back alignment and structure |
|---|
| >2i2c_A Probable inorganic polyphosphate/ATP-NAD kinase 1; NADP bound of lmnadk1, transferase; HET: DTA PG4; 1.85A {Listeria monocytogenes egd-e} PDB: 2i1w_A* 2i2a_A* 2i2b_A* 2i29_A* 2i2d_A* 2i2e_A* 3v7u_A* 3v7w_A* 3v7y_A* 3v80_A* 3v8m_A* 3v8n_A* 3v8p_A* 4dy6_A* 2i2f_A* 2q5f_A* 3v8q_A* 3v8r_A* | Back alignment and structure |
|---|
| >2qv7_A Diacylglycerol kinase DGKB; alpha-beta domain 1, beta sandwich domain 2, protein-ADP COM transferase; HET: ADP; 2.30A {Staphylococcus aureus} SCOP: e.52.1.2 PDB: 2qvl_A | Back alignment and structure |
|---|
| >1eiw_A Hypothetical protein MTH538; CHEY-like fold, flavodoxin-like fold, (A/B)5 doubly wound fold, parallel beta sheet; NMR {Methanothermobacterthermautotrophicus} SCOP: c.23.3.1 | Back alignment and structure |
|---|
| >3rfq_A Pterin-4-alpha-carbinolamine dehydratase MOAB2; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: B3P; 2.25A {Mycobacterium marinum} PDB: 3tcr_A | Back alignment and structure |
|---|
| >3kbq_A Protein TA0487; structural genomics, CINA, protein structure initiative, MCS midwest center for structural genomics, unknown function; 2.00A {Thermoplasma acidophilum} | Back alignment and structure |
|---|
| >1z0s_A Probable inorganic polyphosphate/ATP-NAD kinase; ATP-binding, structural genomics, NADP, PSI, protein structure initiative; HET: ATP; 1.70A {Archaeoglobus fulgidus} SCOP: e.52.1.1 PDB: 1z0u_A* 1z0z_A* 1suw_A* | Back alignment and structure |
|---|
| >3ff4_A Uncharacterized protein; structural genomics, PSI- protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Cytophaga hutchinsonii atcc 33406} | Back alignment and structure |
|---|
| >2an1_A Putative kinase; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG, transferase; 2.00A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >1y5e_A Molybdenum cofactor biosynthesis protein B; structural genomics, protein structure initiative, PSI, MCSG, midwest center for structural genomics; 1.90A {Bacillus cereus} SCOP: c.57.1.1 | Back alignment and structure |
|---|
| >1e2b_A Enzyme IIB-cellobiose; phosphotransferase system, transferas transport, phosphorylation; NMR {Escherichia coli} SCOP: c.44.2.1 PDB: 1iib_A 1h9c_A* 2wwv_D 2wy2_D | Back alignment and structure |
|---|
| >1t0b_A THUA-like protein; trehalose metabolism, NCS symmetry, structural genomics, PSI, protein structure initiative; 1.70A {Geobacillus stearothermophilus} SCOP: c.23.16.6 | Back alignment and structure |
|---|
| >2ark_A Flavodoxin; FMN, structural genomics, PSI, structure initiative, midwest center for structural genomic electron transport; 2.40A {Aquifex aeolicus} SCOP: c.23.5.8 | Back alignment and structure |
|---|
| >1mkz_A Molybdenum cofactor biosynthesis protein B; MAD, WEAK anomalous signal, molybdopterin synthesis, structural genomics, PSI; HET: MSE; 1.60A {Escherichia coli} SCOP: c.57.1.1 PDB: 1r2k_B | Back alignment and structure |
|---|
| >4gi5_A Quinone reductase; protein structure initiative, FAD bound, structural genomics, PSI-biology; HET: FAD; 1.75A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >1ydg_A Trp repressor binding protein WRBA; tetramer, structural genomics, PSI, protein structure initiative; 2.00A {Deinococcus radiodurans} SCOP: c.23.5.8 PDB: 1yrh_A* | Back alignment and structure |
