Citrus Sinensis ID: 033233


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120----
MALRRAVLDHVRVPVQTLALTGSKQRWSVLGSLRFMSSHDDHLTKEEVIDRVLSVVKCFPKVDPSQVTPDVHFQKDLGLDSLDNVEIVMALEEEFKLEIPDKEAVRIDACNLAIEYIYNHPMAS
cHHHHHHHHHHcccccHHHHccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHcccccccHHHHccccHHHHHHHHHHccccc
cHHHHHHHHHccccccccccccccccccHHHHHHHHccccccccHHHHHHHHHHHHHHHHcccHHHcccccEccccccccHHHHHHHHHHHHHHHcccccHHHHccccEHHHHHHHHHHccccc
MALRRAVLDHVRVPVQTLALTGSKQRWSVLGslrfmsshddhltkeEVIDRVLSVVkcfpkvdpsqvtpdvhfqkdlgldsldNVEIVMALEEEfkleipdkeavRIDACNLAIEYIYNHPMAS
malrravldhvrvpvqtlaltgskqrwSVLGSLRFMSSHDDHLTKEEVIDRVLSVVKCFPkvdpsqvtpdvhfqkdlgldsLDNVEIVMALEeefkleipdkeaVRIDACNLAIEYIYNHPMAS
MALRRAVLDHVRVPVQTLALTGSKQRWSVLGSLRFMSSHDDHLTKEEVIDRVLSVVKCFPKVDPSQVTPDVHFQKDLGLDSLDNVEIVMALEEEFKLEIPDKEAVRIDACNLAIEYIYNHPMAS
*****AVLDHVRVPVQTLALTGSKQRWSVLGSLRFMSSHDDHLTKEEVIDRVLSVVKCFPKVDPSQVTPDVHFQKDLGLDSLDNVEIVMALEEEFKLEIPDKEAVRIDACNLAIEYIYN*****
**LR***LDHV***********************************EVIDRVLSVVKCFPKVDPSQVTPDVHFQKDLGLDSLDNVEIVMALEEEFKLEIPDKEAVRIDACNLAIEY*YNH****
MALRRAVLDHVRVPVQTLALTGSKQRWSVLGSLRFMSSHDDHLTKEEVIDRVLSVVKCFPKVDPSQVTPDVHFQKDLGLDSLDNVEIVMALEEEFKLEIPDKEAVRIDACNLAIEYIYNHPMAS
******VLDHVRVPVQTLALTGSKQRWSVLGSLRFMSSHDDHLTKEEVIDRVLSVVKCFPKVDPSQVTPDVHFQKDLGLDSLDNVEIVMALEEEFKLEIPDKEAVRIDACNLAIEYIYNH****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MALRRAVLDHVRVPVQTLALTGSKQRWSVLGSLRFMSSHDDHLTKEEVIDRVLSVVKCFPKVDPSQVTPDVHFQKDLGLDSLDNVEIVMALEEEFKLEIPDKEAVRIDACNLAIEYIYNHPMAS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query124 2.2.26 [Sep-21-2011]
P53665122 Acyl carrier protein 1, m yes no 0.983 1.0 0.733 5e-48
O80800126 Acyl carrier protein 2, m no no 0.967 0.952 0.539 2e-25
P11943134 Acyl carrier protein, mit N/A no 0.911 0.843 0.452 3e-20
Q9FGJ4131 Acyl carrier protein 3, m no no 0.951 0.900 0.366 8e-17
Q85FZ091 Acyl carrier protein OS=C N/A no 0.629 0.857 0.487 7e-16
Q10217112 Putative acyl carrier pro yes no 0.693 0.767 0.489 2e-15
P32463125 Acyl carrier protein, mit yes no 0.709 0.704 0.442 3e-15
Q54E22120 Acyl carrier protein, mit yes no 0.653 0.675 0.463 1e-14
Q0MQC3156 Acyl carrier protein, mit yes no 0.604 0.480 0.506 2e-14
O14561156 Acyl carrier protein, mit yes no 0.604 0.480 0.506 2e-14
>sp|P53665|ACPM1_ARATH Acyl carrier protein 1, mitochondrial OS=Arabidopsis thaliana GN=MTACP1 PE=2 SV=1 Back     alignment and function desciption
 Score =  189 bits (479), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 107/124 (86%), Gaps = 2/124 (1%)

Query: 1   MALRRAVLDHVRVPVQTLALTGSKQRWSVLGSLRFMSSHDDHLTKEEVIDRVLSVVKCFP 60
           MALR A+L H+RVPVQTL L  SK  +  LG++R  SSHDDHL++E V+DRVL VVK FP
Sbjct: 1   MALRNAILRHLRVPVQTLGLNQSKIGF--LGTIRSFSSHDDHLSREAVVDRVLDVVKSFP 58

Query: 61  KVDPSQVTPDVHFQKDLGLDSLDNVEIVMALEEEFKLEIPDKEAVRIDACNLAIEYIYNH 120
           KVDPS+VTP+VHFQ DLGLDSLD VEIVMA+EEEFKLEIPDKEA +ID+C+LAIEY+YNH
Sbjct: 59  KVDPSKVTPEVHFQNDLGLDSLDTVEIVMAIEEEFKLEIPDKEADKIDSCSLAIEYVYNH 118

Query: 121 PMAS 124
           PM+S
Sbjct: 119 PMSS 122




Carrier of the growing fatty acid chain in fatty acid biosynthesis (By similarity). May be involved in the synthesis of short and medium chain fatty acids. Accessory and non-catalytic subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), which functions in the transfer of electrons from NADH to the respiratory chain.
Arabidopsis thaliana (taxid: 3702)
>sp|O80800|ACPM2_ARATH Acyl carrier protein 2, mitochondrial OS=Arabidopsis thaliana GN=MTACP2 PE=1 SV=1 Back     alignment and function description
>sp|P11943|ACPM_NEUCR Acyl carrier protein, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nuo-12 PE=1 SV=2 Back     alignment and function description
>sp|Q9FGJ4|ACPM3_ARATH Acyl carrier protein 3, mitochondrial OS=Arabidopsis thaliana GN=MTACP2 PE=2 SV=1 Back     alignment and function description
>sp|Q85FZ0|ACP_CYAME Acyl carrier protein OS=Cyanidioschyzon merolae GN=acpP PE=3 SV=1 Back     alignment and function description
>sp|Q10217|ACPM_SCHPO Putative acyl carrier protein, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4H3.09 PE=3 SV=1 Back     alignment and function description
>sp|P32463|ACPM_YEAST Acyl carrier protein, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ACP1 PE=1 SV=1 Back     alignment and function description
>sp|Q54E22|ACPM_DICDI Acyl carrier protein, mitochondrial OS=Dictyostelium discoideum GN=ndufab1 PE=3 SV=1 Back     alignment and function description
>sp|Q0MQC3|ACPM_PANTR Acyl carrier protein, mitochondrial OS=Pan troglodytes GN=NDUFAB1 PE=2 SV=1 Back     alignment and function description
>sp|O14561|ACPM_HUMAN Acyl carrier protein, mitochondrial OS=Homo sapiens GN=NDUFAB1 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query124
224137194122 predicted protein [Populus trichocarpa] 0.983 1.0 0.782 6e-48
118487082122 unknown [Populus trichocarpa] 0.983 1.0 0.774 1e-47
449487570126 PREDICTED: acyl carrier protein 1, mitoc 1.0 0.984 0.753 7e-47
15224918122 acyl carrier protein 1 [Arabidopsis thal 0.983 1.0 0.733 2e-46
210110108124 acyl carrier protein 3-3 [Arachis hypoga 1.0 1.0 0.741 4e-46
357507891119 Acyl carrier protein [Medicago truncatul 0.959 1.0 0.75 5e-46
210109926124 acyl carrier protein 3-1 [Arachis hypoga 1.0 1.0 0.733 6e-46
210110001124 acyl carrier protein 3-2 [Arachis hypoga 1.0 1.0 0.741 6e-46
297824487122 mtACP-1 [Arabidopsis lyrata subsp. lyrat 0.983 1.0 0.725 7e-46
225453262124 PREDICTED: acyl carrier protein 1, mitoc 0.983 0.983 0.777 1e-45
>gi|224137194|ref|XP_002327065.1| predicted protein [Populus trichocarpa] gi|222835380|gb|EEE73815.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  194 bits (493), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 97/124 (78%), Positives = 108/124 (87%), Gaps = 2/124 (1%)

Query: 1   MALRRAVLDHVRVPVQTLALTGSKQRWSVLGSLRFMSSHDDHLTKEEVIDRVLSVVKCFP 60
           MALR AVL HVRV VQT  L  +   W+  GS+R MSSHDDHLTKEEV +RVLSV+K FP
Sbjct: 1   MALRAAVLRHVRVAVQTRELKSNP--WAPSGSIRLMSSHDDHLTKEEVAERVLSVIKSFP 58

Query: 61  KVDPSQVTPDVHFQKDLGLDSLDNVEIVMALEEEFKLEIPDKEAVRIDACNLAIEYIYNH 120
           KVDPS+VTP+VHFQKDLGLDSLD+VEIVMALEEEFKLEIPDKEA RID+CNLAIEYI+NH
Sbjct: 59  KVDPSRVTPEVHFQKDLGLDSLDSVEIVMALEEEFKLEIPDKEADRIDSCNLAIEYIHNH 118