|---|
| >3b6i_A Flavoprotein WRBA; flavoproteins, NADH:quinone oxidoreductase, FMN; HET: FMN 15P; 1.66A {Escherichia coli} PDB: 2r96_A* 2r97_A 2rg1_A* 3b6j_A* 3b6k_A* 3b6m_A* | Back alignment and structure |
|---|
| >1t5b_A Acyl carrier protein phosphodiesterase; structural genomics, FMN, alpha/beta/alpha sandwich, PSI, protein structure initiative; HET: FMN; 1.40A {Salmonella typhimurium} SCOP: c.23.5.3 PDB: 1tik_A 2z98_A* 2d5i_A* 1v4b_A* 2z9b_A* 2z9c_A* 2z9d_A* | Back alignment and structure |
|---|
| >2g2c_A Putative molybdenum cofactor biosynthesis protein; structural genomics, PSI, protein structure initiative; 1.50A {Corynebacterium diphtheriae} SCOP: c.57.1.1 | Back alignment and structure |
|---|
| >2vzf_A NADH-dependent FMN reductase; oxidoreductase; 2.50A {Edta-degrading bacterium BNC1} PDB: 2vzh_A* 2vzj_A* | Back alignment and structure |
|---|
| >3iwt_A 178AA long hypothetical molybdenum cofactor biosy protein B; biosynthesis, structural genomics, UNKN function, NPPSFA; HET: PEG; 1.90A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >3klb_A Putative flavoprotein; structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: FMN; 1.75A {Bacteroides fragilis nctc 9343} | Back alignment and structure |
|---|
| >2is8_A Molybdopterin biosynthesis enzyme, MOAB; globular alpha/beta fold, structu genomics, NPPSFA; 1.64A {Thermus thermophilus} PDB: 3mch_A | Back alignment and structure |
|---|
| >2q62_A ARSH; alpha/beta, flavoprotein; 1.80A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2zuv_A Lacto-N-biose phosphorylase; beta-alpha-barrel, TIM barrel, glycosyltransferase, transferase; HET: NDG; 1.85A {Bifidobacterium longum} PDB: 2zus_A* 2zuu_A* 2zut_A* 2zuw_A* | Back alignment and structure |
|---|
| >2hna_A Protein MIOC, flavodoxin; alpha-beta sandwich, flavodoxin fold, electron transport; NMR {Escherichia coli} PDB: 2hnb_A | Back alignment and structure |
|---|
| >1f4p_A Flavodoxin; electron transport, flavoprotein, FMN, 3D-STRCTURE, anisotropic refinement, redox protein; HET: FMN; 1.30A {Desulfovibrio vulgaris} SCOP: c.23.5.1 PDB: 1bu5_A* 1c7f_A* 1c7e_A* 1akr_A* 1fx1_A* 1akt_A* 1akq_A* 1aku_A* 1akv_A* 1azl_A* 1j8q_A* 2fx2_A* 3fx2_A* 4fx2_A* 5fx2_A* 1akw_A* 1i1o_A* 1wsw_A* 1wsb_A* 1xyv_A* ... | Back alignment and structure |
|---|
| >1rtt_A Conserved hypothetical protein; protein structure initiative, SAD with sulfur, putative REDU PSI; 1.28A {Pseudomonas aeruginosa} SCOP: c.23.5.4 PDB: 1x77_A* | Back alignment and structure |
|---|
| >3h75_A Periplasmic sugar-binding domain protein; protein structure initiative II (PSI II), sugar binding PROT alpha/beta fold; 1.60A {Pseudomonas fluorescens pf-5} | Back alignment and structure |
|---|
| >4hs4_A Chromate reductase; triple-layered, A/B/A structure, NAD(P)H-dependent FMN reduc oxidoreductase; HET: FMN; 2.10A {Gluconacetobacter hansenii} PDB: 3s2y_A* 4h6p_A* | Back alignment and structure |
|---|
| >1rli_A Trp repressor binding protein; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.80A {Bacillus subtilis} SCOP: c.23.5.6 | Back alignment and structure |
|---|
| >3rot_A ABC sugar transporter, periplasmic sugar binding; nysgrc, PSI-biology, structural genomics; 1.91A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >4ici_A Putative flavoprotein; PF12682 family protein, flavodoxin_4, structural genomics, J center for structural genomics, JCSG; HET: MSE FMN EPE; 1.40A {Bacteroides eggerthii} | Back alignment and structure |
|---|
| >1di0_A Lumazine synthase; transferase; 2.70A {Brucella abortus} SCOP: c.16.1.1 PDB: 1t13_A* 1xn1_A | Back alignment and structure |
|---|
| >3g1w_A Sugar ABC transporter; sugar-binding protein, bacillus halod target 11229F, transport protein, structural genomics; 2.02A {Bacillus halodurans c-125} | Back alignment and structure |
|---|
| >3f2v_A General stress protein 14; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: FMN; 2.00A {Treponema denticola} | Back alignment and structure |
|---|
| >1uuy_A CNX1, molybdopterin biosynthesis CNX1; chelatase, molybdenum cofactor biosynthesis; HET: MTE AMP; 1.45A {Arabidopsis thaliana} SCOP: c.57.1.1 PDB: 1o8q_A 1o8n_A 1o8o_A 1uux_A* 1eav_A | Back alignment and structure |
|---|
| >2hpv_A FMN-dependent NADH-azoreductase; structural genomics, PS protein structure initiative, southeast collaboratory for S genomics, secsg; HET: FMN; 2.00A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >2pbq_A Molybdenum cofactor biosynthesis MOG; molybdopterin, MPT, structural genomics, NPPSFA, national PR protein structural and functional analyses; 1.70A {Aquifex aeolicus} PDB: 2qq1_A 3mci_A 3mcj_A 3k6a_A* 2f7w_A 2f7y_A 2fuw_A | Back alignment and structure |
|---|
| >3qvl_A Putative hydantoin racemase; isomerase; HET: 5HY; 1.82A {Klebsiella pneumoniae subsp} PDB: 3qvk_A* 3qvj_A | Back alignment and structure |
|---|
| >3l6u_A ABC-type sugar transport system periplasmic compo; structural genomics, nysgrc, target 11006S, PSI-2, protein S initiative; 1.90A {Exiguobacterium sibiricum} | Back alignment and structure |
|---|
| >3edo_A Flavoprotein, putative Trp repressor binding protein; YP_193882.1, flavoprotein in complex with FMN, structural genomics; HET: MSE FMN; 1.20A {Lactobacillus acidophilus ncfm} | Back alignment and structure |
|---|
| >2i0f_A 6,7-dimethyl-8-ribityllumazine synthase 1; lumazine synthase RIBH1, transferase; 2.22A {Brucella abortus} PDB: 2f59_A 2o6h_A* | Back alignment and structure |
|---|
| >1jlj_A Gephyrin; globular alpha/beta fold, structural protein; 1.60A {Homo sapiens} SCOP: c.57.1.1 PDB: 1ihc_A | Back alignment and structure |
|---|
| >2q9u_A A-type flavoprotein; flavodoxin like, beta lactamase like, oxidoreductase; HET: FMN; 1.90A {Giardia intestinalis} | Back alignment and structure |
|---|
| >3cs3_A Sugar-binding transcriptional regulator, LACI FAM; structural genomics, sugar-binding transcriptional regulator structure initiative; 2.40A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >3s2y_A Chromate reductase; uranium reductase, oxidoreductase; HET: FMN PG4; 2.24A {Gluconacetobacter hansenii} | Back alignment and structure |
|---|
| >2c92_A 6,7-dimethyl-8-ribityllumazine synthase; transferase, riboflavin biosynthesis, inhibitor binding; HET: TP6; 1.6A {Mycobacterium tuberculosis} PDB: 1w29_A* 1w19_A* 2c94_A* 2c97_A* 2c9b_A* 2c9d_A* 2vi5_A* | Back alignment and structure |