Query: 121 PMAS 124
           P+AS
Sbjct: 119 PLAS 122




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|118487082|gb|ABK95371.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449487570|ref|XP_004157692.1| PREDICTED: acyl carrier protein 1, mitochondrial-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|15224918|ref|NP_181990.1| acyl carrier protein 1 [Arabidopsis thaliana] gi|1703091|sp|P53665.1|ACPM1_ARATH RecName: Full=Acyl carrier protein 1, mitochondrial; AltName: Full=MtACP-1; Short=ACP; AltName: Full=NADH-ubiquinone oxidoreductase 9.6 kDa subunit; Flags: Precursor gi|903689|gb|AAB96840.1| acyl carrier protein precursor [Arabidopsis thaliana] gi|3341682|gb|AAC27464.1| acyl carrier protein [Arabidopsis thaliana] gi|330255354|gb|AEC10448.1| acyl carrier protein 1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|210110108|gb|ACJ07136.1| acyl carrier protein 3-3 [Arachis hypogaea] gi|284808867|gb|ADB94681.1| acyl carrier protein 3 [Arachis hypogaea] gi|284808869|gb|ADB94682.1| acyl carrier protein 3 [Arachis hypogaea] gi|284808871|gb|ADB94683.1| acyl carrier protein 3 [Arachis hypogaea] Back     alignment and taxonomy information
>gi|357507891|ref|XP_003624234.1| Acyl carrier protein [Medicago truncatula] gi|355499249|gb|AES80452.1| Acyl carrier protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|210109926|gb|ACJ07134.1| acyl carrier protein 3-1 [Arachis hypogaea] gi|284808863|gb|ADB94679.1| acyl carrier protein 3 [Arachis hypogaea] gi|288816953|gb|ADC55285.1| mitochondrial acyl carrier protein [Arachis hypogaea] Back     alignment and taxonomy information
>gi|210110001|gb|ACJ07135.1| acyl carrier protein 3-2 [Arachis hypogaea] gi|284808865|gb|ADB94680.1| acyl carrier protein 3 [Arachis hypogaea] Back     alignment and taxonomy information
>gi|297824487|ref|XP_002880126.1| mtACP-1 [Arabidopsis lyrata subsp. lyrata] gi|297325965|gb|EFH56385.1| mtACP-1 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|225453262|ref|XP_002266315.1| PREDICTED: acyl carrier protein 1, mitochondrial [Vitis vinifera] gi|297734676|emb|CBI16727.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query124
TAIR|locus:2042331122 MTACP-1 "AT2G44620" [Arabidops 0.983 1.0 0.733 2.4e-44
TAIR|locus:2206300126 mtACP2 "AT1G65290" [Arabidopsi 0.967 0.952 0.523 2e-24
UNIPROTKB|G4N818145 MGG_03484 "Acyl carrier protei 0.661 0.565 0.530 2.8e-18
TAIR|locus:2168968131 mtACP3 "AT5G47630" [Arabidopsi 0.927 0.877 0.376 5.3e-17
UNIPROTKB|E2RJ92154 NDUFAB1 "Acyl carrier protein" 0.604 0.487 0.506 1.3e-15
SGD|S000001675125 ACP1 "Mitochondrial matrix acy 0.709 0.704 0.442 1.3e-15
UNIPROTKB|F1SAB6156 NDUFAB1 "Uncharacterized prote 0.604 0.480 0.506 1.6e-15
POMBASE|SPAC4H3.09112 SPAC4H3.09 "mitochondrial type 0.693 0.767 0.489 1.6e-15
UNIPROTKB|G3X6L0156 NDUFAB1 "Acyl carrier protein, 0.604 0.480 0.506 2e-15
UNIPROTKB|P52505156 NDUFAB1 "Acyl carrier protein, 0.604 0.480 0.506 2e-15
TAIR|locus:2042331 MTACP-1 "AT2G44620" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 467 (169.5 bits), Expect = 2.4e-44, P = 2.4e-44
 Identities = 91/124 (73%), Positives = 107/124 (86%)

Query:     1 MALRRAVLDHVRVPVQTLALTGSKQRWSVLGSLRFMSSHDDHLTKEEVIDRVLSVVKCFP 60
             MALR A+L H+RVPVQTL L  SK  +  LG++R  SSHDDHL++E V+DRVL VVK FP
Sbjct:     1 MALRNAILRHLRVPVQTLGLNQSKIGF--LGTIRSFSSHDDHLSREAVVDRVLDVVKSFP 58

Query:    61 KVDPSQVTPDVHFQKDLGLDSLDNVEIVMALEEEFKLEIPDKEAVRIDACNLAIEYIYNH 120
             KVDPS+VTP+VHFQ DLGLDSLD VEIVMA+EEEFKLEIPDKEA +ID+C+LAIEY+YNH
Sbjct:    59 KVDPSKVTPEVHFQNDLGLDSLDTVEIVMAIEEEFKLEIPDKEADKIDSCSLAIEYVYNH 118

Query:   121 PMAS 124
             PM+S
Sbjct:   119 PMSS 122




GO:0000036 "ACP phosphopantetheine attachment site binding involved in fatty acid biosynthetic process" evidence=ISS
GO:0005739 "mitochondrion" evidence=ISM;IDA
GO:0006633 "fatty acid biosynthetic process" evidence=IEA;ISS;IDA
GO:0031177 "phosphopantetheine binding" evidence=IEA
GO:0005759 "mitochondrial matrix" evidence=IDA
GO:0010267 "production of ta-siRNAs involved in RNA interference" evidence=RCA
GO:0035196 "production of miRNAs involved in gene silencing by miRNA" evidence=RCA
GO:0051607 "defense response to virus" evidence=RCA
TAIR|locus:2206300 mtACP2 "AT1G65290" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|G4N818 MGG_03484 "Acyl carrier protein" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
TAIR|locus:2168968 mtACP3 "AT5G47630" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|E2RJ92 NDUFAB1 "Acyl carrier protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
SGD|S000001675 ACP1 "Mitochondrial matrix acyl carrier protein" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
UNIPROTKB|F1SAB6 NDUFAB1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
POMBASE|SPAC4H3.09 SPAC4H3.09 "mitochondrial type II fatty acid synthase component (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
UNIPROTKB|G3X6L0 NDUFAB1 "Acyl carrier protein, mitochondrial" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P52505 NDUFAB1 "Acyl carrier protein, mitochondrial" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P53665ACPM1_ARATHNo assigned EC number0.73380.98381.0yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
estExt_fgenesh4_pg.C_400150
RecName- Full=Acyl carrier protein;; Carrier of the growing fatty acid chain in fatty acid biosynthesis (By similarity) (122 aa)
(Populus trichocarpa)
Predicted Functional Partners:
estExt_fgenesh4_pg.C_LG_IX0832
[acyl-carrier protein] S-malonyltransferase (EC-2.3.1.39) (371 aa)
      0.571
grail3.7185000101
Predicted protein (325 aa)
      0.515

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query124
PTZ00171148 PTZ00171, PTZ00171, acyl carrier protein; Provisio 2e-23
TIGR0051777 TIGR00517, acyl_carrier, acyl carrier protein 7e-23
CHL0012482 CHL00124, acpP, acyl carrier protein; Validated 7e-21
PRK0098278 PRK00982, acpP, acyl carrier protein; Provisional 1e-19
COG023680 COG0236, AcpP, Acyl carrier protein [Lipid metabol 9e-16
PRK1244980 PRK12449, PRK12449, acyl carrier protein; Provisio 4e-09
PRK0650893 PRK06508, PRK06508, acyl carrier protein; Provisio 3e-07
pfam0055066 pfam00550, PP-binding, Phosphopantetheine attachme 2e-05
PRK0535082 PRK05350, PRK05350, acyl carrier protein; Provisio 4e-04
smart0082386 smart00823, PKS_PP, Phosphopantetheine attachment 4e-04
PRK0708183 PRK07081, PRK07081, acyl carrier protein; Provisio 5e-04
PRK0582884 PRK05828, PRK05828, acyl carrier protein; Validate 0.003
PRK0817282 PRK08172, PRK08172, putative acyl carrier protein 0.004
>gnl|CDD|240304 PTZ00171, PTZ00171, acyl carrier protein; Provisional Back     alignment and domain information
 Score = 87.8 bits (218), Expect = 2e-23
 Identities = 43/81 (53%), Positives = 59/81 (72%)

Query: 43  LTKEEVIDRVLSVVKCFPKVDPSQVTPDVHFQKDLGLDSLDNVEIVMALEEEFKLEIPDK 102
           L+KE+V+ RV  VVK F KVD S++TP+ +F KDLG DSLD VE+++A+E+EF L IPD 
Sbjct: 66  LSKEDVLTRVKKVVKNFEKVDASKITPESNFVKDLGADSLDVVELLIAIEQEFNLTIPDH 125