|---|
| >1ehs_A STB, heat-stable enterotoxin B; disulfide; NMR {Escherichia coli} SCOP: g.2.1.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 126 | ||||
| d2ghra1 | 281 | c.23.16.8 (A:17-297) Homoserine O-succinyltransfer | 4e-04 | |
| d1l9xa_ | 288 | c.23.16.1 (A:) gamma-glutamyl hydrolase {Human (Ho | 0.001 |
| >d2ghra1 c.23.16.8 (A:17-297) Homoserine O-succinyltransferase HTS (MetA) {Bacillus cereus [TaxId: 1396]} Length = 281 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Flavodoxin-like superfamily: Class I glutamine amidotransferase-like family: HTS-like domain: Homoserine O-succinyltransferase HTS (MetA) species: Bacillus cereus [TaxId: 1396]
Score = 36.2 bits (83), Expect = 4e-04
Identities = 15/83 (18%), Positives = 31/83 (37%), Gaps = 5/83 (6%)
Query: 28 VFVRMLAEEGETWDVFHVAR--GEFPDDDDFGSYDGYVITGSCNDA--HGNDVWICKLIA 83
+ M + H+ F D ++ +DG +ITG+ + + +L
Sbjct: 52 HLLHMESHLSRNVAQEHLTSFYKTFRDIENEK-FDGLIITGAPVETLSFEEVDYWEELKR 110
Query: 84 LLKQLDSLRKKVLGICFGHQVRA 106
+++ + L IC+G Q
Sbjct: 111 IMEYSKTNVTSTLHICWGAQAGL 133
|
| >d1l9xa_ c.23.16.1 (A:) gamma-glutamyl hydrolase {Human (Homo sapiens) [TaxId: 9606]} Length = 288 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 126 | |||
| d1o1ya_ | 230 | Hypothetical protein TM1158 {Thermotoga maritima [ | 99.92 | |
| d2a9va1 | 196 | GMP synthase subunit A, GuaAA {Archaeon Thermoplas | 99.85 | |
| d1qdlb_ | 195 | Anthranilate synthase GAT subunit, TrpG {Archaeon | 99.81 | |
| d1i7qb_ | 192 | Anthranilate synthase GAT subunit, TrpG {Serratia | 99.79 | |
| d1a9xb2 | 228 | Carbamoyl phosphate synthetase, small subunit C-te | 99.79 | |
| d1gpma2 | 205 | GMP synthetase {Escherichia coli [TaxId: 562]} | 99.78 | |
| d1wl8a1 | 188 | GMP synthase subunit A, GuaAA {Archaeon Pyrococcus | 99.77 | |
| d1q7ra_ | 202 | Hypothetical protein YaaE {Bacillus stearothermoph | 99.75 | |
| d2nv0a1 | 195 | Hypothetical protein YaaE {Bacillus subtilis [TaxI | 99.73 | |
| d2ghra1 | 281 | Homoserine O-succinyltransferase HTS (MetA) {Bacil | 99.72 | |
| d1k9vf_ | 200 | GAT subunit, HisH, (or domain) of imidazoleglycero | 99.54 | |
| d1jvna2 | 232 | GAT subunit, HisH, (or domain) of imidazoleglycero | 99.51 | |
| d2abwa1 | 218 | Pyridoxine biosynthesis protein 2, Pdx2 {Malaria p | 99.46 | |
| d1ka9h_ | 195 | GAT subunit, HisH, (or domain) of imidazoleglycero | 99.44 | |
| d1l9xa_ | 288 | gamma-glutamyl hydrolase {Human (Homo sapiens) [Ta | 99.36 | |
| d1vcoa1 | 250 | CTP synthase PyrG, C-terminal domain {Thermus ther | 99.25 | |
| d1s1ma1 | 258 | CTP synthase PyrG, C-terminal domain {Escherichia | 99.21 | |
| d1t3ta2 | 262 | FGAM synthase PurL, amidotransferase domain {Salmo | 99.14 | |
| d1vhqa_ | 217 | Putative sigma cross-reacting protein 27A (SCRP-27 | 99.08 | |
| d1u9ca_ | 221 | GK2698 ortholog {Bacillus stearothermophilus [TaxI | 98.81 | |
| d1p5fa_ | 186 | DJ-1 {Human (Homo sapiens) [TaxId: 9606]} | 98.77 | |
| d1oi4a1 | 170 | Hypothetical protein YhbO {Escherichia coli [TaxId | 98.77 | |
| d1p80a1 | 156 | Catalase, C-terminal domain {Escherichia coli, HPI | 98.77 | |
| d1g2ia_ | 166 | Intracellular protease {Archaeon Pyrococcus horiko | 98.76 | |