Query: 103 EAVRIDACNLAIEYIYNHPMA 123
           +A +I     AI+YI  + MA
Sbjct: 126 DAEKIKTVQDAIDYIEQNNMA 146


Length = 148

>gnl|CDD|213536 TIGR00517, acyl_carrier, acyl carrier protein Back     alignment and domain information
>gnl|CDD|177047 CHL00124, acpP, acyl carrier protein; Validated Back     alignment and domain information
>gnl|CDD|179197 PRK00982, acpP, acyl carrier protein; Provisional Back     alignment and domain information
>gnl|CDD|223314 COG0236, AcpP, Acyl carrier protein [Lipid metabolism / Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|183533 PRK12449, PRK12449, acyl carrier protein; Provisional Back     alignment and domain information
>gnl|CDD|180597 PRK06508, PRK06508, acyl carrier protein; Provisional Back     alignment and domain information
>gnl|CDD|215989 pfam00550, PP-binding, Phosphopantetheine attachment site Back     alignment and domain information
>gnl|CDD|180033 PRK05350, PRK05350, acyl carrier protein; Provisional Back     alignment and domain information
>gnl|CDD|214834 smart00823, PKS_PP, Phosphopantetheine attachment site Back     alignment and domain information
>gnl|CDD|180828 PRK07081, PRK07081, acyl carrier protein; Provisional Back     alignment and domain information
>gnl|CDD|180278 PRK05828, PRK05828, acyl carrier protein; Validated Back     alignment and domain information
>gnl|CDD|181266 PRK08172, PRK08172, putative acyl carrier protein IacP; Validated Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 124
KOG1748131 consensus Acyl carrier protein/NADH-ubiquinone oxi 99.86
PRK0535082 acyl carrier protein; Provisional 99.82
CHL0012482 acpP acyl carrier protein; Validated 99.82
PRK0711779 acyl carrier protein; Validated 99.82
PRK1244980 acyl carrier protein; Provisional 99.81
PTZ00171148 acyl carrier protein; Provisional 99.8
PRK0588391 acyl carrier protein; Validated 99.8
PRK0582884 acyl carrier protein; Validated 99.8
PRK0763986 acyl carrier protein; Provisional 99.8
PRK0817282 putative acyl carrier protein IacP; Validated 99.79
TIGR0051777 acyl_carrier acyl carrier protein. S (Ser) at posi 99.75
COG023680 AcpP Acyl carrier protein [Lipid metabolism / Seco 99.71
PRK0098278 acpP acyl carrier protein; Provisional 99.68
PRK0918489 acyl carrier protein; Provisional 99.68
PRK0650893 acyl carrier protein; Provisional 99.67
PRK0508778 D-alanine--poly(phosphoribitol) ligase subunit 2; 99.57
PRK0708183 acyl carrier protein; Provisional 99.57
PF0055067 PP-binding: Phosphopantetheine attachment site; In 99.56
TIGR0168873 dltC D-alanine--poly(phosphoribitol) ligase, subun 99.28
PF1457396 PP-binding_2: Acyl-carrier; PDB: 3CE7_A. 99.17
smart0082386 PKS_PP Phosphopantetheine attachment site. Phospho 98.79
TIGR02813 2582 omega_3_PfaA polyketide-type polyunsaturated fatty 98.77
PRK06060705 acyl-CoA synthetase; Validated 98.41
TIGR02813 2582 omega_3_PfaA polyketide-type polyunsaturated fatty 98.28
TIGR03443 1389 alpha_am_amid L-aminoadipate-semialdehyde dehydrog 98.24
PRK10252 1296 entF enterobactin synthase subunit F; Provisional 98.11
COG343374 Aryl carrier domain [Secondary metabolites biosynt 97.93
PRK12467 3956 peptide synthase; Provisional 97.92
PRK12467 3956 peptide synthase; Provisional 97.86
PRK123165163 peptide synthase; Provisional 97.85
PRK056914334 peptide synthase; Validated 97.8
PRK05691 4334 peptide synthase; Validated 97.76
PRK12316 5163 peptide synthase; Provisional 97.7
PF07377111 DUF1493: Protein of unknown function (DUF1493); In 97.54
KOG1202 2376 consensus Animal-type fatty acid synthase and rela 96.62
PF10501112 Ribosomal_L50: Ribosomal subunit 39S; InterPro: IP 95.85
TIGR02372 386 4_coum_CoA_lig 4-coumarate--CoA ligase, photoactiv 94.78
KOG1178 1032 consensus Non-ribosomal peptide synthetase/alpha-a 86.14
>KOG1748 consensus Acyl carrier protein/NADH-ubiquinone oxidoreductase, NDUFAB1/SDAP subunit [Energy production and conversion; Lipid transport and metabolism; Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
Probab=99.86  E-value=2.7e-22  Score=140.94  Aligned_cols=119  Identities=46%  Similarity=0.628  Sum_probs=97.5

Q ss_pred             HHHhhcccccccccccccccccchhh----hhccccCCCC-CCCHHHHHHHHHHHHhhcCCCCCCCCCCCCCcccccCCC
Q 033233            6 AVLDHVRVPVQTLALTGSKQRWSVLG----SLRFMSSHDD-HLTKEEVIDRVLSVVKCFPKVDPSQVTPDVHFQKDLGLD   80 (124)
Q Consensus         6 ~~~~~~~~~~~~~~~~~~~~~~~~~~----~~~~~~~~~~-~M~~~ei~~~l~~il~e~l~v~~~~I~~dt~l~~dLGlD   80 (124)
                      ..+.+.+.-+.+|++.++..+-...+    ..++|+...+ ..+++++.++|..++..+..++++.++.+++|..|||+|
T Consensus         7 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~r~~s~~~p~~l~k~~v~~RVl~VVk~~dki~~~k~~~~s~f~~DLGlD   86 (131)
T KOG1748|consen    7 LSLQRLSSRISTPSSLAQQAPSFNFGRTTGLLRSYSAELPRCLAKKEVVDRVLDVVKKFDKIDPSKLTTDSDFFKDLGLD   86 (131)
T ss_pred             HHHHHHhhhhcccchhhhcCcccCcccchhHHHHHhhhhhhhhhHHHHHHHHHHHHHHhhcCCccccchhhHHHHhcCCc
Confidence            33444444455555554444333322    2677776665 589999999999999999999999999999999999999


Q ss_pred             hhhHHHHHHHHHHHhCCccChhhcccCccHHHHHHHHHcCCCCC
Q 033233           81 SLDNVEIVMALEEEFKLEIPDKEAVRIDACNLAIEYIYNHPMAS  124 (124)
Q Consensus        81 SL~~veli~~lEe~fgI~I~~~~l~~~~Tv~dlv~~I~~~~~a~  124 (124)
                      ||+.+|++++|||+||++||+++..++.|+++.++||.++.+.+
T Consensus        87 SLD~VEiVMAlEEEFgiEIpd~dAdki~t~~da~~yI~~~~d~k  130 (131)
T KOG1748|consen   87 SLDTVEIVMALEEEFGIEIPDEDADKIKTVRDAADYIADKPDVK  130 (131)
T ss_pred             ccccchhhhhhHHHhCCccCcchhhhhCCHHHHHHHHHhccccc
Confidence            99999999999999999999999999999999999999987653