| d1sy7a1 | 184 | Catalase, C-terminal domain {Neurospora crassa [Ta | 98.76 | |
| d2fexa1 | 188 | Hypothetical protein Atu0886 {Agrobacterium tumefa | 98.71 | |
| d1n57a_ | 279 | HSP31 (HchA; YedU) {Escherichia coli [TaxId: 562]} | 98.46 | |
| d1qvwa_ | 236 | Hypothetical protein Ydr533Cp {Baker's yeast (Sacc | 98.46 | |
| d2ab0a1 | 195 | Protein ThiJ (YajL) {Escherichia coli [TaxId: 562] | 98.36 | |
| d1fyea_ | 229 | Aspartyl dipeptidase PepE {Salmonella typhimurium | 96.47 | |
| d1t0ba_ | 240 | GK2113 homologue {Bacillus stearothermophilus [Tax | 95.27 | |
| d1u0ta_ | 302 | Inorganic polyphosphate/ATP-NAD kinase PpnK {Mycob | 95.06 | |
| d1z0sa1 | 249 | Inorganic polyphosphate/ATP-NAD kinase PpnK {Archa | 93.73 | |
| d2arka1 | 184 | Flavodoxin FldA {Aquifex aeolicus [TaxId: 63363]} | 93.48 | |
| d1e5da1 | 152 | Rubredoxin oxygen:oxidoreductase (ROO), C-terminal | 90.85 | |
| d1vmea1 | 148 | ROO-like flavoprotein TM0755, C-terminal domain {T | 90.74 | |
| d1ycga1 | 149 | Nitric oxide reductase C-terminal domain {Moorella | 90.36 | |
| d1a9xa4 | 121 | Carbamoyl phosphate synthetase (CPS), large subuni | 89.47 | |
| d1wu2a3 | 144 | MoeA, central domain {Pyrococcus horikoshii, PH164 | 87.91 | |
| d1eiwa_ | 111 | Hypothetical protein MTH538 {Archaeon Methanobacte | 87.57 | |
| d1iowa1 | 96 | D-Ala-D-Ala ligase, N-domain {Escherichia coli, ge | 86.22 | |
| d1t0ia_ | 185 | Hypothetical protein Ylr011wp {Baker's yeast (Sacc | 85.22 | |
| d2ftsa3 | 155 | Gephyrin, domain 5 {Rat (Rattus norvegicus) [TaxId | 85.09 | |
| d1uz5a3 | 148 | MoeA, central domain {Archaeon Pyrococcus horikosh | 85.08 | |
| d1nni1_ | 171 | Azobenzene reductase {Bacillus subtilis [TaxId: 14 | 84.99 | |
| d1ydga_ | 201 | Trp repressor binding protein WrbA {Deinococcus ra | 84.99 | |
| d2jfga1 | 93 | UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase | 84.35 | |
| d2qwxa1 | 230 | Quinone reductase type 2 (menadione reductase) {Hu | 84.18 | |
| d1dxya2 | 131 | D-2-hydroxyisocaproate dehydrogenase {Lactobacillu | 81.43 | |
| d1ehsa_ | 48 | Heat-stable enterotoxin B {Escherichia coli [TaxId | 80.32 | |
| d1tjya_ | 316 | AI-2 receptor LsrB {Salmonella typhi [TaxId: 90370 | 80.29 | |
| d2a5la1 | 196 | Trp repressor binding protein WrbA {Pseudomonas ae | 80.15 |
| >d1o1ya_ c.23.16.1 (A:) Hypothetical protein TM1158 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Flavodoxin-like superfamily: Class I glutamine amidotransferase-like family: Class I glutamine amidotransferases (GAT) domain: Hypothetical protein TM1158 species: Thermotoga maritima [TaxId: 2336]
Probab=99.92 E-value=3.7e-25 Score=161.53 Aligned_cols=105 Identities=18% Similarity=0.294 Sum_probs=90.0
Q ss_pred CCCeEEEEEcCCCchHHHHhhCCHHHHHHHHHhhCCCeEEEEEccCCC-CCCCCCCCCcCEEEEcCCCCCCCCCc--hHH
Q 033165 2 GGKKFAVLLCAEDSEYVKKKYGGYFGVFVRMLAEEGETWDVFHVARGE-FPDDDDFGSYDGYVITGSCNDAHGND--VWI 78 (126)
Q Consensus 2 ~~~ki~Il~~~~~~~~~~~~~~~~~~~~~~~l~~~g~~~~~~~~~~~~-~p~~~~~~~~d~iii~G~~~~~~~~~--~~~ 78 (126)
..|||+||++.+... .+.+.++|++.|.+++++++...+ +| +++++||+|||+|||.+++++. +|+
T Consensus 2 ~~mrvli~qh~~~e~---------~G~~~~~l~~~g~~~~~~~~~~~~~~p--~~l~~~d~iii~Ggp~~~~d~~~~~~~ 70 (230)