>PRK05350 acyl carrier protein; Provisional Back     alignment and domain information
>CHL00124 acpP acyl carrier protein; Validated Back     alignment and domain information
>PRK07117 acyl carrier protein; Validated Back     alignment and domain information
>PRK12449 acyl carrier protein; Provisional Back     alignment and domain information
>PTZ00171 acyl carrier protein; Provisional Back     alignment and domain information
>PRK05883 acyl carrier protein; Validated Back     alignment and domain information
>PRK05828 acyl carrier protein; Validated Back     alignment and domain information
>PRK07639 acyl carrier protein; Provisional Back     alignment and domain information
>PRK08172 putative acyl carrier protein IacP; Validated Back     alignment and domain information
>TIGR00517 acyl_carrier acyl carrier protein Back     alignment and domain information
>COG0236 AcpP Acyl carrier protein [Lipid metabolism / Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK00982 acpP acyl carrier protein; Provisional Back     alignment and domain information
>PRK09184 acyl carrier protein; Provisional Back     alignment and domain information
>PRK06508 acyl carrier protein; Provisional Back     alignment and domain information
>PRK05087 D-alanine--poly(phosphoribitol) ligase subunit 2; Validated Back     alignment and domain information
>PRK07081 acyl carrier protein; Provisional Back     alignment and domain information
>PF00550 PP-binding: Phosphopantetheine attachment site; InterPro: IPR006163 Phosphopantetheine (or pantetheine 4' phosphate) is the prosthetic group of acyl carrier proteins (ACP) in some multienzyme complexes where it serves as a 'swinging arm' for the attachment of activated fatty acid and amino-acid groups [] Back     alignment and domain information
>TIGR01688 dltC D-alanine--poly(phosphoribitol) ligase, subunit 2 Back     alignment and domain information
>PF14573 PP-binding_2: Acyl-carrier; PDB: 3CE7_A Back     alignment and domain information
>smart00823 PKS_PP Phosphopantetheine attachment site Back     alignment and domain information
>TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA Back     alignment and domain information
>PRK06060 acyl-CoA synthetase; Validated Back     alignment and domain information
>TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA Back     alignment and domain information
>TIGR03443 alpha_am_amid L-aminoadipate-semialdehyde dehydrogenase Back     alignment and domain information
>PRK10252 entF enterobactin synthase subunit F; Provisional Back     alignment and domain information
>COG3433 Aryl carrier domain [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK12467 peptide synthase; Provisional Back     alignment and domain information
>PRK12467 peptide synthase; Provisional Back     alignment and domain information
>PRK12316 peptide synthase; Provisional Back     alignment and domain information
>PRK05691 peptide synthase; Validated Back     alignment and domain information
>PRK05691 peptide synthase; Validated Back     alignment and domain information
>PRK12316 peptide synthase; Provisional Back     alignment and domain information
>PF07377 DUF1493: Protein of unknown function (DUF1493); InterPro: IPR010862 This family consists of several bacterial proteins of around 115 residues in length Back     alignment and domain information
>KOG1202 consensus Animal-type fatty acid synthase and related proteins [Lipid transport and metabolism] Back     alignment and domain information
>PF10501 Ribosomal_L50: Ribosomal subunit 39S; InterPro: IPR018305 This entry represents the L50 protein from the mitochondrial 39S ribosomal subunit Back     alignment and domain information
>TIGR02372 4_coum_CoA_lig 4-coumarate--CoA ligase, photoactive yellow protein activation family Back     alignment and domain information
>KOG1178 consensus Non-ribosomal peptide synthetase/alpha-aminoadipate reductase and related enzymes [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query124
2dnw_A99 Solution Structure Of Rsgi Ruh-059, An Acp Domain O 1e-15
1x3o_A80 Crystal Structure Of The Acyl Carrier Protein From 5e-13
2k92_A77 Structural Modification Of Acyl Carrier Protein By 8e-13
3ejb_A97 Crystal Structure Of P450bioi In Complex With Tetra 9e-13
1l0h_A78 Crystal Structure Of Butyryl-Acp From E.Coli Length 1e-12
1t8k_A77 Crystal Structure Of Apo Acyl Carrier Protein From 1e-12
1l0i_A78 Crystal Structure Of Butyryl-Acp I62m Mutant Length 2e-12
2l0q_A80 Nmr Solution Structure Of Vibrio Harveyi Acyl Carri 6e-12
4dxe_H101 2.52 Angstrom Resolution Crystal Structure Of The A 8e-11
2qnw_A82 Toxoplasma Gondii Apicoplast-Targeted Acyl Carrier 2e-10
2ehs_A77 Crystal Structure Of Acyl Carrier Protein From Aqui 3e-10
2x2b_A78 Crystal Structure Of Malonyl-Acp (Acyl Carrier Prot 1e-09
1hy8_A76 Solution Structure Of B. Subtilis Acyl Carrier Prot 1e-09
2l3v_A79 Nmr Structure Of Acyl Carrier Protein From Brucella 4e-09
1f80_D81 Holo-(Acyl Carrier Protein) Synthase In Complex Wit 4e-09
3gzl_A81 Crystal Structure Of Holo Pfacp Disulfide-Linked Di 4e-09
2fq0_A79 Solution Structure Of Major Conformation Of Holo-Ac 5e-09
2lol_A81 Nmr Structure Of An Acyl-Carrier Protein From Ricke 9e-08
2l4b_A88 Solution Structure Of A Putative Acyl Carrier Prote 3e-06
2cnr_A82 Structural Studies On The Interaction Of Scfas Acp 4e-06
2koo_A81 Nmr Solution Structures Of Hexanoyl-Acp From The St 5e-06
2ava_A82 Solution Structure Of Stearoyl-Acyl Carrier Protein 8e-06
2xz0_D82 The Structure Of The 2:1 (Partially Occupied) Compl 4e-05
1klp_A115 The Solution Structure Of Acyl Carrier Protein From 1e-04
3lmo_A101 Crystal Structure Of Specialized Acyl Carrier Prote 6e-04
>pdb|2DNW|A Chain A, Solution Structure Of Rsgi Ruh-059, An Acp Domain Of Acyl Carrier Protein, Mitochondrial [precursor] From Human Cdna Length = 99 Back     alignment and structure

Iteration: 1

Score = 77.8 bits (190), Expect = 1e-15, Method: Compositional matrix adjust. Identities = 38/75 (50%), Positives = 54/75 (72%) Query: 43 LTKEEVIDRVLSVVKCFPKVDPSQVTPDVHFQKDLGLDSLDNVEIVMALEEEFKLEIPDK 102 LT E + DRVL V+K + K+DP +++ + HF KDLGLDSLD VEI+MA+E+EF EIPD Sbjct: 11 LTLEGIQDRVLYVLKLYDKIDPEKLSVNSHFMKDLGLDSLDQVEIIMAMEDEFGFEIPDI 70 Query: 103 EAVRIDACNLAIEYI 117 +A ++ ++YI Sbjct: 71 DAEKLMCPQEIVDYI 85
>pdb|1X3O|A Chain A, Crystal Structure Of The Acyl Carrier Protein From Thermus Thermophilus Hb8 Length = 80 Back     alignment and structure
>pdb|2K92|A Chain A, Structural Modification Of Acyl Carrier Protein By Butyryl Group Length = 77 Back     alignment and structure
>pdb|3EJB|A Chain A, Crystal Structure Of P450bioi In Complex With Tetradecanoic Acid Ligated Acyl Carrier Protein Length = 97 Back     alignment and structure
>pdb|1L0H|A Chain A, Crystal Structure Of Butyryl-Acp From E.Coli Length = 78 Back     alignment and structure
>pdb|1T8K|A Chain A, Crystal Structure Of Apo Acyl Carrier Protein From E. Coli Length = 77 Back     alignment and structure
>pdb|1L0I|A Chain A, Crystal Structure Of Butyryl-Acp I62m Mutant Length = 78 Back     alignment and structure
>pdb|2L0Q|A Chain A, Nmr Solution Structure Of Vibrio Harveyi Acyl Carrier Protein (Acp) Length = 80 Back     alignment and structure
>pdb|4DXE|H Chain H, 2.52 Angstrom Resolution Crystal Structure Of The Acyl-Carrier-Protein Synthase (Acps)-Acyl Carrier Protein (Acp) Protein-Protein Complex From Staphylococcus Aureus Subsp. Aureus Col Length = 101 Back     alignment and structure
>pdb|2QNW|A Chain A, Toxoplasma Gondii Apicoplast-Targeted Acyl Carrier Protein Length = 82 Back     alignment and structure
>pdb|2EHS|A Chain A, Crystal Structure Of Acyl Carrier Protein From Aquifex Aeolicus (Form 1) Length = 77 Back     alignment and structure
>pdb|2X2B|A Chain A, Crystal Structure Of Malonyl-Acp (Acyl Carrier Protein) From Bacillus Subtilis Length = 78 Back     alignment and structure
>pdb|1HY8|A Chain A, Solution Structure Of B. Subtilis Acyl Carrier Protein Length = 76 Back     alignment and structure
>pdb|2L3V|A Chain A, Nmr Structure Of Acyl Carrier Protein From Brucella Melitensis Length = 79 Back     alignment and structure
>pdb|1F80|D Chain D, Holo-(Acyl Carrier Protein) Synthase In Complex With Holo- (Acyl Carrier Protein) Length = 81 Back     alignment and structure
>pdb|3GZL|A Chain A, Crystal Structure Of Holo Pfacp Disulfide-Linked Dimer Length = 81 Back     alignment and structure
>pdb|2FQ0|A Chain A, Solution Structure Of Major Conformation Of Holo-Acyl Carrier Protein From Malaria Parasite Plasmodium Falciparum Length = 79 Back     alignment and structure
>pdb|2LOL|A Chain A, Nmr Structure Of An Acyl-Carrier Protein From Rickettsia Prowazekii, Seattle Structural Genomics Center For Infectious Disease (Ssgcid) Length = 81 Back     alignment and structure
>pdb|2L4B|A Chain A, Solution Structure Of A Putative Acyl Carrier Protein From Anaplasma Phagocytophilum. Seattle Structural Genomics Center For Infectious Disease Target Anpha.01018.A Length = 88 Back     alignment and structure
>pdb|2CNR|A Chain A, Structural Studies On The Interaction Of Scfas Acp With Acps Length = 82 Back     alignment and structure
>pdb|2KOO|A Chain A, Nmr Solution Structures Of Hexanoyl-Acp From The Streptomyces Coelicolor Fatty Acid Synthase Length = 81 Back     alignment and structure
>pdb|2AVA|A Chain A, Solution Structure Of Stearoyl-Acyl Carrier Protein Length = 82 Back     alignment and structure
>pdb|2XZ0|D Chain D, The Structure Of The 2:1 (Partially Occupied) Complex Between Stearoyl Acyl Carrier Protein Desaturase From Ricinus Communis (Castor Bean) And Acyl Carrier Protein. Length = 82 Back     alignment and structure
>pdb|1KLP|A Chain A, The Solution Structure Of Acyl Carrier Protein From Mycobacterium Tuberculosis Length = 115 Back     alignment and structure
>pdb|3LMO|A Chain A, Crystal Structure Of Specialized Acyl Carrier Protein (Rpa2022) From Rhodopseudomonas Palustris, Northeast Structural Genomics Consortium Target Rpr324 Length = 101 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query124
2dnw_A99 Acyl carrier protein; ACP, fatty acid biosynthesis 7e-34
2l4b_A88 Acyl carrier protein; infectious disease, human gr 1e-28
2ava_A82 ACP I, acyl carrier protein I, chloroplast; four-h 3e-27
3ce7_A107 Specific mitochodrial acyl carrier protein; malari 4e-25
1vku_A100 Acyl carrier protein; TM0175, structural genomics, 1e-24
2qnw_A82 Acyl carrier protein; malaria, SGC, structural gen 3e-24
3ejb_A97 Acyl carrier protein; protein-protein complex, cyt 6e-24
2l3v_A79 ACP, acyl carrier protein; structural genomi seatt 8e-24
2lol_A81 ACP, acyl carrier protein; lipid transport; NMR {R 9e-24
1l0i_A78 Acyl carrier protein; acyl chain binding, fatty ac 9e-24
1x3o_A80 Acyl carrier protein; structural genomics, riken s 1e-23
2kwl_A84 ACP, acyl carrier protein; structural genomics, se 1e-22
1klp_A115 ACP, ACPM, meromycolate extension acyl carrier pro 1e-22
2cnr_A82 FAS, ACP, acyl carrier protein; polykdetide, phosp 2e-22
3gzm_A81 Acyl carrier protein; helix bundle, phosphopanteth 2e-22
4dxe_H101 ACP, acyl carrier protein; acyl-carrier-protein sy 8e-22
2ehs_A77 ACP, acyl carrier protein; lipid transport, struct 1e-21
2cgq_A113 Acyl carrier protein ACPA; RV0033, protein transpo 2e-20
2kw2_A101 Specialized acyl carrier protein; structural genom 3e-20
1f80_D81 Acyl carrier protein; transferase; HET: PN2; 2.30A 7e-17
2lte_A103 Specialized acyl carrier protein; APO protein, tra 2e-11
1nq4_A95 Oxytetracycline polyketide synthase acyl carrier p 1e-10
2kci_A87 Putative acyl carrier protein; alpha, ACP, PCP, st 3e-10
2jq4_A105 AGR_C_4658P, hypothetical protein ATU2571; ATC2521 6e-10
1af8_A86 Actinorhodin polyketide synthase acyl carrier Pro; 3e-09
2kr5_A89 PKS, aflatoxin biosynthesis polyketide synthase; a 4e-09
1or5_A83 Acyl carrier protein; ACP, biosynthesis, frenolici 5e-07
2afd_A88 Protein ASL1650; twisted antiparallel helical bund 2e-06
2l22_A212 Mupirocin didomain acyl carrier protein; biosynthe 2e-06
2l22_A 212 Mupirocin didomain acyl carrier protein; biosynthe 5e-06
1dv5_A80 APO-DCP, APO-D-alanyl carrier protein; 3-helix bun 1e-05
2cg5_B91 Fatty acid synthase; transferase-hydrolase complex 2e-05
2liu_A99 CURA; holo state, transferase; NMR {Lyngbya majusc 8e-05
2lki_A105 Putative uncharacterized protein; helical bundle, 2e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
1fh1_A92 NODF, nodulation protein F; ROOT nodulation factor 4e-04
>2dnw_A Acyl carrier protein; ACP, fatty acid biosynthesis, mitochondria, NADH:ubiquinone oxidereductase, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 Back     alignment and structure
 Score =  112 bits (282), Expect = 7e-34
 Identities = 40/87 (45%), Positives = 57/87 (65%)

Query: 37  SSHDDHLTKEEVIDRVLSVVKCFPKVDPSQVTPDVHFQKDLGLDSLDNVEIVMALEEEFK 96
           SS    LT E + DRVL V+K + K+DP +++ + HF KDLGLDSLD VEI+MA+E+EF 
Sbjct: 5   SSGMPPLTLEGIQDRVLYVLKLYDKIDPEKLSVNSHFMKDLGLDSLDQVEIIMAMEDEFG 64

Query: 97  LEIPDKEAVRIDACNLAIEYIYNHPMA 123
            EIPD +A ++      ++YI +    
Sbjct: 65  FEIPDIDAEKLMCPQEIVDYIADKKDV 91


>2l4b_A Acyl carrier protein; infectious disease, human granulocytic anaplasmosis, ssgcid, structural genomics; NMR {Anaplasma phagocytophilum} Length = 88 Back     alignment and structure
>2ava_A ACP I, acyl carrier protein I, chloroplast; four-helix-bundle, biosynthetic protein; NMR {Spinacia oleracea} PDB: 2fva_A* 2fve_A 2fvf_A* 2xz0_D* 2xz1_C* Length = 82 Back     alignment and structure
>3ce7_A Specific mitochodrial acyl carrier protein; malaria, mitochondrial, ACP, fatty acid biosynthesis, lipid synthesis, phosphopantetheine; 1.64A {Toxoplasma} Length = 107 Back     alignment and structure
>1vku_A Acyl carrier protein; TM0175, structural genomics, JCSG, Pro structure initiative, PSI; 2.00A {Thermotoga maritima} SCOP: a.28.1.1 Length = 100 Back     alignment and structure
>2qnw_A Acyl carrier protein; malaria, SGC, structural genomics CONS fatty acid biosynthesis, lipid synthesis, phosphopantethein transit peptide; 1.90A {Toxoplasma gondii} Length = 82 Back     alignment and structure
>3ejb_A Acyl carrier protein; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Escherichia coli} SCOP: a.28.1.1 PDB: 3ejd_A* 3eje_A* Length = 97 Back     alignment and structure
>2l3v_A ACP, acyl carrier protein; structural genomi seattle structural genomics center for infectious disease, lipid binding protein; NMR {Brucella melitensis} Length = 79 Back     alignment and structure
>2lol_A ACP, acyl carrier protein; lipid transport; NMR {Rickettsia prowazekii str} Length = 81 Back     alignment and structure
>1l0i_A Acyl carrier protein; acyl chain binding, fatty acid biosynt lipid transport; HET: PSR; 1.20A {Escherichia coli} SCOP: a.28.1.1 PDB: 3ny7_B* 2fhs_C 1l0h_A* 1acp_A 1t8k_A 2fac_A* 2fad_A* 2fae_A* 2k92_A 2k93_A 2k94_A 2l0q_A Length = 78 Back     alignment and structure
>1x3o_A Acyl carrier protein; structural genomics, riken structural genomics/proteomics in RSGI, NPPSFA; 1.50A {Thermus thermophilus} Length = 80 Back     alignment and structure
>2kwl_A ACP, acyl carrier protein; structural genomics, seattle structura genomics center for infectious disease, ssgcid, lipid bindi protein; NMR {Borrelia burgdorferi} Length = 84 Back     alignment and structure
>1klp_A ACP, ACPM, meromycolate extension acyl carrier protein; four-helix bundle, ligand transport; NMR {Mycobacterium tuberculosis} SCOP: a.28.1.1 Length = 115 Back     alignment and structure
>2cnr_A FAS, ACP, acyl carrier protein; polykdetide, phosphopantetheine, lipid transport; NMR {Streptomyces coelicolor} PDB: 2koo_A* 2kop_A* 2koq_A* 2kor_A* 2kos_A* Length = 82 Back     alignment and structure
>3gzm_A Acyl carrier protein; helix bundle, phosphopantetheine, fatty acid biosynthesis, L synthesis, transit peptide, biosynthetic protein; HET: PNS; 1.80A {Plasmodium falciparum} PDB: 3gzl_A* 2fq0_A* 2fq2_A* Length = 81 Back     alignment and structure
>4dxe_H ACP, acyl carrier protein; acyl-carrier-protein synthase, type II acid synthesis pathway; 2.51A {Staphylococcus aureus} Length = 101 Back     alignment and structure
>2ehs_A ACP, acyl carrier protein; lipid transport, structural genomics, NPPSFA, national proje protein structural and functional analyses; 1.30A {Aquifex aeolicus} PDB: 2eht_A Length = 77 Back     alignment and structure
>2cgq_A Acyl carrier protein ACPA; RV0033, protein transport, phosphopant; 1.83A {Mycobacterium tuberculosis} Length = 113 Back     alignment and structure
>2kw2_A Specialized acyl carrier protein; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Rhodopseudomonas palustris} PDB: 2ll8_A* 2lpk_A 3lmo_A Length = 101 Back     alignment and structure
>1f80_D Acyl carrier protein; transferase; HET: PN2; 2.30A {Bacillus subtilis} SCOP: a.28.1.1 PDB: 2x2b_A* 1hy8_A Length = 81 Back     alignment and structure
>2lte_A Specialized acyl carrier protein; APO protein, transferase; NMR {Pseudomonas aeruginosa} Length = 103 Back     alignment and structure
>1nq4_A Oxytetracycline polyketide synthase acyl carrier protein; solution structure, dynamics, ACP, biosynthetic protein; NMR {Streptomyces rimosus} SCOP: a.28.1.1 Length = 95 Back     alignment and structure
>2jq4_A AGR_C_4658P, hypothetical protein ATU2571; ATC2521, unknown function, ATC, S genomics, PSI-2, protein structure initiative; NMR {Agrobacterium tumefaciens} SCOP: a.28.1.1 Length = 105 Back     alignment and structure
>1af8_A Actinorhodin polyketide synthase acyl carrier Pro; acyl carrier protein, solution STR antibiotic biosynthesis; NMR {Streptomyces coelicolor} SCOP: a.28.1.1 PDB: 2af8_A 2k0x_A* 2k0y_A 2kg6_A* 2kg8_A* 2kg9_A* 2kga_A* 2kgc_A* 2kgd_A* 2kge_A* Length = 86 Back     alignment and structure
>2kr5_A PKS, aflatoxin biosynthesis polyketide synthase; acyl carrrier protein, holo, phosphopantetheine, transport protein; HET: PNS; NMR {Aspergillus parasiticus} Length = 89 Back     alignment and structure
>1or5_A Acyl carrier protein; ACP, biosynthesis, frenolicin, holo, polyketide synthase, PKS, biosynthetic protein; NMR {Streptomyces roseofulvus} SCOP: a.28.1.1 Length = 83 Back     alignment and structure
>2afd_A Protein ASL1650; twisted antiparallel helical bundle, acyl carrier protein FA structural genomics, PSI, protein structure initiative; NMR {Nostoc SP} PDB: 2afe_A Length = 88 Back     alignment and structure
>2l22_A Mupirocin didomain acyl carrier protein; biosynthetic protein; NMR {Pseudomonas fluorescens} Length = 212 Back     alignment and structure
>2l22_A Mupirocin didomain acyl carrier protein; biosynthetic protein; NMR {Pseudomonas fluorescens} Length = 212 Back     alignment and structure
>1dv5_A APO-DCP, APO-D-alanyl carrier protein; 3-helix bundle, transport protein; NMR {Lactobacillus casei} SCOP: a.28.1.3 PDB: 1hqb_A Length = 80 Back     alignment and structure