T d1o1ya_ 2 HHVRVLAIRHVEIED---------LGMMEDIFREKNWSFDYLDTPKGEKLE--RPLEEYSLVVLLGGYMGAYEEEKYPFL 70 (230)
T ss_dssp CCCEEEEECSSTTSS---------CTHHHHHHHHTTCEEEEECGGGTCCCS--SCGGGCSEEEECCCSCCTTCTTTCTHH
T ss_pred CceEEEEEECCCCCC---------cHHHHHHHHHCCCEEEEEECCCCCcCC--cchhhCCEEEEcCCCcccccchhhhhh
Confidence 358999999987643 234778888899999999987554 33 3678999999999999998764 899
Q ss_pred HHHHHHHHHHHhcCCcEEEEchHHHHHHHHhCCccccCC
Q 033165 79 CKLIALLKQLDSLRKKVLGICFGHQVRAITVFSSHINAS 117 (126)
Q Consensus 79 ~~~~~~i~~~~~~~~PvlGIC~G~Q~la~~~Gg~v~~~~ 117 (126)
..+.++|+++++.++|+||||+|||+|++++||+|.+++
T Consensus 71 ~~~~~~i~~~~~~~~PilGIC~G~Qlla~alGg~V~~~~ 109 (230)
T d1o1ya_ 71 KYEFQLIEEILKKEIPFLGICLGSQMLAKVLGASVYRGK 109 (230)
T ss_dssp HHHHHHHHHHHHHTCCEEEETHHHHHHHHHTTCCEEECT
T ss_pred HHHHHHHHHHHHhcceEEEeecCHHHHHHHhcccccccc
Confidence 999999999999999999999999999999999999865
|
| >d2a9va1 c.23.16.1 (A:1-196) GMP synthase subunit A, GuaAA {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1qdlb_ c.23.16.1 (B:) Anthranilate synthase GAT subunit, TrpG {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1i7qb_ c.23.16.1 (B:) Anthranilate synthase GAT subunit, TrpG {Serratia marcescens [TaxId: 615]} | Back information, alignment and structure |
|---|
| >d1a9xb2 c.23.16.1 (B:1653-1880) Carbamoyl phosphate synthetase, small subunit C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gpma2 c.23.16.1 (A:3-207) GMP synthetase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wl8a1 c.23.16.1 (A:1-188) GMP synthase subunit A, GuaAA {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1q7ra_ c.23.16.1 (A:) Hypothetical protein YaaE {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d2nv0a1 c.23.16.1 (A:1-195) Hypothetical protein YaaE {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2ghra1 c.23.16.8 (A:17-297) Homoserine O-succinyltransferase HTS (MetA) {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1k9vf_ c.23.16.1 (F:) GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2abwa1 c.23.16.1 (A:2-219) Pyridoxine biosynthesis protein 2, Pdx2 {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1ka9h_ c.23.16.1 (H:) GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1l9xa_ c.23.16.1 (A:) gamma-glutamyl hydrolase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vcoa1 c.23.16.1 (A:298-547) CTP synthase PyrG, C-terminal domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1s1ma1 c.23.16.1 (A:287-544) CTP synthase PyrG, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1t3ta2 c.23.16.1 (A:1034-1295) FGAM synthase PurL, amidotransferase domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1vhqa_ c.23.16.2 (A:) Putative sigma cross-reacting protein 27A (SCRP-27A, EllB) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1u9ca_ c.23.16.2 (A:) GK2698 ortholog {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1p5fa_ c.23.16.2 (A:) DJ-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oi4a1 c.23.16.2 (A:23-192) Hypothetical protein YhbO {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1p80a1 c.23.16.3 (A:598-753) Catalase, C-terminal domain {Escherichia coli, HPII [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g2ia_ c.23.16.2 (A:) Intracellular protease {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1sy7a1 c.23.16.3 (A:553-736) Catalase, C-terminal domain {Neurospora crassa [TaxId: 5141]} | Back information, alignment and structure |