>2cg5_B Fatty acid synthase; transferase-hydrolase complex, transferase/hydrolase (comple fatty acid biosynthesis, phosphopantetheine transferase; HET: COA; 2.7A {Homo sapiens} PDB: 2png_A Length = 91 Back     alignment and structure
>2liu_A CURA; holo state, transferase; NMR {Lyngbya majuscula} PDB: 2liw_A* Length = 99 Back     alignment and structure
>2lki_A Putative uncharacterized protein; helical bundle, acyl carrier, phosphopantetheine, fatty acid biosynthesis, lipid synthesis, PSI-biology; HET: PNS; NMR {Nitrosomonas europaea} Length = 105 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1fh1_A NODF, nodulation protein F; ROOT nodulation factor, protein backbone fold, lipid binding protein; NMR {Rhizobium leguminosarum} SCOP: i.11.1.1 Length = 92 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query124
3ejb_A97 Acyl carrier protein; protein-protein complex, cyt 99.84
2dnw_A99 Acyl carrier protein; ACP, fatty acid biosynthesis 99.79
2l4b_A88 Acyl carrier protein; infectious disease, human gr 99.78
2kci_A87 Putative acyl carrier protein; alpha, ACP, PCP, st 99.78
2cnr_A82 FAS, ACP, acyl carrier protein; polykdetide, phosp 99.78
2lol_A81 ACP, acyl carrier protein; lipid transport; NMR {R 99.77
4dxe_H101 ACP, acyl carrier protein; acyl-carrier-protein sy 99.77
2kwl_A84 ACP, acyl carrier protein; structural genomics, se 99.77
1f80_D81 Acyl carrier protein; transferase; HET: PN2; 2.30A 99.77
3gzm_A81 Acyl carrier protein; helix bundle, phosphopanteth 99.77
2kjs_A87 Putative acyl carrier protein; alpha, ACP, PNS, st 99.76
3ce7_A107 Specific mitochodrial acyl carrier protein; malari 99.76
2l9f_A102 CALE8, meacp; transferase, acyl carrier protein; N 99.75
1vku_A100 Acyl carrier protein; TM0175, structural genomics, 99.74
1klp_A115 ACP, ACPM, meromycolate extension acyl carrier pro 99.74
1x3o_A80 Acyl carrier protein; structural genomics, riken s 99.74
2cgq_A113 Acyl carrier protein ACPA; RV0033, protein transpo 99.73
2ava_A82 ACP I, acyl carrier protein I, chloroplast; four-h 99.72
2qnw_A82 Acyl carrier protein; malaria, SGC, structural gen 99.72
2lki_A105 Putative uncharacterized protein; helical bundle, 99.71
1af8_A86 Actinorhodin polyketide synthase acyl carrier Pro; 99.71
1dv5_A80 APO-DCP, APO-D-alanyl carrier protein; 3-helix bun 99.71
1l0i_A78 Acyl carrier protein; acyl chain binding, fatty ac 99.7
2lte_A103 Specialized acyl carrier protein; APO protein, tra 99.51
2jq4_A105 AGR_C_4658P, hypothetical protein ATU2571; ATC2521 99.67
2kw2_A101 Specialized acyl carrier protein; structural genom 99.67
2amw_A83 Hypothetical protein NE2163; all helical protein, 99.67
1or5_A83 Acyl carrier protein; ACP, biosynthesis, frenolici 99.66
2ehs_A77 ACP, acyl carrier protein; lipid transport, struct 99.62
2l3v_A79 ACP, acyl carrier protein; structural genomi seatt 99.62
1nq4_A95 Oxytetracycline polyketide synthase acyl carrier p 99.61
1fh1_A92 NODF, nodulation protein F; ROOT nodulation factor 99.57
2afd_A88 Protein ASL1650; twisted antiparallel helical bund 99.55
2kr5_A89 PKS, aflatoxin biosynthesis polyketide synthase; a 99.5
2liu_A99 CURA; holo state, transferase; NMR {Lyngbya majusc 99.5
2l22_A 212 Mupirocin didomain acyl carrier protein; biosynthe 99.46
2ju1_A95 Erythronolide synthase; carrier protein domain, mo 99.41
2cg5_B91 Fatty acid synthase; transferase-hydrolase complex 99.39
4i4d_A93 Peptide synthetase NRPS type II-PCP; structural ge 99.35
1dny_A91 Non-ribosomal peptide synthetase peptidyl carrier 99.32
2l22_A212 Mupirocin didomain acyl carrier protein; biosynthe 99.31
3tej_A 329 Enterobactin synthase component F; nonribosomal pe 98.88
2cq8_A110 10-formyltetrahydrofolate dehydrogenase; 10-FTHFDH 98.87
2jgp_A 520 Tyrocidine synthetase 3; multifunctional enzyme, a 98.58
2fq1_A287 Isochorismatase; ENTB, NRPS, multi-domain, ACP, hy 98.57
2vsq_A 1304 Surfactin synthetase subunit 3; ligase, peptidyl c 98.34
4f6l_B 508 AUSA reductase domain protein; thioester reductase 98.25
3rg2_A617 Enterobactin synthase component E (ENTE), 2,3-DIH 98.09
4dg8_A620 PA1221; ANL superfamily, adenylation domain, pepti 98.05
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 97.28
2px6_A 316 Thioesterase domain; thioesaterse domain, orlistat 91.59
1dd4_C40 50S ribosomal protein L7/L12; dimer formation, fle 80.37
>3ejb_A Acyl carrier protein; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Escherichia coli} SCOP: a.28.1.1 PDB: 3ejd_A* 3eje_A* Back     alignment and structure
Probab=99.84  E-value=3.3e-21  Score=128.51  Aligned_cols=94  Identities=38%  Similarity=0.479  Sum_probs=75.8

Q ss_pred             chhhhhccccCCCCCCCHHHHHHHHHHHHhhcCCCCCCCCCCCCCcccccCCChhhHHHHHHHHHHHhCCccChhhcccC
Q 033233           28 SVLGSLRFMSSHDDHLTKEEVIDRVLSVVKCFPKVDPSQVTPDVHFQKDLGLDSLDNVEIVMALEEEFKLEIPDKEAVRI  107 (124)
Q Consensus        28 ~~~~~~~~~~~~~~~M~~~ei~~~l~~il~e~l~v~~~~I~~dt~l~~dLGlDSL~~veli~~lEe~fgI~I~~~~l~~~  107 (124)
                      ++.+|+|........++++++.++|++++++.+++++++|+++++|.++||+|||++++|+..||++|||+|+.+++.++
T Consensus         3 ~~~~~~~~~~~~~~~~t~~~i~~~l~~iia~~l~~~~~~i~~d~~l~~dLGlDSL~~vel~~~lE~~fgi~i~~~~l~~~   82 (97)
T 3ejb_A            3 SHHHHHHSSGLVPRGSHMSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEAEKI   82 (97)
T ss_dssp             ---------------CCCCCHHHHHHHHHHHHSCCCTTTSCTTCBTTTTTCCCTTHHHHHHHHHHHHTTCCCCHHHHHHC
T ss_pred             CCcCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCcCHHHCCCCCCchhhcCCCHHHHHHHHHHHHHHHCCCCCHHHHHhC
Confidence            35678888888888999999999999999999999999999999997799999999999999999999999999999999


Q ss_pred             ccHHHHHHHHHcCC
Q 033233          108 DACNLAIEYIYNHP  121 (124)
Q Consensus       108 ~Tv~dlv~~I~~~~  121 (124)
                      .|++++++||.+++
T Consensus        83 ~Tv~~l~~~i~~~~   96 (97)
T 3ejb_A           83 TTVQAAIDYINGHQ   96 (97)
T ss_dssp             CBHHHHHHHHHHC-
T ss_pred             CCHHHHHHHHHHhc
Confidence            99999999998775



>2dnw_A Acyl carrier protein; ACP, fatty acid biosynthesis, mitochondria, NADH:ubiquinone oxidereductase, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2l4b_A Acyl carrier protein; infectious disease, human granulocytic anaplasmosis, ssgcid, structural genomics; NMR {Anaplasma phagocytophilum} Back     alignment and structure
>2cnr_A FAS, ACP, acyl carrier protein; polykdetide, phosphopantetheine, lipid transport; NMR {Streptomyces coelicolor} PDB: 2koo_A* 2kop_A* 2koq_A* 2kor_A* 2kos_A* Back     alignment and structure
>2lol_A ACP, acyl carrier protein; lipid transport; NMR {Rickettsia prowazekii str} Back     alignment and structure
>4dxe_H ACP, acyl carrier protein; acyl-carrier-protein synthase, type II acid synthesis pathway; 2.51A {Staphylococcus aureus} Back     alignment and structure
>2kwl_A ACP, acyl carrier protein; structural genomics, seattle structura genomics center for infectious disease, ssgcid, lipid bindi protein; NMR {Borrelia burgdorferi} Back     alignment and structure
>1f80_D Acyl carrier protein; transferase; HET: PN2; 2.30A {Bacillus subtilis} SCOP: a.28.1.1 PDB: 2x2b_A* 1hy8_A Back     alignment and structure
>3gzm_A Acyl carrier protein; helix bundle, phosphopantetheine, fatty acid biosynthesis, L synthesis, transit peptide, biosynthetic protein; HET: PNS; 1.80A {Plasmodium falciparum} SCOP: a.28.1.0 PDB: 3gzl_A* 2fq0_A* 2fq2_A* Back     alignment and structure
>3ce7_A Specific mitochodrial acyl carrier protein; malaria, mitochondrial, ACP, fatty acid biosynthesis, lipid synthesis, phosphopantetheine; 1.64A {Toxoplasma} Back     alignment and structure
>2l9f_A CALE8, meacp; transferase, acyl carrier protein; NMR {Micromonospora echinospora} Back     alignment and structure
>1vku_A Acyl carrier protein; TM0175, structural genomics, JCSG, Pro structure initiative, PSI; 2.00A {Thermotoga maritima} SCOP: a.28.1.1 Back     alignment and structure
>1klp_A ACP, ACPM, meromycolate extension acyl carrier protein; four-helix bundle, ligand transport; NMR {Mycobacterium tuberculosis} SCOP: a.28.1.1 Back     alignment and structure
>1x3o_A Acyl carrier protein; structural genomics, riken structural genomics/proteomics in RSGI, NPPSFA; 1.50A {Thermus thermophilus} Back     alignment and structure
>2cgq_A Acyl carrier protein ACPA; RV0033, protein transport, phosphopant; 1.83A {Mycobacterium tuberculosis} Back     alignment and structure
>2ava_A ACP I, acyl carrier protein I, chloroplast; four-helix-bundle, biosynthetic protein; NMR {Spinacia oleracea} PDB: 2fva_A* 2fve_A 2fvf_A* 2xz0_D* 2xz1_C* Back     alignment and structure
>2qnw_A Acyl carrier protein; malaria, SGC, structural genomics CONS fatty acid biosynthesis, lipid synthesis, phosphopantethein transit peptide; 1.90A {Toxoplasma gondii} Back     alignment and structure
>2lki_A Putative uncharacterized protein; helical bundle, acyl carrier, phosphopantetheine, fatty acid biosynthesis, lipid synthesis, PSI-biology; HET: PNS; NMR {Nitrosomonas europaea} Back     alignment and structure
>1af8_A Actinorhodin polyketide synthase acyl carrier Pro; acyl carrier protein, solution STR antibiotic biosynthesis; NMR {Streptomyces coelicolor} SCOP: a.28.1.1 PDB: 2af8_A 2k0x_A* 2k0y_A 2kg6_A* 2kg8_A* 2kg9_A* 2kga_A* 2kgc_A* 2kgd_A* 2kge_A* Back     alignment and structure
>1dv5_A APO-DCP, APO-D-alanyl carrier protein; 3-helix bundle, transport protein; NMR {Lactobacillus casei} SCOP: a.28.1.3 PDB: 1hqb_A Back     alignment and structure
>1l0i_A Acyl carrier protein; acyl chain binding, fatty acid biosynt lipid transport; HET: PSR; 1.20A {Escherichia coli} SCOP: a.28.1.1 PDB: 3ny7_B* 2fhs_C 1l0h_A* 1acp_A 1t8k_A 2fac_A* 2fad_A* 2fae_A* 2k92_A 2k93_A 2k94_A 2l0q_A Back     alignment and structure
>2lte_A Specialized acyl carrier protein; APO protein, transferase; NMR {Pseudomonas aeruginosa} Back     alignment and structure
>2jq4_A AGR_C_4658P, hypothetical protein ATU2571; ATC2521, unknown function, ATC, S genomics, PSI-2, protein structure initiative; NMR {Agrobacterium tumefaciens} SCOP: a.28.1.1 Back     alignment and structure
>2kw2_A Specialized acyl carrier protein; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Rhodopseudomonas palustris} PDB: 2ll8_A* 2lpk_A 3lmo_A Back     alignment and structure
>1or5_A Acyl carrier protein; ACP, biosynthesis, frenolicin, holo, polyketide synthase, PKS, biosynthetic protein; NMR {Streptomyces roseofulvus} SCOP: a.28.1.1 Back     alignment and structure
>2ehs_A ACP, acyl carrier protein; lipid transport, structural genomics, NPPSFA, national proje protein structural and functional analyses; 1.30A {Aquifex aeolicus} PDB: 2eht_A Back     alignment and structure
>2l3v_A ACP, acyl carrier protein; structural genomi seattle structural genomics center for infectious disease, lipid binding protein; NMR {Brucella melitensis} Back     alignment and structure
>1nq4_A Oxytetracycline polyketide synthase acyl carrier protein; solution structure, dynamics, ACP, biosynthetic protein; NMR {Streptomyces rimosus} SCOP: a.28.1.1 Back     alignment and structure
>1fh1_A NODF, nodulation protein F; ROOT nodulation factor, protein backbone fold, lipid binding protein; NMR {Rhizobium leguminosarum} SCOP: i.11.1.1 Back     alignment and structure
>2afd_A Protein ASL1650; twisted antiparallel helical bundle, acyl carrier protein FA structural genomics, PSI, protein structure initiative; NMR {Nostoc SP} PDB: 2afe_A Back     alignment and structure
>2kr5_A PKS, aflatoxin biosynthesis polyketide synthase; acyl carrrier protein, holo, phosphopantetheine, transport protein; HET: PNS; NMR {Aspergillus parasiticus} Back     alignment and structure
>2liu_A CURA; holo state, transferase; NMR {Lyngbya majuscula} PDB: 2liw_A* Back     alignment and structure
>2l22_A Mupirocin didomain acyl carrier protein; biosynthetic protein; NMR {Pseudomonas fluorescens} Back     alignment and structure
>2ju1_A Erythronolide synthase; carrier protein domain, modular polyketide synthase, alpha- helical bundle, acyltransferase; NMR {Saccharopolyspora erythraea} PDB: 2ju2_A Back     alignment and structure
>2cg5_B Fatty acid synthase; transferase-hydrolase complex, transferase/hydrolase (comple fatty acid biosynthesis, phosphopantetheine transferase; HET: COA; 2.7A {Homo sapiens} PDB: 2png_A Back     alignment and structure
>4i4d_A Peptide synthetase NRPS type II-PCP; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MLY; 2.10A {Streptomyces verticillus} Back     alignment and structure
>1dny_A Non-ribosomal peptide synthetase peptidyl carrier protein; four-helix bundle, modular enzyme, domain, flexible region; NMR {Brevibacillus brevis} SCOP: a.28.1.2 PDB: 2gdw_A 2gdx_A 2gdy_A 2k2q_A Back     alignment and structure
>2l22_A Mupirocin didomain acyl carrier protein; biosynthetic protein; NMR {Pseudomonas fluorescens} Back     alignment and structure
>3tej_A Enterobactin synthase component F; nonribosomal peptide, thioesterase, carrier domain, ATP- BIN enterobactin biosynthesis, ION transport, iron; HET: UF0; 1.90A {Escherichia coli} PDB: 2roq_A Back     alignment and structure
>2cq8_A 10-formyltetrahydrofolate dehydrogenase; 10-FTHFDH, PP-binding, acyl carrier protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2jgp_A Tyrocidine synthetase 3; multifunctional enzyme, antibiotic biosynthesis, condensatio domain, peptide bond formation, ligase; 1.85A {Brevibacillus brevis} Back     alignment and structure
>2fq1_A Isochorismatase; ENTB, NRPS, multi-domain, ACP, hydrolase; 2.30A {Escherichia coli} Back     alignment and structure
>2vsq_A Surfactin synthetase subunit 3; ligase, peptidyl carrier protein, ligase phosphoprotein, TER module, phosphopantetheine; 2.60A {Bacillus subtilis} Back     alignment and structure
>4f6l_B AUSA reductase domain protein; thioester reductase, oxidoreductase; 3.86A {Staphylococcus aureus} Back     alignment and structure
>3rg2_A Enterobactin synthase component E (ENTE), 2,3-DIH dihydroxybenzoate synthetase, isochroismatase...; adenylate-forming enzymes, ANL superfamily; HET: SVS PNS; 3.10A {Escherichia coli} Back     alignment and structure
>4dg8_A PA1221; ANL superfamily, adenylation domain, peptidyl carrier protei ribosomal peptide synthetase, NRPS, valine adenylation, LIG; HET: AMP; 2.15A {Pseudomonas aeruginosa} PDB: 4dg9_A* Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure
>2px6_A Thioesterase domain; thioesaterse domain, orlistat, fatty acid synthase, drug complex, tetrahydrolipstatin, transferase; HET: DH9; 2.30A {Homo sapiens} Back     alignment and structure
>1dd4_C 50S ribosomal protein L7/L12; dimer formation, flexibility, hinge region, four-helix- bundle, five-helix- bundle, alpha-beta structure; HET: TBR; 2.40A {Thermotoga maritima} SCOP: a.108.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 124
d1t8ka_77 a.28.1.1 (A:) Acyl carrier protein {Escherichia co 2e-16
d1f80d_74 a.28.1.1 (D:) Acyl carrier protein {Bacillus subti 8e-16
d1dv5a_80 a.28.1.3 (A:) apo-D-alanyl carrier protein {Lactob 2e-13
d1klpa_115 a.28.1.1 (A:) Acyl carrier protein {Mycobacterium 2e-13
d1vkua_85 a.28.1.1 (A:) Acyl carrier protein {Thermotoga mar 1e-11
d1or5a_82 a.28.1.1 (A:) Frenolicin polyketide synthase acyl 9e-08
d1nq4a_95 a.28.1.1 (A:) Oxytetracycline polyketide synthase 1e-07
d2af8a_86 a.28.1.1 (A:) Actinorhodin polyketide synthase acy 8e-07
d2pnga176 a.28.1.1 (A:1-76) Type I fatty acid synthase ACP d 5e-06
d2jq4a183 a.28.1.1 (A:1-83) Hypothetical protein Atu2571 {Ag 1e-05
>d1t8ka_ a.28.1.1 (A:) Acyl carrier protein {Escherichia coli [TaxId: 562]} Length = 77 Back     information, alignment and structure