|---|
| >d2fexa1 c.23.16.2 (A:1-188) Hypothetical protein Atu0886 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1n57a_ c.23.16.2 (A:) HSP31 (HchA; YedU) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qvwa_ c.23.16.2 (A:) Hypothetical protein Ydr533Cp {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ab0a1 c.23.16.2 (A:2-196) Protein ThiJ (YajL) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1fyea_ c.23.16.4 (A:) Aspartyl dipeptidase PepE {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1t0ba_ c.23.16.6 (A:) GK2113 homologue {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1u0ta_ e.52.1.1 (A:) Inorganic polyphosphate/ATP-NAD kinase PpnK {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1z0sa1 e.52.1.1 (A:1-249) Inorganic polyphosphate/ATP-NAD kinase PpnK {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2arka1 c.23.5.8 (A:1-184) Flavodoxin FldA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1e5da1 c.23.5.1 (A:251-402) Rubredoxin oxygen:oxidoreductase (ROO), C-terminal domain {Desulfovibrio gigas [TaxId: 879]} | Back information, alignment and structure |
|---|
| >d1vmea1 c.23.5.1 (A:251-398) ROO-like flavoprotein TM0755, C-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ycga1 c.23.5.1 (A:251-399) Nitric oxide reductase C-terminal domain {Moorella thermoacetica [TaxId: 1525]} | Back information, alignment and structure |
|---|
| >d1a9xa4 c.30.1.1 (A:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wu2a3 c.57.1.2 (A:181-324) MoeA, central domain {Pyrococcus horikoshii, PH1647 [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1eiwa_ c.23.3.1 (A:) Hypothetical protein MTH538 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1iowa1 c.30.1.2 (A:1-96) D-Ala-D-Ala ligase, N-domain {Escherichia coli, gene ddlB [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1t0ia_ c.23.5.4 (A:) Hypothetical protein Ylr011wp {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ftsa3 c.57.1.2 (A:499-653) Gephyrin, domain 5 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1uz5a3 c.57.1.2 (A:181-328) MoeA, central domain {Archaeon Pyrococcus horikoshii, PH0582 [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1nni1_ c.23.5.4 (1:) Azobenzene reductase {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1ydga_ c.23.5.8 (A:) Trp repressor binding protein WrbA {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2qwxa1 c.23.5.3 (A:1-230) Quinone reductase type 2 (menadione reductase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dxya2 c.23.12.1 (A:1-100,A:300-330) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} | Back information, alignment and structure |
|---|
| >d1ehsa_ g.2.1.1 (A:) Heat-stable enterotoxin B {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1tjya_ c.93.1.1 (A:) AI-2 receptor LsrB {Salmonella typhi [TaxId: 90370]} | Back information, alignment and structure |
|---|
| >d2a5la1 c.23.5.8 (A:3-198) Trp repressor binding protein WrbA {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|