class: All alpha proteins
fold: Acyl carrier protein-like
superfamily: ACP-like
family: Acyl-carrier protein (ACP)
domain: Acyl carrier protein
species: Escherichia coli [TaxId: 562]
 Score = 66.3 bits (162), Expect = 2e-16
 Identities = 35/74 (47%), Positives = 46/74 (62%)

Query: 47  EVIDRVLSVVKCFPKVDPSQVTPDVHFQKDLGLDSLDNVEIVMALEEEFKLEIPDKEAVR 106
            + +RV  ++     V   +VT +  F +DLG DSLD VE+VMALEEEF  EIPD+EA +
Sbjct: 2   TIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEAEK 61

Query: 107 IDACNLAIEYIYNH 120
           I     AI+YI  H
Sbjct: 62  ITTVQAAIDYINGH 75


>d1f80d_ a.28.1.1 (D:) Acyl carrier protein {Bacillus subtilis [TaxId: 1423]} Length = 74 Back     information, alignment and structure
>d1dv5a_ a.28.1.3 (A:) apo-D-alanyl carrier protein {Lactobacillus casei [TaxId: 1582]} Length = 80 Back     information, alignment and structure
>d1klpa_ a.28.1.1 (A:) Acyl carrier protein {Mycobacterium tuberculosis [TaxId: 1773]} Length = 115 Back     information, alignment and structure
>d1vkua_ a.28.1.1 (A:) Acyl carrier protein {Thermotoga maritima [TaxId: 2336]} Length = 85 Back     information, alignment and structure
>d1or5a_ a.28.1.1 (A:) Frenolicin polyketide synthase acyl carrier protein, Fren ACP {Streptomyces roseofulvus [TaxId: 33902]} Length = 82 Back     information, alignment and structure
>d1nq4a_ a.28.1.1 (A:) Oxytetracycline polyketide synthase acyl carrier {Streptomyces rimosus [TaxId: 1927]} Length = 95 Back     information, alignment and structure
>d2af8a_ a.28.1.1 (A:) Actinorhodin polyketide synthase acyl carrier protein, ACT ACP {Streptomyces coelicolor, A3(2) [TaxId: 1902]} Length = 86 Back     information, alignment and structure
>d2pnga1 a.28.1.1 (A:1-76) Type I fatty acid synthase ACP domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 76 Back     information, alignment and structure
>d2jq4a1 a.28.1.1 (A:1-83) Hypothetical protein Atu2571 {Agrobacterium tumefaciens [TaxId: 358]} Length = 83 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query124
d1t8ka_77 Acyl carrier protein {Escherichia coli [TaxId: 562 99.82
d1vkua_85 Acyl carrier protein {Thermotoga maritima [TaxId: 99.77
d1f80d_74 Acyl carrier protein {Bacillus subtilis [TaxId: 14 99.77
d1klpa_115 Acyl carrier protein {Mycobacterium tuberculosis [ 99.75
d1dv5a_80 apo-D-alanyl carrier protein {Lactobacillus casei 99.7
d2af8a_86 Actinorhodin polyketide synthase acyl carrier prot 99.67
d1nq4a_95 Oxytetracycline polyketide synthase acyl carrier { 99.66
d1or5a_82 Frenolicin polyketide synthase acyl carrier protei 99.56
d2jq4a183 Hypothetical protein Atu2571 {Agrobacterium tumefa 99.54
d2gdwa176 Peptidyl carrier protein (PCP), thioester domain { 99.31
d2pnga176 Type I fatty acid synthase ACP domain {Rat (Rattus 99.25
d2gyc3147 Ribosomal protein L7/12, oligomerisation (N-termin 90.4
d1v32a_101 Hypothetical protein AT5G08430 (rafl09-47-k03) {Th 80.51
>d1t8ka_ a.28.1.1 (A:) Acyl carrier protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All alpha proteins
fold: Acyl carrier protein-like
superfamily: ACP-like
family: Acyl-carrier protein (ACP)
domain: Acyl carrier protein
species: Escherichia coli [TaxId: 562]
Probab=99.82  E-value=1.3e-20  Score=119.41  Aligned_cols=76  Identities=46%  Similarity=0.670  Sum_probs=72.5

Q ss_pred             HHHHHHHHHHhhcCCCCCCCCCCCCCcccccCCChhhHHHHHHHHHHHhCCccChhhcccCccHHHHHHHHHcCCC
Q 033233           47 EVIDRVLSVVKCFPKVDPSQVTPDVHFQKDLGLDSLDNVEIVMALEEEFKLEIPDKEAVRIDACNLAIEYIYNHPM  122 (124)
Q Consensus        47 ei~~~l~~il~e~l~v~~~~I~~dt~l~~dLGlDSL~~veli~~lEe~fgI~I~~~~l~~~~Tv~dlv~~I~~~~~  122 (124)
                      +|.++|++++++.+|+++++|+++++|.++||||||++++++..+|++||++||++++.++.|++++++||.++++
T Consensus         2 ~I~~~v~~iia~~l~i~~~~i~~~~~l~~dLg~DSl~~~el~~~iE~~f~i~i~~~~~~~~~Tv~dlv~~i~~~~A   77 (77)
T d1t8ka_           2 TIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEAEKITTVQAAIDYINGHQA   77 (77)
T ss_dssp             CHHHHHHHHHHHHHTCCGGGCCTTCBTTTTTCCCHHHHHHHHHHHHHHHTCCCCHHHHTTCCBHHHHHHHHHHTCC
T ss_pred             cHHHHHHHHHHHHHCCCHHHcCCCCcchhccccchhHHHHHHHHHHHHhCCCCCHHHHHhCCCHHHHHHHHHHccC
Confidence            4789999999999999999999999998789999999999999999999999999999999999999999998864



>d1vkua_ a.28.1.1 (A:) Acyl carrier protein {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1f80d_ a.28.1.1 (D:) Acyl carrier protein {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1klpa_ a.28.1.1 (A:) Acyl carrier protein {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1dv5a_ a.28.1.3 (A:) apo-D-alanyl carrier protein {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d2af8a_ a.28.1.1 (A:) Actinorhodin polyketide synthase acyl carrier protein, ACT ACP {Streptomyces coelicolor, A3(2) [TaxId: 1902]} Back     information, alignment and structure
>d1nq4a_ a.28.1.1 (A:) Oxytetracycline polyketide synthase acyl carrier {Streptomyces rimosus [TaxId: 1927]} Back     information, alignment and structure
>d1or5a_ a.28.1.1 (A:) Frenolicin polyketide synthase acyl carrier protein, Fren ACP {Streptomyces roseofulvus [TaxId: 33902]} Back     information, alignment and structure
>d2jq4a1 a.28.1.1 (A:1-83) Hypothetical protein Atu2571 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2gdwa1 a.28.1.2 (A:8-83) Peptidyl carrier protein (PCP), thioester domain {Bacillus brevis [TaxId: 1393]} Back     information, alignment and structure
>d2pnga1 a.28.1.1 (A:1-76) Type I fatty acid synthase ACP domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2gyc31 a.108.1.1 (3:2-48) Ribosomal protein L7/12, oligomerisation (N-terminal) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v32a_ a.42.1.1 (A:) Hypothetical protein AT5G08430 (rafl09-47-k03) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure